F403447

General Info

Members Datasets Scaffolds Average Seq Length
315 200 630 293

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2896253425|2896253851
Length 310
Sequence PAQYREEWQGRVAFITGAVTGIGLGTAQAFADAGMRVALSYRNEDDRAATEKWFADKGYETPLFCKLDVTNRQRFAQVAEEVVDHFGEVHVLVNNAGVSVFGPTDEASYDDYDWIMGVNFGGVVNGLQSFLPRIKASEGRRHVVNVASMAAFLPGPQAGIYTASKFAVRGLTDSLRYNLAPHGIGCSLCCPALTRTNAWASAQKRPEEFADAGFAPPKEGELEQFGTAFEQFGMDPYEVGAKILRGMSQQDGLILTHPEHAIDFTQEFAKQIAALPVEDCPPGRARIEELRRQAGRDAEAGLSVAMDDLT

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
134 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
135 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
136 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
179 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
192 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
197 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
198 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
199 2818991435 Caulobacter henricii 536 Isolate Unclassified
200 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.4
Nodule 0
Rhizoplane 1.9
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000497 3300001979 Bacteria 16878
2 JGI24739J22299_10000214 3300001989 Bacteria 19320
3 JGI24739J22299_10001030 3300001989 Bacteria 10323
4 JGI24737J22298_10000335 3300001990 Bacteria 15729
5 JGI24737J22298_10000367 3300001990 Bacteria 15344
6 JGI24735J21928_10000070 3300002067 Bacteria 42425
7 JGI24735J21928_10001472 3300002067 Bacteria 8324
8 JGI24738J21930_10010240 3300002075 Bacteria 2090
9 rootL2_10026182 3300003322 Bacteria 8823
10 Ga0055531_10003911 3300003794 Bacteria 9298
11 Ga0065165_1000428 3300005262 Bacteria 66075
12 Ga0065165_1017648 3300005262 Bacteria 2619
13 Ga0065715_10198755 3300005293 Bacteria 1373
14 Ga0070658_10000139 3300005327 Bacteria 63781
15 Ga0070658_10032126 3300005327 Bacteria 4220
16 Ga0070683_100005574 3300005329 Bacteria 10513
17 Ga0070677_10011926 3300005333 Bacteria 3007
18 Ga0070680_100024301 3300005336 Bacteria 4839
19 Ga0070680_100202933 3300005336 Bacteria 1672
20 Ga0070680_100486263 3300005336 Bacteria 1055
21 Ga0070682_100065446 3300005337 Bacteria 2310
22 Ga0070660_100052494 3300005339 Bacteria 3143
23 Ga0070660_100294616 3300005339 Bacteria 1329
24 Ga0070691_10025824 3300005341 Bacteria 2737
25 Ga0070669_100098605 3300005353 Bacteria 2201
26 Ga0070674_100503675 3300005356 Bacteria 1009
27 Ga0070659_100043251 3300005366 Bacteria 3523
28 Ga0070659_100081093 3300005366 Bacteria 2591
29 Ga0070709_10003457 3300005434 Bacteria 8476
30 Ga0070709_10023554 3300005434 Unclassified 3618
31 Ga0070714_100019704 3300005435 Bacteria 5500
32 Ga0070713_100458619 3300005436 Bacteria 1198
33 Ga0070681_10007054 3300005458 Bacteria 10939
34 Ga0070681_10008914 3300005458 Bacteria 9859
35 Ga0070681_10052763 3300005458 Unclassified 4056
36 Ga0070681_10556041 3300005458 Unclassified 1061
37 Ga0068867_100093909 3300005459 Bacteria 2280
38 Ga0070679_100027645 3300005530 Bacteria 5584
39 Ga0070684_100145947 3300005535 Bacteria 2142
40 Ga0068853_100011133 3300005539 Bacteria 7297
41 Ga0068853_100121863 3300005539 Bacteria 2327
