F403113

General Info

Members Datasets Scaffolds Average Seq Length
315 196 630 391

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10003399|Ga0075367_1000339911
Length 425
Sequence VQSRLPKGNGSHNRYMRFELYVALRYLSARRKQAFISLISLISTLGVGXXXXALIIAISLMTGLQGELRDRILGSAAHVYVSKLTPQGIEDVDGEMKQLKSVPRVTGAAPVLLGKALIQTARNDQFITIEGINPALEASVNDLAKSMKQGNLAALKSAPDSEQPDGIVLGQDLARTLGTFIGDSVTVLTPESTLTPFGAVPRRRTLKVVGIYSLGLFEFDSAYGFVSLDVAKRLTGKIVPDYIELRVDDIYKAPEIAADINQRFGKTYLAQDWSTLNAPLFSALWLEKVAIGITISLIMIVAGLNIVASLVLLVMEKSRDIAILKTMGASARSIMMIFMLQGVLIGAAGTTVGAILGRTIAFVLDRYKLIQISTEVYQITYMPFRIETTDFLLVLAAAMAICFVATIYPSRQASRLDPAEALRYA

Samples

Sample ID Description Type Environment
1 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
192 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.89
Nodule 0
Rhizoplane 3.81
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 2.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075367_10003399 3300006178 Bacteria 7585
2 JGI24746J21847_1000984 3300001977 Bacteria 4478
3 JGI25406J46586_10000335 3300003203 Bacteria 21248
4 Ga0065704_10119036 3300005289 Bacteria 1806
5 Ga0065712_10000394 3300005290 Bacteria 12912
6 Ga0065712_10017778 3300005290 Bacteria 2300
7 Ga0065715_10000929 3300005293 Bacteria 12377
8 Ga0065715_10105703 3300005293 Bacteria 2876
9 Ga0065707_10140770 3300005295 Bacteria 1776
10 Ga0070676_10002821 3300005328 Bacteria 8985
11 Ga0070676_10053252 3300005328 Bacteria 2383
12 Ga0070676_10066196 3300005328 Bacteria 2159
13 Ga0070683_100005427 3300005329 Bacteria 10650
14 Ga0070690_100001530 3300005330 Bacteria 12118
15 Ga0070690_100068304 3300005330 Bacteria 2305
16 Ga0070670_100036815 3300005331 Bacteria 4210
17 Ga0070677_10004165 3300005333 Bacteria 4705
18 Ga0068869_100004141 3300005334 Bacteria 8992
19 Ga0068869_100011964 3300005334 Bacteria 5711
20 Ga0070666_10010895 3300005335 Bacteria 5696
21 Ga0070666_10180660 3300005335 Bacteria 1480
22 Ga0068868_100022579 3300005338 Bacteria 4751
23 Ga0068868_100055737 3300005338 Bacteria 3120
24 Ga0070689_100031077 3300005340 Bacteria 4057
25 Ga0070689_100161375 3300005340 Bacteria 1812
26 Ga0070687_100023488 3300005343 Bacteria 2932
27 Ga0070661_100031553 3300005344 Bacteria 3832
28 Ga0070668_100016348 3300005347 Bacteria 5549
29 Ga0070669_100031315 3300005353 Bacteria 3842
30 Ga0070675_100002112 3300005354 Bacteria 14682
31 Ga0070675_100021072 3300005354 Bacteria 5205
32 Ga0070675_100125561 3300005354 Bacteria 2182
33 Ga0070675_100158038 3300005354 Bacteria 1948
34 Ga0070674_100001996 3300005356 Bacteria 11165
35 Ga0070673_100020351 3300005364 Bacteria 4786
36 Ga0070673_100041452 3300005364 Bacteria 3541
37 Ga0070673_100113531 3300005364 Bacteria 2250
38 Ga0070688_100009009 3300005365 Bacteria 5440
39 Ga0070688_100179101 3300005365 Bacteria 1469
40 Ga0070659_100032407 3300005366 Bacteria 4053
41 Ga0070659_100164895 3300005366 Archaea 1813
42 Ga0070667_100012113 3300005367 Bacteria 7139
43 Ga0070713_100212852 3300005436 Bacteria 1751
44 Ga0070700_100003490 3300005441 Bacteria 8110
45 Ga0070694_100081759 3300005444 Bacteria 2248
46 Ga0070694_100081922 3300005444 Unclassified 2246
47 Ga0070678_100034468 3300005456 Bacteria 3526
48 Ga0070662_100026706 3300005457 Bacteria 4001
49 Ga0068867_100243200 3300005459 Unclassified 1460
50 Ga0070685_10014557 3300005466 Bacteria 4168
51 Ga0070684_100028211 3300005535 Bacteria 4747
