F403776

General Info

Members Datasets Scaffolds Average Seq Length
316 157 632 346

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0016336|Ga0395905_0016336_2179_3345
Length 388
Sequence MKIANIVGARPQFVKAAVVSRALRAAPGVDEVILHTGQHYDANMSQCFFDELQMPAPKYHLAIGSGPHGMQTGRMLERIERALSEITPDRVLVYGDTNTTLAGALAAAKMHLPLAHIEAGLRSWNRAMPEEINRVVADHVADLLFAPTKRAAKNLAAEGIPNDRIEVVGDVMFDVALQYSAPAESRSVILQELGVDEYVLATVHRVENTDDRKRLSNILSALADLAEDIAVVLPLHPRTEAKLKQANMLNLNWTRIRMIPAVSYLDMLKLERNARLIATDSGGVQKEAFFFKVPCVTMRKETEWTELVEAGWNRLADPSSKESVLAVLQSALNANVPDRRPSIFGSGHSAELIAQILLGKGAAPTPPDDLTRKVDPSQRDVIETVKSQ

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
77 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
92 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
96 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.44
Rhizosphere 89.24
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0016336 3300037471 Bacteria 7053
2 Ga0070658_10054241 3300005327 Bacteria 3255
3 Ga0070683_100092621 3300005329 Bacteria 2839
4 Ga0070683_100093261 3300005329 Bacteria 2829
5 Ga0070680_100002261 3300005336 Bacteria 14233
6 Ga0070680_100172930 3300005336 Bacteria 1818
7 Ga0068868_100083147 3300005338 Bacteria 2569
8 Ga0070661_100025917 3300005344 Bacteria 4214
9 Ga0070703_10001730 3300005406 Bacteria 6474
10 Ga0070709_10022981 3300005434 Bacteria 3655
11 Ga0070714_100410379 3300005435 Bacteria 1282
12 Ga0070713_100013156 3300005436 Bacteria 6099
13 Ga0070711_100146263 3300005439 Bacteria 1778
14 Ga0070700_100132707 3300005441 Bacteria 1683
15 Ga0070708_100005926 3300005445 Bacteria 9716
16 Ga0070708_100027820 3300005445 Bacteria 4856
17 Ga0070708_100029775 3300005445 Bacteria 4712
18 Ga0070706_100107155 3300005467 Bacteria 2600
19 Ga0070706_100266823 3300005467 Bacteria 1598
20 Ga0070707_100001530 3300005468 Bacteria 22503
21 Ga0070707_100144917 3300005468 Bacteria 2312
22 Ga0070707_100386383 3300005468 Bacteria 1359
23 Ga0070699_100386190 3300005518 Bacteria 1265
24 Ga0070679_100204430 3300005530 Bacteria 1939
25 Ga0070684_100096699 3300005535 Bacteria 2633
26 Ga0070697_100193325 3300005536 Bacteria 1727
27 Ga0070704_100054280 3300005549 Bacteria 2835
28 Ga0070664_100347982 3300005564 Bacteria 1347
29 Ga0068857_100042185 3300005577 Bacteria 4046
30 Ga0068857_100392278 3300005577 Bacteria 1291
31 Ga0068856_100129024 3300005614 Bacteria 2533
32 Ga0068856_100343687 3300005614 Bacteria 1510
33 Ga0081455_10005491 3300005937 Bacteria 13900
34 Ga0081455_10027190 3300005937 Bacteria 5244
35 Ga0081455_10051788 3300005937 Bacteria 3519
36 Ga0081455_10120492 3300005937 Bacteria 2068
37 Ga0081538_10000908 3300005981 Bacteria 31991
38 Ga0081538_10001619 3300005981 Bacteria 23088
39 Ga0081538_10022041 3300005981 Bacteria 4627
40 Ga0081538_10041674 3300005981 Bacteria 2909
41 Ga0081538_10044929 3300005981 Bacteria 2746
42 Ga0081540_1003927 3300005983 Bacteria 11564
43 Ga0081540_1061651 3300005983 Bacteria 1787
44 Ga0070716_100022458 3300006173 Bacteria 3335
45 Ga0070716_100181946 3300006173 Bacteria 1381
46 Ga0070712_100015465 3300006175 Bacteria 4917
47 Ga0070712_100154830 3300006175 Bacteria 1764
48 Ga0075428_100003350 3300006844 Bacteria 17538