42 Ga0070665_100005884 3300005548 Bacteria 12563
43 Ga0068855_100004272 3300005563 Bacteria 17445
44 Ga0068855_100008073 3300005563 Bacteria 12719
45 Ga0068855_100009844 3300005563 Bacteria 11532
46 Ga0068855_100021286 3300005563 Bacteria 7775
47 Ga0070664_100028925 3300005564 Bacteria 4616
48 Ga0070664_100031233 3300005564 Bacteria 4449
49 Ga0068857_100018898 3300005577 Bacteria 6047
50 Ga0068857_100019510 3300005577 Bacteria 5955
51 Ga0068854_100000298 3300005578 Bacteria 32863
52 Ga0068854_100085442 3300005578 Bacteria 2337
53 Ga0068856_100002394 3300005614 Bacteria 19290
54 Ga0068856_100003382 3300005614 Bacteria 16154
55 Ga0068856_100017851 3300005614 Bacteria 6883
56 Ga0068856_100149315 3300005614 Bacteria 2346
57 Ga0068856_100330776 3300005614 Bacteria 1541
58 Ga0068856_100391148 3300005614 Bacteria 1410
59 Ga0068852_100000302 3300005616 Bacteria 33181
60 Ga0068852_100000545 3300005616 Bacteria 24656
61 Ga0068852_100018020 3300005616 Bacteria 5554
62 Ga0068861_100000027 3300005719 Bacteria 68738
63 Ga0068851_10002017 3300005834 Bacteria 8951
64 Ga0068858_100000785 3300005842 Bacteria 33219
65 Ga0068862_100014053 3300005844 Bacteria 6641
66 Ga0081455_10000579 3300005937 Bacteria 47717
67 Ga0070712_100227095 3300006175 Bacteria 1481
68 Ga0075369_10093311 3300006186 Bacteria 1345
69 Ga0075428_100041104 3300006844 Bacteria 5086
70 Ga0075428_100098105 3300006844 Bacteria 3194
71 Ga0075430_100034937 3300006846 Bacteria 4268
72 Ga0075431_100011120 3300006847 Bacteria 9060
73 Ga0075431_100144522 3300006847 Bacteria 2451
74 Ga0075431_100461658 3300006847 Bacteria 1264
75 Ga0105240_10002755 3300009093 Bacteria 27775
76 Ga0105240_10010146 3300009093 Bacteria 13262
77 Ga0105240_10043792 3300009093 Bacteria 5692
78 Ga0105240_10087579 3300009093 Unclassified 3813
79 Ga0105240_10105215 3300009093 Unclassified 3426
80 Ga0105240_10117862 3300009093 Unclassified 3201
81 Ga0111539_10025895 3300009094 Bacteria 7181
82 Ga0111539_10052231 3300009094 Bacteria 4866
83 Ga0105241_10029336 3300009174 Bacteria 4104
84 Ga0105241_10224284 3300009174 Bacteria 1581
85 Ga0105237_10026726 3300009545 Bacteria 5898
86 Ga0105237_10032442 3300009545 Bacteria 5288
87 Ga0105237_10126119 3300009545 Unclassified 2554
88 Ga0105238_10021648 3300009551 Bacteria 6549
89 Ga0105238_10036050 3300009551 Bacteria 5028
90 Ga0105238_10110341 3300009551 Bacteria 2731
91 Ga0105249_10361488 3300009553 Unclassified 1473
92 Ga0105239_10012505 3300010375 Bacteria 9453
93 Ga0157373_10016340 3300013100 Bacteria 5414
94 Ga0157371_10003894 3300013102 Bacteria 13298
95 Ga0157371_10037314 3300013102 Bacteria 3478
96 Ga0157370_10025878 3300013104 Bacteria 5802
97 Ga0157369_10008210 3300013105 Bacteria 11974
98 Ga0157372_10000722 3300013307 Bacteria 36035
99 Ga0157372_10044483 3300013307 Bacteria 4920
100 Ga0157375_10214348 3300013308 Bacteria 2083
101 Ga0157380_10059503 3300014326 Bacteria 3049
102 Ga0157379_10158572 3300014968 Bacteria 2042
103 Ga0209674_102507 3300025226 Bacteria 3898
104 Ga0209673_1023330 3300025273 Bacteria 2110
105 Ga0209564_1000461 3300025295 Bacteria 68416
106 Ga0209758_1004692 3300025297 Bacteria 11163