52 Ga0070672_100001689 3300005543 Bacteria 13770
53 Ga0070672_100157853 3300005543 Bacteria 1880
54 Ga0070686_100008863 3300005544 Bacteria 5636
55 Ga0070686_100097434 3300005544 Bacteria 1980
56 Ga0070664_100004968 3300005564 Bacteria 10652
57 Ga0070702_100017931 3300005615 Bacteria 3662
58 Ga0068852_100029855 3300005616 Bacteria 4482
59 Ga0068852_100067456 3300005616 Bacteria 3128
60 Ga0068859_100047831 3300005617 Bacteria 4298
61 Ga0068859_100332830 3300005617 Bacteria 1613
62 Ga0068864_100076040 3300005618 Bacteria 2933
63 Ga0068861_100071362 3300005719 Bacteria 2692
64 Ga0068870_10006634 3300005840 Bacteria 5111
65 Ga0068860_100010723 3300005843 Bacteria 9048
66 Ga0068862_100087679 3300005844 Bacteria 2707
67 Ga0075363_100050469 3300006048 Bacteria 2217
68 Ga0075364_10003997 3300006051 Bacteria 8465
69 Ga0075364_10050262 3300006051 Bacteria 2721
70 Ga0075364_10067868 3300006051 Bacteria 2345
71 Ga0075362_10005384 3300006177 Bacteria 4678
72 Ga0075367_10004497 3300006178 Bacteria 6817
73 Ga0075367_10137677 3300006178 Bacteria 1511
74 Ga0075366_10008953 3300006195 Bacteria 5580
75 Ga0075366_10065604 3300006195 Bacteria 2159
76 Ga0097621_100009398 3300006237 Bacteria 7095
77 Ga0097621_100033293 3300006237 Bacteria 4103
78 Ga0097621_100043767 3300006237 Bacteria 3610
79 Ga0075370_10155513 3300006353 Bacteria 1341
80 Ga0068871_100038281 3300006358 Bacteria 3829
81 Ga0068871_100205484 3300006358 Bacteria 1702
82 Ga0075428_100001419 3300006844 Bacteria 25530
83 Ga0075428_100006912 3300006844 Bacteria 12602
84 Ga0075428_100011429 3300006844 Bacteria 9876
85 Ga0075428_100022441 3300006844 Bacteria 6989
86 Ga0075430_100001514 3300006846 Bacteria 18953
87 Ga0075430_100030048 3300006846 Bacteria 4614
88 Ga0075430_100089477 3300006846 Bacteria 2576
89 Ga0075430_100164975 3300006846 Bacteria 1843
90 Ga0075431_100020217 3300006847 Bacteria 6801
91 Ga0075431_100030395 3300006847 Bacteria 5564
92 Ga0075431_100108099 3300006847 Bacteria 2870
93 Ga0075433_10004293 3300006852 Bacteria 11072
94 Ga0075434_100001510 3300006871 Bacteria 19657
95 Ga0075429_100003283 3300006880 Bacteria 13779
96 Ga0075429_100006846 3300006880 Bacteria 9895
97 Ga0097620_100047828 3300006931 Bacteria 4298
98 Ga0097620_100332847 3300006931 Bacteria 1613
99 Ga0075435_100032686 3300007076 Bacteria 4110
100 Ga0105240_10011092 3300009093 Bacteria 12600
101 Ga0105240_10113774 3300009093 Bacteria 3270
102 Ga0105240_10227669 3300009093 Bacteria 2168
103 Ga0111539_10000325 3300009094 Bacteria 58382
104 Ga0111539_10001033 3300009094 Bacteria 36485
105 Ga0111539_10002623 3300009094 Bacteria 23839
106 Ga0111539_10011674 3300009094 Bacteria 11019
107 Ga0111539_10015699 3300009094 Bacteria 9414
108 Ga0111539_10040109 3300009094 Bacteria 5639
109 Ga0111539_10135058 3300009094 Bacteria 2889
110 Ga0105247_10024716 3300009101 Bacteria 3621
111 Ga0114129_10000086 3300009147 Bacteria 86772
112 Ga0105243_10147387 3300009148 Bacteria 2015
113 Ga0105242_10020391 3300009176 Bacteria 5197
114 Ga0105242_10204151 3300009176 Bacteria 1757
115 Ga0105237_10019879 3300009545 Bacteria 6934
116 Ga0105238_10241397 3300009551 Bacteria 1784
117 Ga0105249_10003470 3300009553 Bacteria 13653
118 Ga0105246_10010058 3300011119 Bacteria 5838
119 Ga0157374_10065091 3300013296 Bacteria 3423
120 Ga0157374_10434619 3300013296 Bacteria 1312
121 Ga0157378_10151547 3300013297 Bacteria 2161
122 Ga0163162_10034839 3300013306 Bacteria 5012