49 Ga0075428_100020834 3300006844 Bacteria 7259
50 Ga0075428_100056996 3300006844 Bacteria 4278
51 Ga0075430_100054384 3300006846 Bacteria 3368
52 Ga0075430_100117419 3300006846 Bacteria 2218
53 Ga0075431_100016259 3300006847 Bacteria 7548
54 Ga0075433_10074485 3300006852 Bacteria 2988
55 Ga0075433_10242052 3300006852 Bacteria 1601
56 Ga0075434_100023950 3300006871 Bacteria 5960
57 Ga0075434_100102190 3300006871 Bacteria 2874
58 Ga0075429_100026226 3300006880 Bacteria 5058
59 Ga0075435_100108048 3300007076 Bacteria 2311
60 Ga0111539_10028063 3300009094 Bacteria 6871
61 Ga0111539_10340956 3300009094 Bacteria 1744
62 Ga0105245_10235801 3300009098 Bacteria 1771
63 Ga0105245_10275280 3300009098 Bacteria 1643
64 Ga0114129_10014244 3300009147 Bacteria 11332
65 Ga0114129_10079555 3300009147 Bacteria 4557
66 Ga0114129_10241107 3300009147 Bacteria 2430
67 Ga0114129_10751486 3300009147 Bacteria 1248
68 Ga0105242_10317046 3300009176 Bacteria 1429
69 Ga0157371_10038992 3300013102 Unclassified 3398
70 Ga0157371_10061418 3300013102 Bacteria 2664
71 Ga0157370_10004652 3300013104 Bacteria 15680
72 Ga0163162_10006177 3300013306 Bacteria 11607
73 Ga0157372_10001724 3300013307 Bacteria 23724
74 Ga0206353_10181333 3300020082 Bacteria 11098
75 Ga0206353_11225562 3300020082 Bacteria 3888
76 Ga0207692_10107316 3300025898 Bacteria 1543
77 Ga0207699_10240359 3300025906 Bacteria 1244
78 Ga0207699_10288263 3300025906 Bacteria 1143
79 Ga0207705_10063949 3300025909 Bacteria 2659
80 Ga0207705_10122979 3300025909 Bacteria 1927
81 Ga0207707_10081694 3300025912 Bacteria 2821
82 Ga0207693_10002067 3300025915 Bacteria 17543
83 Ga0207693_10143234 3300025915 Bacteria 1879
84 Ga0207660_10075917 3300025917 Bacteria 2456
85 Ga0207660_10415793 3300025917 Bacteria 1084
86 Ga0207657_10000964 3300025919 Bacteria 30488
87 Ga0207649_10032593 3300025920 Bacteria 3108
88 Ga0207646_10004153 3300025922 Bacteria 15887
89 Ga0207700_10000012 3300025928 Bacteria 231712
90 Ga0207664_10429937 3300025929 Bacteria 1177
91 Ga0207665_10008368 3300025939 Bacteria 6825
92 Ga0207665_10167948 3300025939 Bacteria 1582
93 Ga0207665_10204076 3300025939 Bacteria 1441
94 Ga0207661_10052007 3300025944 Bacteria 3271
95 Ga0207661_10175955 3300025944 Bacteria 1866
96 Ga0207667_10116255 3300025949 Bacteria 2756
97 Ga0207667_10270665 3300025949 Bacteria 1737
98 Ga0207668_10087309 3300025972 Bacteria 2281
99 Ga0207708_10098270 3300026075 Bacteria 2263
100 Ga0207702_10290836 3300026078 Bacteria 1548
101 Ga0207702_10334077 3300026078 Bacteria 1446
102 Ga0207674_10024146 3300026116 Bacteria 6500
103 Ga0207674_10048263 3300026116 Bacteria 4358
104 Ga0207674_10377907 3300026116 Bacteria 1370
105 Ga0207675_100245683 3300026118 Bacteria 1731
106 Ga0207428_10006517 3300027907 Bacteria 10771
107 Ga0207428_10030995 3300027907 Bacteria 4418
108 Ga0207428_10296650 3300027907 Bacteria 1197
109 Ga0265338_10005886 3300028800 Bacteria 15814
110 Ga0265340_10018223 3300031247 Bacteria 3624
111 Ga0265327_10006685 3300031251 Bacteria 9134
112 Ga0265313_10014058 3300031595 Bacteria 4762
113 Ga0265314_10003285 3300031711 Bacteria 15795
114 Ga0265342_10047086 3300031712 Bacteria 2589
115 Ga0395899_0005536 3300037312 Bacteria 9782