107 Ga0209257_1000159 3300025304 Bacteria 178767
108 Ga0209257_1000402 3300025304 Bacteria 84536
109 Ga0207656_10101384 3300025321 Bacteria 1320
110 Ga0207682_10074085 3300025893 Bacteria 1447
111 Ga0207692_10116978 3300025898 Bacteria 1487
112 Ga0207647_10000516 3300025904 Bacteria 30815
113 Ga0207647_10001684 3300025904 Bacteria 17029
114 Ga0207647_10008642 3300025904 Bacteria 7281
115 Ga0207645_10002198 3300025907 Bacteria 15574
116 Ga0207643_10008979 3300025908 Bacteria 5365
117 Ga0207705_10000009 3300025909 Bacteria 576128
118 Ga0207654_10006855 3300025911 Bacteria 5734
119 Ga0207654_10182596 3300025911 Bacteria 1369
120 Ga0207707_10004036 3300025912 Bacteria 13014
121 Ga0207695_10002649 3300025913 Bacteria 26162
122 Ga0207695_10006300 3300025913 Bacteria 15444
123 Ga0207695_10026430 3300025913 Bacteria 6478
124 Ga0207695_10124954 3300025913 Unclassified 2536
125 Ga0207671_10030964 3300025914 Bacteria 3989
126 Ga0207693_10084783 3300025915 Bacteria 2482
127 Ga0207663_10064269 3300025916 Bacteria 2341
128 Ga0207657_10000281 3300025919 Bacteria 54261
129 Ga0207657_10002697 3300025919 Bacteria 19137
130 Ga0207657_10055094 3300025919 Bacteria 3436
131 Ga0207649_10121811 3300025920 Bacteria 1759
132 Ga0207652_10024547 3300025921 Bacteria 5003
133 Ga0207681_10058830 3300025923 Bacteria 2633
134 Ga0207681_10259146 3300025923 Bacteria 1361
135 Ga0207694_10011952 3300025924 Bacteria 6546
136 Ga0207694_10019838 3300025924 Bacteria 5085
137 Ga0207687_10044391 3300025927 Bacteria 3067
138 Ga0207700_10155843 3300025928 Bacteria 1892
139 Ga0207664_10071196 3300025929 Bacteria 2800
140 Ga0207690_10101969 3300025932 Bacteria 2051
141 Ga0207706_10002294 3300025933 Bacteria 18663
142 Ga0207706_10004216 3300025933 Bacteria 13540
143 Ga0207706_10005611 3300025933 Bacteria 11690
144 Ga0207706_10006033 3300025933 Bacteria 11270
145 Ga0207706_10141762 3300025933 Bacteria 2115
146 Ga0207691_10001861 3300025940 Bacteria 20637
147 Ga0207711_10225721 3300025941 Unclassified 1714
148 Ga0207689_10162203 3300025942 Bacteria 1842
149 Ga0207679_10020348 3300025945 Bacteria 4478
150 Ga0207679_10284331 3300025945 Bacteria 1420
151 Ga0207679_10354240 3300025945 Bacteria 1280
152 Ga0207667_10004412 3300025949 Bacteria 17219
153 Ga0207667_10011377 3300025949 Bacteria 10347
154 Ga0207667_10029717 3300025949 Bacteria 5921
155 Ga0207667_10230213 3300025949 Bacteria 1898
156 Ga0207712_10132081 3300025961 Bacteria 1904
157 Ga0207712_10231218 3300025961 Unclassified 1484
158 Ga0207668_10032672 3300025972 Bacteria 3442
159 Ga0207640_10000193 3300025981 Bacteria 43544
160 Ga0207703_10000439 3300026035 Bacteria 43808
161 Ga0207703_10112612 3300026035 Bacteria 2325
162 Ga0207639_10002633 3300026041 Bacteria 12050
163 Ga0207639_10062952 3300026041 Bacteria 2870
164 Ga0207639_10194017 3300026041 Bacteria 1737
165 Ga0207678_10001522 3300026067 Bacteria 21250
166 Ga0207678_10081597 3300026067 Bacteria 2768
167 Ga0207708_10121773 3300026075 Bacteria 2033
168 Ga0207702_10002821 3300026078 Bacteria 16253
169 Ga0207702_10007861 3300026078 Bacteria 9043
170 Ga0207702_10017481 3300026078 Bacteria 5933