123 Ga0163162_10336560 3300013306 Bacteria 1642
124 Ga0157375_10087995 3300013308 Bacteria 3160
125 Ga0163163_10116950 3300014325 Bacteria 2698
126 Ga0157380_10001392 3300014326 Bacteria 15784
127 Ga0157380_10023919 3300014326 Bacteria 4616
128 Ga0157380_10110930 3300014326 Bacteria 2305
129 Ga0157380_10169277 3300014326 Bacteria 1907
130 Ga0157377_10086324 3300014745 Archaea 1844
131 Ga0157377_10102119 3300014745 Bacteria 1710
132 Ga0157379_10012264 3300014968 Bacteria 7485
133 Ga0157376_10049889 3300014969 Bacteria 3469
134 Ga0157376_10121316 3300014969 Bacteria 2317
135 Ga0163161_10020212 3300017792 Bacteria 4671
136 Ga0163161_10050089 3300017792 Bacteria 3021
137 Ga0207697_10000651 3300025315 Bacteria 19784
138 Ga0207697_10041794 3300025315 Bacteria 1883
139 Ga0207682_10000753 3300025893 Bacteria 14930
140 Ga0207682_10018106 3300025893 Bacteria 2752
141 Ga0207642_10027161 3300025899 Bacteria 2340
142 Ga0207710_10060288 3300025900 Bacteria 1719
143 Ga0207688_10003111 3300025901 Bacteria 9059
144 Ga0207688_10043372 3300025901 Bacteria 2505
145 Ga0207680_10091064 3300025903 Bacteria 1940
146 Ga0207680_10139397 3300025903 Bacteria 1606
147 Ga0207699_10071699 3300025906 Bacteria 2120
148 Ga0207645_10033560 3300025907 Bacteria 3298
149 Ga0207645_10061218 3300025907 Bacteria 2404
150 Ga0207643_10000388 3300025908 Bacteria 29338
151 Ga0207695_10176960 3300025913 Bacteria 2056
152 Ga0207671_10042421 3300025914 Bacteria 3367
153 Ga0207662_10000919 3300025918 Bacteria 13622
154 Ga0207681_10096710 3300025923 Bacteria 2120
155 Ga0207694_10066258 3300025924 Bacteria 2817
156 Ga0207659_10005929 3300025926 Bacteria 7458
157 Ga0207659_10009865 3300025926 Bacteria 5978
158 Ga0207659_10040057 3300025926 Bacteria 3273
159 Ga0207659_10065971 3300025926 Bacteria 2625
160 Ga0207659_10100397 3300025926 Bacteria 2180
161 Ga0207659_10112150 3300025926 Bacteria 2075
162 Ga0207659_10248420 3300025926 Bacteria 1442
163 Ga0207687_10169446 3300025927 Bacteria 1683
164 Ga0207700_10082837 3300025928 Bacteria 2509
165 Ga0207644_10021711 3300025931 Bacteria 4377
166 Ga0207690_10059378 3300025932 Bacteria 2591
167 Ga0207690_10154842 3300025932 Archaea 1703
168 Ga0207706_10002317 3300025933 Bacteria 18582
169 Ga0207706_10166200 3300025933 Bacteria 1939
170 Ga0207686_10049739 3300025934 Bacteria 2603
171 Ga0207669_10001188 3300025937 Bacteria 11059
172 Ga0207691_10002243 3300025940 Bacteria 18938
173 Ga0207691_10026403 3300025940 Bacteria 5449
174 Ga0207691_10115795 3300025940 Bacteria 2380
175 Ga0207711_10120445 3300025941 Bacteria 2342
176 Ga0207711_10181701 3300025941 Bacteria 1913
177 Ga0207689_10005295 3300025942 Bacteria 11554
178 Ga0207689_10016626 3300025942 Bacteria 6226
179 Ga0207679_10007230 3300025945 Bacteria 7037
180 Ga0207679_10324267 3300025945 Archaea 1335
181 Ga0207651_10069811 3300025960 Bacteria 2482
182 Ga0207651_10087017 3300025960 Archaea 2273
183 Ga0207712_10014453 3300025961 Bacteria 5080
184 Ga0207640_10112382 3300025981 Bacteria 1934
185 Ga0207658_10164467 3300025986 Bacteria 1821
186 Ga0207708_10112688 3300026075 Unclassified 2113
187 Ga0207648_10010747 3300026089 Bacteria 8649
188 Ga0207648_10017464 3300026089 Bacteria 6527
189 Ga0207648_10022969 3300026089 Bacteria 5593
190 Ga0207674_10036509 3300026116 Bacteria 5118
191 Ga0207675_100008223 3300026118 Bacteria 9832
192 Ga0207683_10005142 3300026121 Bacteria 11234