116 Ga0395900_0054377 3300037418 Bacteria 4122
117 Ga0395898_0091081 3300037466 Bacteria 2934
118 Ga0395898_0268048 3300037466 Bacteria 1628
119 Ga0395901_0065528 3300038443 Bacteria 3782
120 Ga0395901_0164993 3300038443 Bacteria 2326
121 Ga0395901_0626511 3300038443 Bacteria 1082
122 Ga0436363_0411041 3300039450 Bacteria 1791
123 Ga0439448_0053575 3300042005 Bacteria 1324
124 Ga0439455_0006164 3300042012 Bacteria 2476
125 Ga0466961_0027176 3300044693 Bacteria 3679
126 Ga0466963_0002724 3300044694 Bacteria 9966
127 Ga0466963_0003331 3300044694 Bacteria 9162
128 Ga0466963_0004476 3300044694 Bacteria 8129
129 Ga0466963_0010321 3300044694 Bacteria 5652
130 Ga0466963_0151837 3300044694 Bacteria 1609
131 Ga0466964_0002806 3300044706 Bacteria 6270
132 Ga0466964_0057333 3300044706 Bacteria 1612
133 Ga0466971_0004425 3300044719 Bacteria 6062
134 Ga0466968_0019237 3300044735 Bacteria 2748
135 Ga0466957_0007123 3300044842 Bacteria 6321
136 Ga0466957_0206180 3300044842 Bacteria 1293
137 Ga0466959_0015941 3300045049 Bacteria 5483
138 Ga0451576_0022075 3300045051 Bacteria 6907
139 Ga0466958_0003543 3300045836 Bacteria 8118
140 Ga0466958_0017759 3300045836 Bacteria 4119
141 Ga0466958_0164781 3300045836 Bacteria 1402
142 Ga0466967_0002026 3300045976 Bacteria 12356
143 Ga0466967_0008519 3300045976 Bacteria 7526
144 Ga0466967_0008982 3300045976 Bacteria 7383
145 Ga0466967_0009492 3300045976 Bacteria 7223
146 Ga0466967_0026916 3300045976 Bacteria 4774
147 Ga0466967_0053879 3300045976 Bacteria 3537
148 Ga0466967_0210159 3300045976 Bacteria 1845
149 Ga0466967_0315381 3300045976 Bacteria 1507
150 Ga0495585_0133796 3300046492 Archaea 1303
151 Ga0495607_0114494 3300046501 Bacteria 1425
152 Ga0495630_0111274 3300046517 Bacteria 2074
153 Ga0495637_0049195 3300046520 Bacteria 1772
154 Ga0495598_0040270 3300046537 Archaea 1362
155 Ga0495668_0104928 3300046616 Bacteria 1546
156 Ga0495635_0007138 3300046663 Bacteria 7809
157 Ga0495670_0051328 3300046691 Bacteria 2064
158 Ga0495589_0074003 3300046794 Bacteria 1662
159 Ga0495660_0151593 3300046810 Archaea 1144
160 Ga0495680_0202569 3300047322 Bacteria 1423
161 Ga0496100_0040413 3300048903 Bacteria 2967
162 Ga0496100_0110455 3300048903 Bacteria 1909
163 Ga0496101_0011369 3300048904 Bacteria 5904
164 Ga0496101_0047046 3300048904 Bacteria 3096
165 Ga0496102_0005963 3300048905 Bacteria 10379
166 Ga0496103_0018667 3300048906 Bacteria 4161
167 Ga0496104_0008026 3300048907 Bacteria 9361
168 Ga0496105_0000413 3300048908 Bacteria 28035
169 Ga0496105_0250898 3300048908 Bacteria 1434
170 Ga0496106_0011644 3300048909 Bacteria 6501
171 Ga0496106_0016374 3300048909 Bacteria 5486
172 Ga0496106_0036029 3300048909 Bacteria 3701
173 Ga0496108_0027437 3300048911 Bacteria 4702
174 Ga0496108_0181256 3300048911 Bacteria 1824
175 Ga0496109_0005379 3300048912 Bacteria 10699
176 Ga0496109_0019462 3300048912 Bacteria 5989
177 Ga0496110_0003689 3300048913 Bacteria 11787
178 Ga0496110_0030508 3300048913 Bacteria 4648
179 Ga0496110_0063401 3300048913 Bacteria 3266
180 Ga0496110_0132380 3300048913 Bacteria 2252
181 Ga0496110_0195977 3300048913 Bacteria 1834
182 Ga0496111_0000599 3300048914 Bacteria 19006
183 Ga0496111_0055980 3300048914 Bacteria 2853