171 Ga0207702_10052738 3300026078 Bacteria 3442
172 Ga0207702_10287706 3300026078 Bacteria 1556
173 Ga0207648_10002196 3300026089 Bacteria 21186
174 Ga0207648_10120783 3300026089 Bacteria 2304
175 Ga0207674_10004762 3300026116 Bacteria 16271
176 Ga0207674_10009638 3300026116 Bacteria 11016
177 Ga0207674_10386907 3300026116 Bacteria 1352
178 Ga0207674_10400939 3300026116 Bacteria 1326
179 Ga0207674_10456270 3300026116 Bacteria 1235
180 Ga0207675_100000018 3300026118 Bacteria 124200
181 Ga0207675_100002471 3300026118 Bacteria 18294
182 Ga0207698_10000320 3300026142 Bacteria 28735
183 Ga0207698_10003047 3300026142 Bacteria 10039
184 Ga0207698_10092625 3300026142 Bacteria 2478
185 Ga0209967_1003592 3300027364 Bacteria 2043
186 Ga0209970_1001512 3300027614 Bacteria 4055
187 Ga0210002_1000799 3300027617 Bacteria 4295
188 Ga0209983_1005352 3300027665 Bacteria 2661
189 Ga0209971_1001050 3300027682 Bacteria 7039
190 Ga0209966_1004450 3300027695 Bacteria 2377
191 Ga0209998_10000895 3300027717 Bacteria 7653
192 Ga0207428_10104934 3300027907 Bacteria 2180
193 Ga0268266_10000058 3300028379 Bacteria 277346
194 Ga0268266_10001861 3300028379 Bacteria 23842
195 Ga0268265_10128620 3300028380 Bacteria 2101
196 Ga0265326_10023032 3300028558 Bacteria 1781
197 Ga0265334_10001387 3300028573 Bacteria 11681
198 Ga0307509_10000002 3300031507 Bacteria 607551
199 Ga0307408_100084410 3300031548 Bacteria 2382
200 Ga0307408_100279153 3300031548 Unclassified 1390
201 Ga0307516_10000305 3300031730 Bacteria 63768
202 Ga0307405_10171137 3300031731 Unclassified 1549
203 Ga0307413_10055144 3300031824 Bacteria 2416
204 Ga0307413_10552527 3300031824 Bacteria 934
205 Ga0307406_10004991 3300031901 Bacteria 7229
206 Ga0307412_10003181 3300031911 Bacteria 9119
207 Ga0307412_10153433 3300031911 Unclassified 1702
208 Ga0307416_100059267 3300032002 Bacteria 3110
209 Ga0307416_100157727 3300032002 Bacteria 2092
210 Ga0307414_10053066 3300032004 Unclassified 2825
211 Ga0307414_10079839 3300032004 Bacteria 2390
212 Ga0307414_10180412 3300032004 Bacteria 1697
213 Ga0307411_10338162 3300032005 Bacteria 1222
214 Ga0316584_0276375 3300036712 Bacteria 1221
215 Ga0395899_0053682 3300037312 Bacteria 2983
216 Ga0395900_0023394 3300037418 Bacteria 6325
217 Ga0395898_0006169 3300037466 Bacteria 12840
218 Ga0439443_004127 3300042003 Bacteria 1875
219 Ga0439445_0020908 3300042004 Bacteria 1641
220 Ga0439462_0000440 3300042015 Bacteria 8124
221 Ga0450912_000003 3300042116 Bacteria 13298
222 Ga0439444_0000531 3300042437 Bacteria 4324
223 Ga0450893_0000082 3300042532 Bacteria 10231
224 Ga0466969_0001802 3300044656 Bacteria 11423
225 Ga0466969_0002943 3300044656 Bacteria 9092
226 Ga0466972_0071275 3300044658 Bacteria 1658
227 Ga0466966_0031590 3300044684 Bacteria 3433
228 Ga0466964_0277145 3300044706 Bacteria 837
229 Ga0466970_0000559 3300044765 Bacteria 18193
230 Ga0466959_0031145 3300045049 Bacteria 3947
231 Ga0466959_0144437 3300045049 Bacteria 1679
232 Ga0466958_0009488 3300045836 Bacteria 5426
233 Ga0466958_0264574 3300045836 Bacteria 1101
234 Ga0496100_0056952 3300048903 Bacteria 2559
235 Ga0496104_0008690 3300048907 Bacteria 9032