193 Ga0207683_10072895 3300026121 Bacteria 3037
194 Ga0207698_10296050 3300026142 Bacteria 1504
195 Ga0207428_10000207 3300027907 Bacteria 81801
196 Ga0207428_10000928 3300027907 Bacteria 32749
197 Ga0207428_10002004 3300027907 Bacteria 20617
198 Ga0207428_10005489 3300027907 Bacteria 11818
199 Ga0207428_10088806 3300027907 Bacteria 2403
200 Ga0268266_10069510 3300028379 Bacteria 3051
201 Ga0268266_10109389 3300028379 Unclassified 2447
202 Ga0307405_10009263 3300031731 Bacteria 5039
203 Ga0307405_10074182 3300031731 Bacteria 2199
204 Ga0307413_10016019 3300031824 Bacteria 3858
205 Ga0307410_10047207 3300031852 Bacteria 2877
206 Ga0307406_10226264 3300031901 Bacteria 1394
207 Ga0307407_10010999 3300031903 Bacteria 4288
208 Ga0307412_10050613 3300031911 Bacteria 2742
209 Ga0307412_10061582 3300031911 Bacteria 2523
210 Ga0307412_10073472 3300031911 Bacteria 2340
211 Ga0307409_100100039 3300031995 Bacteria 2403
212 Ga0307409_100102235 3300031995 Bacteria 2380
213 Ga0307416_100292068 3300032002 Bacteria 1614
214 Ga0307416_100386478 3300032002 Bacteria 1432
215 Ga0307414_10230096 3300032004 Bacteria 1528
216 Ga0307411_10040099 3300032005 Bacteria 2968
217 Ga0307411_10044580 3300032005 Bacteria 2846
218 Ga0307411_10211735 3300032005 Bacteria 1497
219 Ga0307415_100037163 3300032126 Bacteria 3198
220 Ga0373954_0049085 3300035118 Bacteria 1979
221 Ga0373937_0155103 3300036401 Bacteria 2146
222 Ga0373937_0272770 3300036401 Bacteria 1597
223 Ga0439431_0030179 3300041997 Bacteria 1342
224 Ga0453683_0066583 3300044673 Bacteria 2252
225 Ga0466963_0080915 3300044694 Bacteria 2200
226 Ga0466967_0237048 3300045976 Bacteria 1739
227 Ga0495643_0004387 3300046522 Bacteria 9884
228 Ga0495598_0030347 3300046537 Unclassified 1514
229 Ga0495635_0121682 3300046663 Bacteria 1780
230 Ga0495674_0222200 3300047319 Bacteria 1561
231 Ga0495672_0015746 3300047320 Bacteria 5122
232 Ga0496101_0000261 3300048904 Bacteria 37482
233 Ga0496104_0016501 3300048907 Bacteria 6710
234 Ga0496104_0024966 3300048907 Bacteria 5505
235 Ga0496105_0049459 3300048908 Bacteria 3471
236 Ga0496105_0197514 3300048908 Bacteria 1643
237 Ga0496108_0016469 3300048911 Bacteria 6032
238 Ga0496109_0395249 3300048912 Bacteria 1306
239 Ga0496110_0027329 3300048913 Bacteria 4891
240 Ga0496111_0213901 3300048914 Bacteria 1432
241 Ga0496114_0011058 3300048917 Bacteria 7200
242 Ga0496114_0019830 3300048917 Bacteria 5452
243 Ga0496115_0017923 3300048918 Bacteria 5425
244 Ga0501298_029928 3300049521 Bacteria 1063
245 Ga0501031_0020098 3300049568 Bacteria 4352
246 Ga0501032_0000575 3300049569 Bacteria 29765
247 Ga0501033_0030862 3300049570 Bacteria 4028
248 Ga0501034_0043097 3300049571 Bacteria 4567
249 Ga0501034_0081180 3300049571 Bacteria 3245
250 Ga0501036_0000334 3300049572 Bacteria 32981
251 Ga0501037_0019855 3300049573 Bacteria 4958
252 Ga0501038_0000320 3300049574 Bacteria 41216
253 Ga0501041_0021739 3300049577 Bacteria 3842
254 Ga0501043_0015536 3300049579 Bacteria 5965
255 Ga0501046_0001489 3300049580 Bacteria 22454
256 Ga0501046_0066832 3300049580 Unclassified 2801
257 Ga0501068_0000723 3300049584 Bacteria 16918
258 Ga0501069_0005954 3300049585 Bacteria 6363
259 Ga0501072_0007380 3300049588 Bacteria 8340
260 Ga0501073_0000736 3300049589 Bacteria 23190
261 Ga0501074_0005619 3300049590 Bacteria 9027
262 Ga0501075_0003263 3300049591 Bacteria 10860
263 Ga0501076_0010788 3300049592 Bacteria 6793