184 Ga0496111_0151120 3300048914 Bacteria 1722
185 Ga0496112_0000307 3300048915 Bacteria 31590
186 Ga0496112_0021600 3300048915 Bacteria 6123
187 Ga0496112_0331850 3300048915 Bacteria 1465
188 Ga0496112_0431309 3300048915 Bacteria 1256
189 Ga0496113_0001897 3300048916 Bacteria 11933
190 Ga0496113_0040532 3300048916 Bacteria 3432
191 Ga0496113_0262888 3300048916 Bacteria 1379
192 Ga0496114_0023636 3300048917 Bacteria 5016
193 Ga0496115_0056922 3300048918 Bacteria 3143
194 Ga0501031_0001441 3300049568 Bacteria 14760
195 Ga0501032_0001182 3300049569 Bacteria 20907
196 Ga0501032_0098315 3300049569 Bacteria 1939
197 Ga0501033_0001160 3300049570 Bacteria 23837
198 Ga0501033_0058160 3300049570 Bacteria 2856
199 Ga0501034_0012424 3300049571 Bacteria 8794
200 Ga0501036_0001095 3300049572 Bacteria 20542
201 Ga0501036_0015927 3300049572 Bacteria 6279
202 Ga0501036_0089287 3300049572 Bacteria 2604
203 Ga0501037_0000453 3300049573 Bacteria 33413
204 Ga0501038_0002315 3300049574 Bacteria 17712
205 Ga0501038_0071886 3300049574 Bacteria 2933
206 Ga0501039_0012167 3300049575 Bacteria 6561
207 Ga0501039_0022809 3300049575 Bacteria 4801
208 Ga0501039_0033744 3300049575 Bacteria 3948
209 Ga0501040_0000039 3300049576 Bacteria 59106
210 Ga0501040_0001948 3300049576 Bacteria 13284
211 Ga0501040_0012962 3300049576 Bacteria 5479
212 Ga0501040_0034320 3300049576 Bacteria 3437
213 Ga0501041_0000291 3300049577 Bacteria 24200
214 Ga0501042_0000258 3300049578 Bacteria 25888
215 Ga0501042_0003076 3300049578 Bacteria 10387
216 Ga0501042_0007490 3300049578 Bacteria 7153
217 Ga0501043_0003344 3300049579 Bacteria 13212
218 Ga0501043_0004317 3300049579 Bacteria 11571
219 Ga0501046_0004795 3300049580 Bacteria 12192
220 Ga0501046_0023719 3300049580 Bacteria 5042
221 Ga0501046_0045295 3300049580 Bacteria 3495
222 Ga0501046_0057154 3300049580 Bacteria 3061
223 Ga0501047_0003304 3300049581 Bacteria 15268
224 Ga0501047_0095419 3300049581 Bacteria 2853
225 Ga0501047_0358110 3300049581 Bacteria 1295
226 Ga0501048_0001713 3300049582 Bacteria 16721
227 Ga0501048_0006992 3300049582 Bacteria 8573
228 Ga0501048_0091578 3300049582 Bacteria 2144
229 Ga0501067_0000840 3300049583 Bacteria 16557
230 Ga0501067_0022019 3300049583 Bacteria 3526
231 Ga0501068_0000990 3300049584 Bacteria 14932
232 Ga0501068_0023692 3300049584 Bacteria 3599
233 Ga0501068_0054376 3300049584 Bacteria 2425
234 Ga0501068_0082083 3300049584 Bacteria 1979
235 Ga0501069_0000751 3300049585 Bacteria 15127
236 Ga0501069_0015641 3300049585 Bacteria 4068
237 Ga0501069_0022266 3300049585 Bacteria 3445
238 Ga0501070_0000221 3300049586 Bacteria 54147
239 Ga0501070_0031242 3300049586 Bacteria 4461
240 Ga0501070_0050950 3300049586 Bacteria 3436
241 Ga0501070_0063202 3300049586 Bacteria 3066
242 Ga0501070_0124774 3300049586 Bacteria 2128
243 Ga0501070_0284601 3300049586 Bacteria 1348
244 Ga0501071_0000001 3300049587 Bacteria 123952
245 Ga0501071_0039691 3300049587 Bacteria 3368
246 Ga0501071_0130533 3300049587 Bacteria 1866
247 Ga0501071_0244999 3300049587 Bacteria 1352
248 Ga0501072_0000837 3300049588 Bacteria 22627
249 Ga0501072_0001579 3300049588 Bacteria 17015
250 Ga0501072_0003508 3300049588 Bacteria 11819
