F403097

General Info

Members Datasets Scaffolds Average Seq Length
315 131 630 94

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10195474|Ga0081538_101954741
Length 102
Sequence VIAAFGLAIGVIVVAALDAVFGGLRAQLDELDDRAQAAGDADDEPELDRVLDEMWQLVQGRGERLADDDLSASDVVIPPSDLTLEETKRLFSDEGLIPDLPA

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
25 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
26 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
27 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
28 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
29 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
30 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
31 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
32 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
33 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
34 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
35 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
36 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
37 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
38 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
39 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
40 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
45 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
46 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
47 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
48 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
49 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
50 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
51 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
52 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
53 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
54 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
55 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
56 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
57 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
58 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
59 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
60 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
64 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
65 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
66 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
67 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
68 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
69 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
70 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
71 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
72 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
73 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
74 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
75 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
76 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
77 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
78 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
79 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
80 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
81 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
82 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
83 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 0.32
Rhizosphere 97.14
Stem 0
Stem Tuber 0
Unclassified 10.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10195474 3300005981 Bacteria 840
2 JGI25407J50210_10001578 3300003373 Bacteria 5190
3 JGI25407J50210_10008490 3300003373 Bacteria 2590
4 JGI25407J50210_10014062 3300003373 Bacteria 2061
5 JGI25407J50210_10021213 3300003373 Bacteria 1690
6 JGI25407J50210_10041236 3300003373 Bacteria 1182
7 Ga0070683_102076459 3300005329 Bacteria 546
8 Ga0070701_10982734 3300005438 Bacteria 588
9 Ga0070662_100617357 3300005457 Bacteria 913
10 Ga0070684_101962933 3300005535 Bacteria 552
11 Ga0081455_10006341 3300005937 Bacteria 12700
12 Ga0081455_10013726 3300005937 Bacteria 7975
13 Ga0081455_10029115 3300005937 Bacteria 5037
14 Ga0081455_10044879 3300005937 Bacteria 3850
15 Ga0081455_10099425 3300005937 Archaea 2340
16 Ga0081455_10119076 3300005937 Bacteria 2083
17 Ga0081455_10137765 3300005937 Bacteria 1899
18 Ga0081455_10576912 3300005937 Bacteria 738
19 Ga0081455_10663166 3300005937 Bacteria 670
20 Ga0081538_10000051 3300005981 Bacteria 109652
21 Ga0081538_10000411 3300005981 Bacteria 48407
22 Ga0081538_10001344 3300005981 Bacteria 25276
23 Ga0081538_10001353 3300005981 Bacteria 25231
24 Ga0081538_10002084 3300005981 Bacteria 19923
25 Ga0081538_10003916 3300005981 Bacteria 13890
26 Ga0081538_10007437 3300005981 Bacteria 9480
27 Ga0081538_10016672 3300005981 Bacteria 5619
28 Ga0081538_10025870 3300005981 Bacteria 4124
29 Ga0081538_10029515 3300005981 Bacteria 3745
30 Ga0081538_10043162 3300005981 Bacteria 2836