264 Ga0501076_0054947 3300049592 Bacteria 3157
265 Ga0501077_0060855 3300049593 Unclassified 2396
266 Ga0501079_0028969 3300049741 Bacteria 4250
267 Ga0501080_0000006 3300049742 Bacteria 138444
268 Ga0501081_0013613 3300049743 Bacteria 5347
269 Ga0501083_0018749 3300049744 Bacteria 4818
270 Ga0501035_0075529 3300049822 Bacteria 2980
271 Ga0501044_0015040 3300049823 Bacteria 8340
272 nmdc:mga03683_5809_c1 3300050489 Bacteria 4189
273 nmdc:mga03n38_50788_c1 3300050490 Bacteria 1849
274 nmdc:mga00v17_12248_c1 3300050491 Bacteria 4731
275 nmdc:mga00v17_129004_c1 3300050491 Bacteria 1615
276 nmdc:mga00v17_62702_c1 3300050491 Bacteria 2288
277 nmdc:mga0yw44_65732_c1 3300050492 Bacteria 2236
278 nmdc:mga0k408_14390_c1 3300050493 Bacteria 4358
279 nmdc:mga0k408_27039_c1 3300050493 Bacteria 3256
280 nmdc:mga06z11_114996_c1 3300050494 Bacteria 1494
281 nmdc:mga06z11_12054_c1 3300050494 Bacteria 3749
282 nmdc:mga06z11_47115_c1 3300050494 Bacteria 2188
283 nmdc:mga06z11_70149_c1 3300050494 Bacteria 1852
284 nmdc:mga07m45_93595_c1 3300050496 Bacteria 1723
285 nmdc:mga05p37_379034_c1 3300050507 Bacteria 1658
286 nmdc:mga05p37_811_c1 3300050507 Bacteria 34909
287 nmdc:mga09592_2587_c1 3300050508 Bacteria 14652
288 nmdc:mga09592_45897_c1 3300050508 Bacteria 3679
289 nmdc:mga0qj67_1429_c1 3300050509 Bacteria 16714
290 nmdc:mga0qj67_2563_c1 3300050509 Bacteria 12982
291 nmdc:mga0qj67_350079_c1 3300050509 Bacteria 1194
292 nmdc:mga0qj67_437584_c1 3300050509 Bacteria 1054
293 nmdc:mga0qj67_60133_c1 3300050509 Bacteria 3014
294 nmdc:mga06r32_179542_c1 3300050510 Bacteria 2102
295 nmdc:mga06r32_18955_c1 3300050510 Bacteria 6309
296 nmdc:mga06r32_51955_c1 3300050510 Bacteria 3924
297 nmdc:mga08y16_167791_c1 3300050511 Bacteria 2280
298 nmdc:mga08y16_217121_c1 3300050511 Bacteria 1980
299 nmdc:mga08y16_2623_c1 3300050511 Bacteria 18478
300 nmdc:mga08y16_4247_c1 3300050511 Bacteria 14951
301 nmdc:mga08y16_445_c1 3300050511 Bacteria 38283
302 nmdc:mga08y16_5185_c1 3300050511 Bacteria 13610
303 nmdc:mga08y16_75126_c1 3300050511 Bacteria 3523
304 nmdc:mga08y16_9575_c1 3300050511 Bacteria 10170
305 nmdc:mga0n895_6924_c1 3300050512 Bacteria 9686
306 nmdc:mga08x19_160206_c1 3300050514 Bacteria 1528
307 nmdc:mga0a205_303643_c1 3300050515 Archaea 1469
308 nmdc:mga0a205_3413_c1 3300050515 Bacteria 12051
309 Ga0495595_0056284 3300053084 Bacteria 1832
310 Ga0500641_0030011 3300053096 Bacteria 2133
311 Ga0500555_000241 3300053103 Bacteria 24303
312 Ga0500616_0000358 3300053153 Bacteria 64893
313 Ga0500645_002590 3300053730 Bacteria 7953
314 Ga0501084_0002006 3300054114 Bacteria 16269
315 Ga0501082_0002854 3300060353 Bacteria 15056
316 Ga0075367_10003399
317 JGI24746J21847_1000984
318 JGI25406J46586_10000335
319 Ga0065704_10119036
320 Ga0065712_10000394
321 Ga0065712_10017778
322 Ga0065715_10000929
323 Ga0065715_10105703
324 Ga0065707_10140770
325 Ga0070676_10002821
326 Ga0070676_10053252
327 Ga0070676_10066196
328 Ga0070683_100005427
329 Ga0070690_100001530
330 Ga0070690_100068304
331 Ga0070670_100036815
332 Ga0070677_10004165
333 Ga0068869_100004141
334 Ga0068869_100011964
335 Ga0070666_10010895
336 Ga0070666_10180660
337 Ga0068868_100022579
338 Ga0068868_100055737
339 Ga0070689_100031077
340 Ga0070689_100161375
341 Ga0070687_100023488
342 Ga0070661_100031553
343 Ga0070668_100016348
344 Ga0070669_100031315
345 Ga0070675_100002112