236 Ga0496104_0213132 3300048907 Bacteria 1843
237 Ga0496105_0068122 3300048908 Bacteria 2939
238 Ga0496114_0019661 3300048917 Bacteria 5473
239 Ga0496115_0013596 3300048918 Bacteria 6158
240 Ga0496119_0000119 3300048922 Bacteria 110434
241 Ga0496120_0002171 3300048923 Bacteria 20843
242 Ga0496126_0001431 3300048929 Bacteria 37495
243 Ga0501292_000017 3300049515 Bacteria 57254
244 Ga0501033_0043163 3300049570 Bacteria 3359
245 Ga0501033_0051983 3300049570 Bacteria 3037
246 Ga0501036_0000156 3300049572 Bacteria 45001
247 Ga0501036_0597809 3300049572 Bacteria 915
248 Ga0501037_0040355 3300049573 Bacteria 3435
249 Ga0501037_0082006 3300049573 Bacteria 2338
250 Ga0501038_0002624 3300049574 Bacteria 16804
251 Ga0501039_0001593 3300049575 Bacteria 16706
252 Ga0501040_0000799 3300049576 Bacteria 19570
253 Ga0501040_0004734 3300049576 Bacteria 8834
254 Ga0501041_0000362 3300049577 Bacteria 22561
255 Ga0501041_0005775 3300049577 Bacteria 7231
256 Ga0501042_0000430 3300049578 Bacteria 21331
257 Ga0501042_0146207 3300049578 Bacteria 1704
258 Ga0501043_0012186 3300049579 Bacteria 6720
259 Ga0501043_0249967 3300049579 Bacteria 1366
260 Ga0501046_0042317 3300049580 Bacteria 3632
261 Ga0501047_0520789 3300049581 Bacteria 1015
262 Ga0501048_0015561 3300049582 Bacteria 5619
263 Ga0501048_0068190 3300049582 Bacteria 2514
264 Ga0501068_0005114 3300049584 Bacteria 7145
265 Ga0501071_0000586 3300049587 Bacteria 18850
266 Ga0501071_0021658 3300049587 Bacteria 4479
267 Ga0501072_0002410 3300049588 Bacteria 14023
268 Ga0501072_0154784 3300049588 Bacteria 1828
269 Ga0501072_0267806 3300049588 Bacteria 1359
270 Ga0501073_0321866 3300049589 Bacteria 1067
271 Ga0501074_0031083 3300049590 Bacteria 3869
272 Ga0501075_0000191 3300049591 Bacteria 32035
273 Ga0501075_0007232 3300049591 Bacteria 7694
274 Ga0501076_0000170 3300049592 Bacteria 38043
275 Ga0501076_0004840 3300049592 Bacteria 9611
276 Ga0501077_0007608 3300049593 Bacteria 6686
277 Ga0501077_0019804 3300049593 Bacteria 4256
278 Ga0501245_000207 3300049708 Bacteria 6602
279 Ga0501079_0000635 3300049741 Bacteria 23374
280 Ga0501079_0042696 3300049741 Bacteria 3500
281 Ga0501080_0039102 3300049742 Bacteria 4428
282 Ga0501080_0046082 3300049742 Bacteria 4061
283 Ga0501081_0000380 3300049743 Bacteria 24400
284 Ga0501081_0251545 3300049743 Bacteria 1290
285 Ga0501083_0061158 3300049744 Bacteria 2515
286 Ga0501279_000019 3300049775 Bacteria 58746
287 Ga0501282_007309 3300049778 Bacteria 1182
288 Ga0501035_0026754 3300049822 Bacteria 5276
289 Ga0501035_0222315 3300049822 Bacteria 1612
290 Ga0501044_0069977 3300049823 Bacteria 3571
291 Ga0501045_0011381 3300049824 Bacteria 6247
292 Ga0501045_0222511 3300049824 Bacteria 1405
293 nmdc:mga0k408_33404_c1 3300050493 Bacteria 2942
294 nmdc:mga09592_104491_c1 3300050508 Bacteria 2427
295 nmdc:mga09592_22166_c1 3300050508 Bacteria 5241
296 nmdc:mga06r32_343616_c1 3300050510 Bacteria 1477
297 nmdc:mga08y16_30506_c1 3300050511 Bacteria 5674
298 nmdc:mga0sz30_372_c1 3300050516 Bacteria 17105
299 Ga0500583_0082808 3300053092 Bacteria 1552
300 Ga0500641_0022314 3300053096 Bacteria 2423
301 Ga0500658_0107953 3300053134 Bacteria 1222