251 Ga0501072_0018440 3300049588 Bacteria 5374
252 Ga0501072_0093328 3300049588 Bacteria 2390
253 Ga0501072_0207237 3300049588 Bacteria 1563
254 Ga0501073_0014543 3300049589 Bacteria 5717
255 Ga0501073_0170215 3300049589 Bacteria 1508
256 Ga0501074_0001717 3300049590 Bacteria 14954
257 Ga0501074_0005376 3300049590 Bacteria 9216
258 Ga0501074_0013708 3300049590 Bacteria 5892
259 Ga0501074_0022467 3300049590 Bacteria 4583
260 Ga0501074_0086081 3300049590 Bacteria 2251
261 Ga0501075_0000075 3300049591 Bacteria 44277
262 Ga0501075_0055108 3300049591 Bacteria 2991
263 Ga0501076_0000129 3300049592 Bacteria 41999
264 Ga0501076_0001493 3300049592 Bacteria 15680
265 Ga0501076_0004691 3300049592 Bacteria 9745
266 Ga0501076_0048217 3300049592 Bacteria 3367
267 Ga0501076_0090795 3300049592 Bacteria 2457
268 Ga0501077_0001211 3300049593 Bacteria 15601
269 Ga0501077_0090805 3300049593 Bacteria 1935
270 Ga0501077_0106752 3300049593 Bacteria 1774
271 Ga0501079_0000577 3300049741 Bacteria 24242
272 Ga0501079_0000736 3300049741 Bacteria 22171
273 Ga0501079_0000756 3300049741 Bacteria 22006
274 Ga0501079_0014403 3300049741 Bacteria 6029
275 Ga0501079_0115115 3300049741 Bacteria 2090
276 Ga0501079_0124011 3300049741 Bacteria 2009
277 Ga0501080_0000431 3300049742 Bacteria 32377
278 Ga0501081_0000883 3300049743 Bacteria 17712
279 Ga0501081_0004607 3300049743 Bacteria 8849
280 Ga0501081_0046254 3300049743 Bacteria 2990
281 Ga0501081_0091416 3300049743 Bacteria 2140
282 Ga0501083_0000058 3300049744 Bacteria 78835
283 Ga0501083_0002621 3300049744 Bacteria 12392
284 Ga0501083_0035950 3300049744 Bacteria 3381
285 Ga0501083_0055523 3300049744 Bacteria 2655
286 Ga0501083_0101783 3300049744 Bacteria 1894
287 Ga0501035_0000990 3300049822 Bacteria 30014
288 Ga0501035_0194681 3300049822 Bacteria 1741
289 Ga0501045_0002378 3300049824 Bacteria 12771
290 Ga0501045_0032027 3300049824 Bacteria 3808
291 Ga0501045_0059044 3300049824 Bacteria 2809
292 Ga0501045_0137559 3300049824 Bacteria 1816
293 nmdc:mga05p37_4602_c1 3300050507 Bacteria 16126
294 nmdc:mga05p37_79706_c1 3300050507 Bacteria 4032
295 nmdc:mga09592_4653_c1 3300050508 Bacteria 11113
296 nmdc:mga0qj67_13777_c2 3300050509 Bacteria 5185
297 nmdc:mga0qj67_76750_c1 3300050509 Bacteria 2673
298 nmdc:mga08y16_28815_c1 3300050511 Bacteria 5853
299 nmdc:mga0n895_13300_c1 3300050512 Bacteria 7420
300 nmdc:mga0rr50_15396_c1 3300050513 Bacteria 5048
301 nmdc:mga0a205_372774_c1 3300050515 Bacteria 1293
302 nmdc:mga0a205_379632_c1 3300050515 Bacteria 1279
303 Ga0495619_0011997 3300053085 Bacteria 5459
304 Ga0501084_0000824 3300054114 Bacteria 23857
305 Ga0501084_0008900 3300054114 Bacteria 8306
306 Ga0501084_0010790 3300054114 Bacteria 7562
307 Ga0501084_0112676 3300054114 Bacteria 2285
308 Ga0501084_0160283 3300054114 Bacteria 1898
309 Ga0501082_0001676 3300060353 Bacteria 19540
310 Ga0501082_0010982 3300060353 Bacteria 7791
311 Ga0501082_0066279 3300060353 Bacteria 3109
312 Ga0501082_0066972 3300060353 Bacteria 3092
313 Ga0466962_0000333 3300061719 Bacteria 20176
314 Ga0530510_0000423 3300061734 Bacteria 27287
315 Ga0530510_0001330 3300061734 Bacteria 16535
316 Ga0530510_0040372 3300061734 Bacteria 3367