346 Ga0070675_100021072
347 Ga0070675_100125561
348 Ga0070675_100158038
349 Ga0070674_100001996
350 Ga0070673_100020351
351 Ga0070673_100041452
352 Ga0070673_100113531
353 Ga0070688_100009009
354 Ga0070688_100179101
355 Ga0070659_100032407
356 Ga0070659_100164895
357 Ga0070667_100012113
358 Ga0070713_100212852
359 Ga0070700_100003490
360 Ga0070694_100081759
361 Ga0070694_100081922
362 Ga0070678_100034468
363 Ga0070662_100026706
364 Ga0068867_100243200
365 Ga0070685_10014557
366 Ga0070684_100028211
367 Ga0070672_100001689
368 Ga0070672_100157853
369 Ga0070686_100008863
370 Ga0070686_100097434
371 Ga0070664_100004968
372 Ga0070702_100017931
373 Ga0068852_100029855
374 Ga0068852_100067456
375 Ga0068859_100047831
376 Ga0068859_100332830
377 Ga0068864_100076040
378 Ga0068861_100071362
379 Ga0068870_10006634
380 Ga0068860_100010723
381 Ga0068862_100087679
382 Ga0075363_100050469
383 Ga0075364_10003997
384 Ga0075364_10050262
385 Ga0075364_10067868
386 Ga0075362_10005384
387 Ga0075367_10004497
388 Ga0075367_10137677
389 Ga0075366_10008953
390 Ga0075366_10065604
391 Ga0097621_100009398
392 Ga0097621_100033293
393 Ga0097621_100043767
394 Ga0075370_10155513
395 Ga0068871_100038281
396 Ga0068871_100205484
397 Ga0075428_100001419
398 Ga0075428_100006912
399 Ga0075428_100011429
400 Ga0075428_100022441
401 Ga0075430_100001514
402 Ga0075430_100030048
403 Ga0075430_100089477
404 Ga0075430_100164975
405 Ga0075431_100020217
406 Ga0075431_100030395
407 Ga0075431_100108099
408 Ga0075433_10004293
409 Ga0075434_100001510
410 Ga0075429_100003283
411 Ga0075429_100006846
412 Ga0097620_100047828
413 Ga0097620_100332847
414 Ga0075435_100032686
415 Ga0105240_10011092
416 Ga0105240_10113774
417 Ga0105240_10227669
418 Ga0111539_10000325
419 Ga0111539_10001033
420 Ga0111539_10002623
421 Ga0111539_10011674
422 Ga0111539_10015699
423 Ga0111539_10040109
424 Ga0111539_10135058
425 Ga0105247_10024716
426 Ga0114129_10000086
427 Ga0105243_10147387
428 Ga0105242_10020391
429 Ga0105242_10204151
430 Ga0105237_10019879
431 Ga0105238_10241397
432 Ga0105249_10003470
433 Ga0105246_10010058
434 Ga0157374_10065091
435 Ga0157374_10434619
436 Ga0157378_10151547
437 Ga0163162_10034839
438 Ga0163162_10336560
439 Ga0157375_10087995
440 Ga0163163_10116950
441 Ga0157380_10001392
442 Ga0157380_10023919
443 Ga0157380_10110930
444 Ga0157380_10169277
445 Ga0157377_10086324
446 Ga0157377_10102119
447 Ga0157379_10012264
448 Ga0157376_10049889
449 Ga0157376_10121316
450 Ga0163161_10020212
451 Ga0163161_10050089
452 Ga0207697_10000651
453 Ga0207697_10041794
454 Ga0207682_10000753
455 Ga0207682_10018106
456 Ga0207642_10027161
457 Ga0207710_10060288
458 Ga0207688_10003111
459 Ga0207688_10043372
460 Ga0207680_10091064
461 Ga0207680_10139397
462 Ga0207699_10071699
463 Ga0207645_10033560
464 Ga0207645_10061218
465 Ga0207643_10000388
466 Ga0207695_10176960
467 Ga0207671_10042421
468 Ga0207662_10000919
469 Ga0207681_10096710
470 Ga0207694_10066258
471 Ga0207659_10005929
472 Ga0207659_10009865
473 Ga0207659_10040057
474 Ga0207659_10065971
475 Ga0207659_10100397
476 Ga0207659_10112150
477 Ga0207659_10248420
478 Ga0207687_10169446
479 Ga0207700_10082837
480 Ga0207644_10021711
481 Ga0207690_10059378
482 Ga0207690_10154842
483 Ga0207706_10002317
484 Ga0207706_10166200
485 Ga0207686_10049739
486 Ga0207669_10001188
487 Ga0207691_10002243
488 Ga0207691_10026403
489 Ga0207691_10115795