302 Ga0500637_0110131 3300053178 Bacteria 1597
303 Ga0500587_004480 3300053739 Bacteria 1916
304 Ga0501084_0000851 3300054114 Bacteria 23584
305 Ga0501084_0010587 3300054114 Bacteria 7630
306 Ga0501084_0226770 3300054114 Bacteria 1577
307 Ga0501082_0008050 3300060353 Bacteria 9093
308 Ga0501082_0130534 3300060353 Bacteria 2180
309 Ga0466962_0037080 3300061719 Bacteria 2333
310 Ga0530510_0000156 3300061734 Bacteria 40875
311 Ga0530510_0002939 3300061734 Bacteria 11689
312 2896253851 2896253425 Bacteria 3418029
313 2729905308 2728369276 Bacteria 5610032
314 2819538834 2818991435 Bacteria 5433759
315 2896186533 2896184354 Bacteria 3258548
316 JGI24740J21852_10000497
317 JGI24739J22299_10000214
318 JGI24739J22299_10001030
319 JGI24737J22298_10000335
320 JGI24737J22298_10000367
321 JGI24735J21928_10000070
322 JGI24735J21928_10001472
323 JGI24738J21930_10010240
324 rootL2_10026182
325 Ga0055531_10003911
326 Ga0065165_1000428
327 Ga0065165_1017648
328 Ga0065715_10198755
329 Ga0070658_10000139
330 Ga0070658_10032126
331 Ga0070683_100005574
332 Ga0070677_10011926
333 Ga0070680_100024301
334 Ga0070680_100202933
335 Ga0070680_100486263
336 Ga0070682_100065446
337 Ga0070660_100052494
338 Ga0070660_100294616
339 Ga0070691_10025824
340 Ga0070669_100098605
341 Ga0070674_100503675
342 Ga0070659_100043251
343 Ga0070659_100081093
344 Ga0070709_10003457
345 Ga0070709_10023554
346 Ga0070714_100019704
347 Ga0070713_100458619
348 Ga0070681_10007054
349 Ga0070681_10008914
350 Ga0070681_10052763
351 Ga0070681_10556041
352 Ga0068867_100093909
353 Ga0070679_100027645
354 Ga0070684_100145947
355 Ga0068853_100011133
356 Ga0068853_100121863
357 Ga0070665_100005884
358 Ga0068855_100004272
359 Ga0068855_100008073
360 Ga0068855_100009844
361 Ga0068855_100021286
362 Ga0070664_100028925
363 Ga0070664_100031233
364 Ga0068857_100018898
365 Ga0068857_100019510
366 Ga0068854_100000298
367 Ga0068854_100085442
368 Ga0068856_100002394
369 Ga0068856_100003382
370 Ga0068856_100017851
371 Ga0068856_100149315
372 Ga0068856_100330776
373 Ga0068856_100391148
374 Ga0068852_100000302
375 Ga0068852_100000545
376 Ga0068852_100018020
377 Ga0068861_100000027
378 Ga0068851_10002017
379 Ga0068858_100000785
380 Ga0068862_100014053
381 Ga0081455_10000579
382 Ga0070712_100227095
383 Ga0075369_10093311
384 Ga0075428_100041104
385 Ga0075428_100098105
386 Ga0075430_100034937
387 Ga0075431_100011120
388 Ga0075431_100144522
389 Ga0075431_100461658
390 Ga0105240_10002755
391 Ga0105240_10010146
392 Ga0105240_10043792
393 Ga0105240_10087579
394 Ga0105240_10105215
395 Ga0105240_10117862
396 Ga0111539_10025895
397 Ga0111539_10052231
398 Ga0105241_10029336
399 Ga0105241_10224284
400 Ga0105237_10026726
401 Ga0105237_10032442
402 Ga0105237_10126119
403 Ga0105238_10021648
404 Ga0105238_10036050
405 Ga0105238_10110341
406 Ga0105249_10361488
407 Ga0105239_10012505
408 Ga0157373_10016340
409 Ga0157371_10003894
410 Ga0157371_10037314
411 Ga0157370_10025878
412 Ga0157369_10008210
413 Ga0157372_10000722
414 Ga0157372_10044483
415 Ga0157375_10214348
416 Ga0157380_10059503
417 Ga0157379_10158572
418 Ga0209674_102507
419 Ga0209673_1023330
420 Ga0209564_1000461