317 Ga0395905_0016336
318 Ga0070658_10054241
319 Ga0070683_100092621
320 Ga0070683_100093261
321 Ga0070680_100002261
322 Ga0070680_100172930
323 Ga0068868_100083147
324 Ga0070661_100025917
325 Ga0070703_10001730
326 Ga0070709_10022981
327 Ga0070714_100410379
328 Ga0070713_100013156
329 Ga0070711_100146263
330 Ga0070700_100132707
331 Ga0070708_100005926
332 Ga0070708_100027820
333 Ga0070708_100029775
334 Ga0070706_100107155
335 Ga0070706_100266823
336 Ga0070707_100001530
337 Ga0070707_100144917
338 Ga0070707_100386383
339 Ga0070699_100386190
340 Ga0070679_100204430
341 Ga0070684_100096699
342 Ga0070697_100193325
343 Ga0070704_100054280
344 Ga0070664_100347982
345 Ga0068857_100042185
346 Ga0068857_100392278
347 Ga0068856_100129024
348 Ga0068856_100343687
349 Ga0081455_10005491
350 Ga0081455_10027190
351 Ga0081455_10051788
352 Ga0081455_10120492
353 Ga0081538_10000908
354 Ga0081538_10001619
355 Ga0081538_10022041
356 Ga0081538_10041674
357 Ga0081538_10044929
358 Ga0081540_1003927
359 Ga0081540_1061651
360 Ga0070716_100022458
361 Ga0070716_100181946
362 Ga0070712_100015465
363 Ga0070712_100154830
364 Ga0075428_100003350
365 Ga0075428_100020834
366 Ga0075428_100056996
367 Ga0075430_100054384
368 Ga0075430_100117419
369 Ga0075431_100016259
370 Ga0075433_10074485
371 Ga0075433_10242052
372 Ga0075434_100023950
373 Ga0075434_100102190
374 Ga0075429_100026226
375 Ga0075435_100108048
376 Ga0111539_10028063
377 Ga0111539_10340956
378 Ga0105245_10235801
379 Ga0105245_10275280
380 Ga0114129_10014244
381 Ga0114129_10079555
382 Ga0114129_10241107
383 Ga0114129_10751486
384 Ga0105242_10317046
385 Ga0157371_10038992
386 Ga0157371_10061418
387 Ga0157370_10004652
388 Ga0163162_10006177
389 Ga0157372_10001724
390 Ga0206353_10181333
391 Ga0206353_11225562
392 Ga0207692_10107316
393 Ga0207699_10240359
394 Ga0207699_10288263
395 Ga0207705_10063949
396 Ga0207705_10122979
397 Ga0207707_10081694
398 Ga0207693_10002067
399 Ga0207693_10143234
400 Ga0207660_10075917
401 Ga0207660_10415793
402 Ga0207657_10000964
403 Ga0207649_10032593
404 Ga0207646_10004153
405 Ga0207700_10000012
406 Ga0207664_10429937
407 Ga0207665_10008368
408 Ga0207665_10167948
409 Ga0207665_10204076
410 Ga0207661_10052007
411 Ga0207661_10175955
412 Ga0207667_10116255
413 Ga0207667_10270665
414 Ga0207668_10087309
415 Ga0207708_10098270
416 Ga0207702_10290836
417 Ga0207702_10334077
418 Ga0207674_10024146
419 Ga0207674_10048263
420 Ga0207674_10377907
421 Ga0207675_100245683
422 Ga0207428_10006517
423 Ga0207428_10030995
424 Ga0207428_10296650
425 Ga0265338_10005886
426 Ga0265340_10018223
427 Ga0265327_10006685
428 Ga0265313_10014058
429 Ga0265314_10003285
430 Ga0265342_10047086
431 Ga0395899_0005536
432 Ga0395900_0054377
433 Ga0395898_0091081
434 Ga0395898_0268048
435 Ga0395901_0065528
436 Ga0395901_0164993
437 Ga0395901_0626511
438 Ga0436363_0411041
439 Ga0439448_0053575
440 Ga0439455_0006164
441 Ga0466961_0027176
442 Ga0466963_0002724
443 Ga0466963_0003331
444 Ga0466963_0004476
445 Ga0466963_0010321
446 Ga0466963_0151837
447 Ga0466964_0002806
448 Ga0466964_0057333
449 Ga0466971_0004425
450 Ga0466968_0019237
451 Ga0466957_0007123
452 Ga0466957_0206180
453 Ga0466959_0015941
454 Ga0451576_0022075