490 Ga0207711_10120445
491 Ga0207711_10181701
492 Ga0207689_10005295
493 Ga0207689_10016626
494 Ga0207679_10007230
495 Ga0207679_10324267
496 Ga0207651_10069811
497 Ga0207651_10087017
498 Ga0207712_10014453
499 Ga0207640_10112382
500 Ga0207658_10164467
501 Ga0207708_10112688
502 Ga0207648_10010747
503 Ga0207648_10017464
504 Ga0207648_10022969
505 Ga0207674_10036509
506 Ga0207675_100008223
507 Ga0207683_10005142
508 Ga0207683_10072895
509 Ga0207698_10296050
510 Ga0207428_10000207
511 Ga0207428_10000928
512 Ga0207428_10002004
513 Ga0207428_10005489
514 Ga0207428_10088806
515 Ga0268266_10069510
516 Ga0268266_10109389
517 Ga0307405_10009263
518 Ga0307405_10074182
519 Ga0307413_10016019
520 Ga0307410_10047207
521 Ga0307406_10226264
522 Ga0307407_10010999
523 Ga0307412_10050613
524 Ga0307412_10061582
525 Ga0307412_10073472
526 Ga0307409_100100039
527 Ga0307409_100102235
528 Ga0307416_100292068
529 Ga0307416_100386478
530 Ga0307414_10230096
531 Ga0307411_10040099
532 Ga0307411_10044580
533 Ga0307411_10211735
534 Ga0307415_100037163
535 Ga0373954_0049085
536 Ga0373937_0155103
537 Ga0373937_0272770
538 Ga0439431_0030179
539 Ga0453683_0066583
540 Ga0466963_0080915
541 Ga0466967_0237048
542 Ga0495643_0004387
543 Ga0495598_0030347
544 Ga0495635_0121682
545 Ga0495674_0222200
546 Ga0495672_0015746
547 Ga0496101_0000261
548 Ga0496104_0016501
549 Ga0496104_0024966
550 Ga0496105_0049459
551 Ga0496105_0197514
552 Ga0496108_0016469
553 Ga0496109_0395249
554 Ga0496110_0027329
555 Ga0496111_0213901
556 Ga0496114_0011058
557 Ga0496114_0019830
558 Ga0496115_0017923
559 Ga0501298_029928
560 Ga0501031_0020098
561 Ga0501032_0000575
562 Ga0501033_0030862
563 Ga0501034_0043097
564 Ga0501034_0081180
565 Ga0501036_0000334
566 Ga0501037_0019855
567 Ga0501038_0000320
568 Ga0501041_0021739
569 Ga0501043_0015536
570 Ga0501046_0001489
571 Ga0501046_0066832
572 Ga0501068_0000723
573 Ga0501069_0005954
574 Ga0501072_0007380
575 Ga0501073_0000736
576 Ga0501074_0005619
577 Ga0501075_0003263
578 Ga0501076_0010788
579 Ga0501076_0054947
580 Ga0501077_0060855
581 Ga0501079_0028969
582 Ga0501080_0000006
583 Ga0501081_0013613
584 Ga0501083_0018749
585 Ga0501035_0075529
586 Ga0501044_0015040
587 nmdc:mga03683_5809_c1
588 nmdc:mga03n38_50788_c1
589 nmdc:mga00v17_12248_c1
590 nmdc:mga00v17_129004_c1
591 nmdc:mga00v17_62702_c1
592 nmdc:mga0yw44_65732_c1
593 nmdc:mga0k408_14390_c1
594 nmdc:mga0k408_27039_c1
595 nmdc:mga06z11_114996_c1
596 nmdc:mga06z11_12054_c1
597 nmdc:mga06z11_47115_c1
598 nmdc:mga06z11_70149_c1
599 nmdc:mga07m45_93595_c1
600 nmdc:mga05p37_379034_c1
601 nmdc:mga05p37_811_c1
602 nmdc:mga09592_2587_c1
603 nmdc:mga09592_45897_c1
604 nmdc:mga0qj67_1429_c1
605 nmdc:mga0qj67_2563_c1
606 nmdc:mga0qj67_350079_c1
607 nmdc:mga0qj67_437584_c1
608 nmdc:mga0qj67_60133_c1
609 nmdc:mga06r32_179542_c1
610 nmdc:mga06r32_18955_c1
611 nmdc:mga06r32_51955_c1
612 nmdc:mga08y16_167791_c1
613 nmdc:mga08y16_217121_c1
614 nmdc:mga08y16_2623_c1
615 nmdc:mga08y16_4247_c1
616 nmdc:mga08y16_445_c1
617 nmdc:mga08y16_5185_c1
618 nmdc:mga08y16_75126_c1
619 nmdc:mga08y16_9575_c1
620 nmdc:mga0n895_6924_c1
621 nmdc:mga08x19_160206_c1
622 nmdc:mga0a205_303643_c1
623 nmdc:mga0a205_3413_c1
624 Ga0495595_0056284
625 Ga0500641_0030011
626 Ga0500555_000241
627 Ga0500616_0000358
628 Ga0500645_002590
629 Ga0501084_0002006
630 Ga0501082_0002854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