421 Ga0209758_1004692
422 Ga0209257_1000159
423 Ga0209257_1000402
424 Ga0207656_10101384
425 Ga0207682_10074085
426 Ga0207692_10116978
427 Ga0207647_10000516
428 Ga0207647_10001684
429 Ga0207647_10008642
430 Ga0207645_10002198
431 Ga0207643_10008979
432 Ga0207705_10000009
433 Ga0207654_10006855
434 Ga0207654_10182596
435 Ga0207707_10004036
436 Ga0207695_10002649
437 Ga0207695_10006300
438 Ga0207695_10026430
439 Ga0207695_10124954
440 Ga0207671_10030964
441 Ga0207693_10084783
442 Ga0207663_10064269
443 Ga0207657_10000281
444 Ga0207657_10002697
445 Ga0207657_10055094
446 Ga0207649_10121811
447 Ga0207652_10024547
448 Ga0207681_10058830
449 Ga0207681_10259146
450 Ga0207694_10011952
451 Ga0207694_10019838
452 Ga0207687_10044391
453 Ga0207700_10155843
454 Ga0207664_10071196
455 Ga0207690_10101969
456 Ga0207706_10002294
457 Ga0207706_10004216
458 Ga0207706_10005611
459 Ga0207706_10006033
460 Ga0207706_10141762
461 Ga0207691_10001861
462 Ga0207711_10225721
463 Ga0207689_10162203
464 Ga0207679_10020348
465 Ga0207679_10284331
466 Ga0207679_10354240
467 Ga0207667_10004412
468 Ga0207667_10011377
469 Ga0207667_10029717
470 Ga0207667_10230213
471 Ga0207712_10132081
472 Ga0207712_10231218
473 Ga0207668_10032672
474 Ga0207640_10000193
475 Ga0207703_10000439
476 Ga0207703_10112612
477 Ga0207639_10002633
478 Ga0207639_10062952
479 Ga0207639_10194017
480 Ga0207678_10001522
481 Ga0207678_10081597
482 Ga0207708_10121773
483 Ga0207702_10002821
484 Ga0207702_10007861
485 Ga0207702_10017481
486 Ga0207702_10052738
487 Ga0207702_10287706
488 Ga0207648_10002196
489 Ga0207648_10120783
490 Ga0207674_10004762
491 Ga0207674_10009638
492 Ga0207674_10386907
493 Ga0207674_10400939
494 Ga0207674_10456270
495 Ga0207675_100000018
496 Ga0207675_100002471
497 Ga0207698_10000320
498 Ga0207698_10003047
499 Ga0207698_10092625
500 Ga0209967_1003592
501 Ga0209970_1001512
502 Ga0210002_1000799
503 Ga0209983_1005352
504 Ga0209971_1001050
505 Ga0209966_1004450
506 Ga0209998_10000895
507 Ga0207428_10104934
508 Ga0268266_10000058
509 Ga0268266_10001861
510 Ga0268265_10128620
511 Ga0265326_10023032
512 Ga0265334_10001387
513 Ga0307509_10000002
514 Ga0307408_100084410
515 Ga0307408_100279153
516 Ga0307516_10000305
517 Ga0307405_10171137
518 Ga0307413_10055144
519 Ga0307413_10552527
520 Ga0307406_10004991
521 Ga0307412_10003181
522 Ga0307412_10153433
523 Ga0307416_100059267
524 Ga0307416_100157727
525 Ga0307414_10053066
526 Ga0307414_10079839
527 Ga0307414_10180412
528 Ga0307411_10338162
529 Ga0316584_0276375
530 Ga0395899_0053682
531 Ga0395900_0023394
532 Ga0395898_0006169
533 Ga0439443_004127
534 Ga0439445_0020908
535 Ga0439462_0000440
536 Ga0450912_000003
537 Ga0439444_0000531
538 Ga0450893_0000082
539 Ga0466969_0001802
540 Ga0466969_0002943
541 Ga0466972_0071275
542 Ga0466966_0031590
543 Ga0466964_0277145
544 Ga0466970_0000559
545 Ga0466959_0031145
546 Ga0466959_0144437
547 Ga0466958_0009488
548 Ga0466958_0264574
549 Ga0496100_0056952
550 Ga0496104_0008690
551 Ga0496104_0213132
552 Ga0496105_0068122
553 Ga0496114_0019661
554 Ga0496115_0013596
555 Ga0496119_0000119
556 Ga0496120_0002171
557 Ga0496126_0001431