455 Ga0466958_0003543
456 Ga0466958_0017759
457 Ga0466958_0164781
458 Ga0466967_0002026
459 Ga0466967_0008519
460 Ga0466967_0008982
461 Ga0466967_0009492
462 Ga0466967_0026916
463 Ga0466967_0053879
464 Ga0466967_0210159
465 Ga0466967_0315381
466 Ga0495585_0133796
467 Ga0495607_0114494
468 Ga0495630_0111274
469 Ga0495637_0049195
470 Ga0495598_0040270
471 Ga0495668_0104928
472 Ga0495635_0007138
473 Ga0495670_0051328
474 Ga0495589_0074003
475 Ga0495660_0151593
476 Ga0495680_0202569
477 Ga0496100_0040413
478 Ga0496100_0110455
479 Ga0496101_0011369
480 Ga0496101_0047046
481 Ga0496102_0005963
482 Ga0496103_0018667
483 Ga0496104_0008026
484 Ga0496105_0000413
485 Ga0496105_0250898
486 Ga0496106_0011644
487 Ga0496106_0016374
488 Ga0496106_0036029
489 Ga0496108_0027437
490 Ga0496108_0181256
491 Ga0496109_0005379
492 Ga0496109_0019462
493 Ga0496110_0003689
494 Ga0496110_0030508
495 Ga0496110_0063401
496 Ga0496110_0132380
497 Ga0496110_0195977
498 Ga0496111_0000599
499 Ga0496111_0055980
500 Ga0496111_0151120
501 Ga0496112_0000307
502 Ga0496112_0021600
503 Ga0496112_0331850
504 Ga0496112_0431309
505 Ga0496113_0001897
506 Ga0496113_0040532
507 Ga0496113_0262888
508 Ga0496114_0023636
509 Ga0496115_0056922
510 Ga0501031_0001441
511 Ga0501032_0001182
512 Ga0501032_0098315
513 Ga0501033_0001160
514 Ga0501033_0058160
515 Ga0501034_0012424
516 Ga0501036_0001095
517 Ga0501036_0015927
518 Ga0501036_0089287
519 Ga0501037_0000453
520 Ga0501038_0002315
521 Ga0501038_0071886
522 Ga0501039_0012167
523 Ga0501039_0022809
524 Ga0501039_0033744
525 Ga0501040_0000039
526 Ga0501040_0001948
527 Ga0501040_0012962
528 Ga0501040_0034320
529 Ga0501041_0000291
530 Ga0501042_0000258
531 Ga0501042_0003076
532 Ga0501042_0007490
533 Ga0501043_0003344
534 Ga0501043_0004317
535 Ga0501046_0004795
536 Ga0501046_0023719
537 Ga0501046_0045295
538 Ga0501046_0057154
539 Ga0501047_0003304
540 Ga0501047_0095419
541 Ga0501047_0358110
542 Ga0501048_0001713
543 Ga0501048_0006992
544 Ga0501048_0091578
545 Ga0501067_0000840
546 Ga0501067_0022019
547 Ga0501068_0000990
548 Ga0501068_0023692
549 Ga0501068_0054376
550 Ga0501068_0082083
551 Ga0501069_0000751
552 Ga0501069_0015641
553 Ga0501069_0022266
554 Ga0501070_0000221
555 Ga0501070_0031242
556 Ga0501070_0050950
557 Ga0501070_0063202
558 Ga0501070_0124774
559 Ga0501070_0284601
560 Ga0501071_0000001
561 Ga0501071_0039691
562 Ga0501071_0130533
563 Ga0501071_0244999
564 Ga0501072_0000837
565 Ga0501072_0001579
566 Ga0501072_0003508
567 Ga0501072_0018440
568 Ga0501072_0093328
569 Ga0501072_0207237
570 Ga0501073_0014543
571 Ga0501073_0170215
572 Ga0501074_0001717
573 Ga0501074_0005376
574 Ga0501074_0013708
575 Ga0501074_0022467
576 Ga0501074_0086081
577 Ga0501075_0000075
578 Ga0501075_0055108
579 Ga0501076_0000129
580 Ga0501076_0001493
581 Ga0501076_0004691
582 Ga0501076_0048217
583 Ga0501076_0090795
584 Ga0501077_0001211
585 Ga0501077_0090805
586 Ga0501077_0106752
587 Ga0501079_0000577
588 Ga0501079_0000736
589 Ga0501079_0000756
590 Ga0501079_0014403
591 Ga0501079_0115115
592 Ga0501079_0124011
593 Ga0501080_0000431
594 Ga0501081_0000883
595 Ga0501081_0004607
596 Ga0501081_0046254
597 Ga0501081_0091416
598 Ga0501083_0000058