292

418

0.96

PF12704

MacB_PCD

MacB-like periplasmic core domain

40

263

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8865 38 243
7w7c-assembly1.cif.gz_B-2 heme exporter in the unliganded form 0.8816 255 391
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.866 38 243
5udf-assembly1.cif.gz_C structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.858 38 243
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8573 38 243
ID Description Score Start End Superfamily
4pwuA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6781 210 241 3.30.70.260
af_Q57908_264_436_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.66 79 102 3.40.50.880
af_A0A1D6MKY7_352_440_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6537 205 240 3.30.70.330
af_Q9FM71_231_322_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6519 210 240 3.30.70.330
af_A0A1D8PGR8_607_716_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6167 202 240 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A352S7P5-F1-model_v4 Lipoprotein-releasing system transmembrane subunit LolC 0.9409 97 204 GO:0044874
GO:0098797
AF-A0A7C4JQ90-F1-model_v4 ABC transporter permease 0.9257 256 394 GO:0044874
GO:0098797
AF-A0A7C4JQ90-F1-model_v4 ABC transporter permease 0.9133 256 394 GO:0044874
GO:0098797
AF-A0A7C3I0U6-F1-model_v4 FtsX-like permease family protein 0.9065 88 394 GO:0044874
GO:0098797
AF-A0A090VLC4-F1-model_v4 ABC transporter permease protein 0.9027 269 394 GO:0044874
GO:0098797

Map