558 Ga0501292_000017
559 Ga0501033_0043163
560 Ga0501033_0051983
561 Ga0501036_0000156
562 Ga0501036_0597809
563 Ga0501037_0040355
564 Ga0501037_0082006
565 Ga0501038_0002624
566 Ga0501039_0001593
567 Ga0501040_0000799
568 Ga0501040_0004734
569 Ga0501041_0000362
570 Ga0501041_0005775
571 Ga0501042_0000430
572 Ga0501042_0146207
573 Ga0501043_0012186
574 Ga0501043_0249967
575 Ga0501046_0042317
576 Ga0501047_0520789
577 Ga0501048_0015561
578 Ga0501048_0068190
579 Ga0501068_0005114
580 Ga0501071_0000586
581 Ga0501071_0021658
582 Ga0501072_0002410
583 Ga0501072_0154784
584 Ga0501072_0267806
585 Ga0501073_0321866
586 Ga0501074_0031083
587 Ga0501075_0000191
588 Ga0501075_0007232
589 Ga0501076_0000170
590 Ga0501076_0004840
591 Ga0501077_0007608
592 Ga0501077_0019804
593 Ga0501245_000207
594 Ga0501079_0000635
595 Ga0501079_0042696
596 Ga0501080_0039102
597 Ga0501080_0046082
598 Ga0501081_0000380
599 Ga0501081_0251545
600 Ga0501083_0061158
601 Ga0501279_000019
602 Ga0501282_007309
603 Ga0501035_0026754
604 Ga0501035_0222315
605 Ga0501044_0069977
606 Ga0501045_0011381
607 Ga0501045_0222511
608 nmdc:mga0k408_33404_c1
609 nmdc:mga09592_104491_c1
610 nmdc:mga09592_22166_c1
611 nmdc:mga06r32_343616_c1
612 nmdc:mga08y16_30506_c1
613 nmdc:mga0sz30_372_c1
614 Ga0500583_0082808
615 Ga0500641_0022314
616 Ga0500658_0107953
617 Ga0500637_0110131
618 Ga0500587_004480
619 Ga0501084_0000851
620 Ga0501084_0010587
621 Ga0501084_0226770
622 Ga0501082_0008050
623 Ga0501082_0130534
624 Ga0466962_0037080
625 Ga0530510_0000156
626 Ga0530510_0002939
627 2896253851
628 2729905308
629 2819538834
630 2896186533

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

11

207

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

17

226

0.91

PF08659

KR

KR domain

12

183

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zzp-assembly2.cif.gz_D-3 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and 3-oxovalerate 0.9518 2 192
4yae-assembly1.cif.gz_B crystal structure of ligl-apo form from sphingobium sp. strain syk-6 0.9491 3 266
4mow-assembly1.cif.gz_C crystal structure of a putative glucose 1-dehydrogenase from burkholderia cenocepacia j2315 0.9477 3 190
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9472 7 237
4trr-assembly2.cif.gz_G crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 0.9469 5 190
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9539 91 188 3.40.50.720
3ioyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9517 5 248 3.40.50.720
4yaeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9502 3 266 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9472 7 237 3.40.50.720
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9469 5 190 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A534PYM4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9723 1 188 GO:0016491
AF-A0A534PYM4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9672 1 188 GO:0016491
AF-A0A2N3E5P0-F1-model_v4 Short-chain dehydrogenase 0.9613 1 183 GO:0016491
AF-A0A2D5KQ22-F1-model_v4 deleted 0.9586 3 188
AF-A0A7K1CVG8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9573 2 188 GO:0016616

Map