599 Ga0501083_0002621
600 Ga0501083_0035950
601 Ga0501083_0055523
602 Ga0501083_0101783
603 Ga0501035_0000990
604 Ga0501035_0194681
605 Ga0501045_0002378
606 Ga0501045_0032027
607 Ga0501045_0059044
608 Ga0501045_0137559
609 nmdc:mga05p37_4602_c1
610 nmdc:mga05p37_79706_c1
611 nmdc:mga09592_4653_c1
612 nmdc:mga0qj67_13777_c2
613 nmdc:mga0qj67_76750_c1
614 nmdc:mga08y16_28815_c1
615 nmdc:mga0n895_13300_c1
616 nmdc:mga0rr50_15396_c1
617 nmdc:mga0a205_372774_c1
618 nmdc:mga0a205_379632_c1
619 Ga0495619_0011997
620 Ga0501084_0000824
621 Ga0501084_0008900
622 Ga0501084_0010790
623 Ga0501084_0112676
624 Ga0501084_0160283
625 Ga0501082_0001676
626 Ga0501082_0010982
627 Ga0501082_0066279
628 Ga0501082_0066972
629 Ga0466962_0000333
630 Ga0530510_0000423
631 Ga0530510_0001330
632 Ga0530510_0040372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02350

Epimerase_2

UDP-N-acetylglucosamine 2-epimerase

21

358

0.95

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

14

170

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nes-assembly1.cif.gz_A-2 crystal structure of methanocaldococcus jannaschii udp-glcnac 2-epimerase in complex with udp-glcnac and udp 0.9348 1 336
4nes-assembly1.cif.gz_A-2 crystal structure of methanocaldococcus jannaschii udp-glcnac 2-epimerase in complex with udp-glcnac and udp 0.9295 1 336
8sye-assembly1.cif.gz_A x-ray crystal structure of udp-2,3-diacetamido-2,3-dideoxy-glucuronic acid-2-epimerase from thermus thermophilus strain hb27, d98n variant in the presence of udp-2,3-diacetamido-2,3-dideoxy-glucuronic acid and udp at ph 6 0.9216 2 336
8sy0-assembly1.cif.gz_A x-ray crystal structure of udp- 2,3-diacetamido-2,3-dideoxy-glucuronic acid-2-epimerase from thermus thermophilus strain hb27 in complex with its product udp-2,3-diacetamido-2,3-dideoxy-d-mannuronic acid at ph 9 0.9193 2 335
8sye-assembly1.cif.gz_A x-ray crystal structure of udp-2,3-diacetamido-2,3-dideoxy-glucuronic acid-2-epimerase from thermus thermophilus strain hb27, d98n variant in the presence of udp-2,3-diacetamido-2,3-dideoxy-glucuronic acid and udp at ph 6 0.9137 2 336
ID Description Score Start End Superfamily
af_Q58899_3_336_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.947 4 310 3.40.50.2000
af_Q2G1K2_188_329_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9269 187 309 3.40.50.2000
5enzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9115 2 171 3.40.50.2000
af_Q58899_2_184_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9112 3 175 3.40.50.2000
af_P27828_2_186_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8857 3 175 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7V9SUP5-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase 0.9862 1 103 GO:0008761
AF-A0A538ML67-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase (Non-hydrolyzing) (EC 5.1.3.14) 0.9819 1 315 GO:0000271
GO:0008761
GO:0016616
GO:0016628
GO:0051287
AF-A0A7V9SUP5-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase 0.9768 1 103 GO:0008761
AF-A0A538E332-F1-model_v4 UDP-N-acetyl glucosamine 2-epimerase 0.9722 71 336 GO:0008761
AF-A0A7W1S6K4-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase 0.9698 184 336 GO:0008761

Map