31 Ga0081538_10045008 3300005981 Bacteria 2742
32 Ga0081538_10048896 3300005981 Bacteria 2572
33 Ga0081538_10075838 3300005981 Bacteria 1822
34 Ga0081538_10341077 3300005981 Bacteria 543
35 Ga0075365_10668863 3300006038 Bacteria 734
36 Ga0075363_100574599 3300006048 Bacteria 674
37 Ga0075363_100979235 3300006048 Bacteria 520
38 Ga0075364_10003358 3300006051 Bacteria 9079
39 Ga0075432_10179021 3300006058 Bacteria 829
40 Ga0075432_10274133 3300006058 Bacteria 692
41 Ga0075367_10329109 3300006178 Bacteria 963
42 Ga0075428_100038908 3300006844 Bacteria 5233
43 Ga0075428_100385957 3300006844 Unclassified 1501
44 Ga0075428_101286192 3300006844 Unclassified 769
45 Ga0075430_100059169 3300006846 Bacteria 3221
46 Ga0075430_100143919 3300006846 Bacteria 1985
47 Ga0075430_100930599 3300006846 Bacteria 716
48 Ga0075431_100224893 3300006847 Bacteria 1913
49 Ga0075431_100309600 3300006847 Bacteria 1594
50 Ga0075431_100326547 3300006847 Bacteria 1546
51 Ga0075433_11558229 3300006852 Bacteria 570
52 Ga0075434_100003231 3300006871 Bacteria 14548
53 Ga0075429_100005640 3300006880 Bacteria 10792
54 Ga0075429_100581328 3300006880 Bacteria 981
55 Ga0075436_100158646 3300006914 Unclassified 1594
56 Ga0075435_100032320 3300007076 Bacteria 4132
57 Ga0111539_10036113 3300009094 Bacteria 5978
58 Ga0111539_10106122 3300009094 Bacteria 3295
59 Ga0111539_10269926 3300009094 Bacteria 1980
60 Ga0111539_11689744 3300009094 Bacteria 734
61 Ga0114129_10027685 3300009147 Bacteria 8025
62 Ga0114129_11130201 3300009147 Bacteria 979
63 Ga0114129_11762139 3300009147 Unclassified 754
64 Ga0114129_12144285 3300009147 Bacteria 673
65 Ga0114129_13106452 3300009147 Bacteria 543
66 Ga0182008_10066033 3300014497 Bacteria 1780
67 Ga0207428_10055854 3300027907 Bacteria 3138
68 Ga0307408_100049452 3300031548 Bacteria 3020
69 Ga0307405_10003617 3300031731 Bacteria 7148
70 Ga0307405_10204739 3300031731 Bacteria 1436
71 Ga0307413_10108097 3300031824 Bacteria 1855
72 Ga0307410_10028691 3300031852 Bacteria 3534
73 Ga0307406_10110380 3300031901 Bacteria 1892
74 Ga0307406_11635195 3300031901 Unclassified 570
75 Ga0307407_10122932 3300031903 Bacteria 1648
76 Ga0307412_10374746 3300031911 Bacteria 1150
77 Ga0307409_100369574 3300031995 Bacteria 1359
78 Ga0307409_101975635 3300031995 Unclassified 613
79 Ga0307416_100071440 3300032002 Bacteria 2883
80 Ga0307414_10197721 3300032004 Bacteria 1632
81 Ga0307411_10020281 3300032005 Bacteria 3862
82 Ga0307415_100043474 3300032126 Bacteria 2997
83 Ga0373962_0137632 3300035242 Bacteria 791
84 Ga0373931_0564509 3300035691 Bacteria 741
85 Ga0395899_0007614 3300037312 Bacteria 8352
86 Ga0395899_0433021 3300037312 Bacteria 864
87 Ga0395899_0549937 3300037312 Unclassified 742
88 Ga0395900_0032360 3300037418 Bacteria 5378
89 Ga0395900_0182661 3300037418 Bacteria 2130
90 Ga0395900_0191632 3300037418 Bacteria 2073
91 Ga0395900_0264375 3300037418 Bacteria 1717
92 Ga0395900_0759194 3300037418 Bacteria 900
93 Ga0395900_0937917 3300037418 Unclassified 787
94 Ga0395898_0036663 3300037466 Bacteria 4869
95 Ga0395898_0138399 3300037466 Bacteria 2331
96 Ga0395898_0255975 3300037466 Unclassified 1669
97 Ga0395898_0315648 3300037466 Bacteria 1491
98 Ga0395898_0391513 3300037466 Bacteria 1325
99 Ga0395898_0468965 3300037466 Bacteria 1198
100 Ga0395898_0772699 3300037466 Unclassified 901
101 Ga0395898_0997810 3300037466 Unclassified 773
102 Ga0395905_0123237 3300037471 Bacteria 2437
103 Ga0395905_0153035 3300037471 Bacteria 2169
104 Ga0395905_0240654 3300037471 Bacteria 1691
105 Ga0395905_0604289 3300037471 Bacteria 999
106 Ga0395905_0665490 3300037471 Unclassified 943
107 Ga0395905_0677873 3300037471 Bacteria 933
108 Ga0395905_0751546 3300037471 Unclassified 877
109 Ga0395901_0062485 3300038443 Bacteria 3875
110 Ga0395901_0099925 3300038443 Bacteria 3043
111 Ga0395901_0114504 3300038443 Bacteria 2832
112 Ga0395901_0144105 3300038443 Bacteria 2504
113 Ga0395901_0152993 3300038443 Bacteria 2423
114 Ga0395901_0346960 3300038443 Unclassified 1532
115 Ga0395901_0445238 3300038443 Bacteria 1325
116 Ga0395901_0460087 3300038443 Bacteria 1300
117 Ga0395901_0696686 3300038443 Bacteria 1014
118 Ga0395901_0719039 3300038443 Bacteria 994
119 Ga0439436_0049844 3300041404 Bacteria 1186
120 Ga0439439_0001252 3300041406 Bacteria 4943
121 Ga0439431_0012532 3300041997 Bacteria 1949
122 Ga0439433_0005990 3300041999 Bacteria 2613
123 Ga0439442_012629 3300042002 Bacteria 1726
124 Ga0439448_0066863 3300042005 Bacteria 1194
125 Ga0439448_0241022 3300042005 Unclassified 637
126 Ga0439450_140841 3300042008 Bacteria 629
127 Ga0439451_017560 3300042009 Bacteria 1443
128 Ga0439462_0005116 3300042015 Bacteria 3218
129 Ga0439463_134645 3300042016 Unclassified 640
130 Ga0450912_033947 3300042116 Unclassified 537
131 Ga0450913_025963 3300042117 Bacteria 560
132 Ga0450915_001926 3300042119 Bacteria 1033
133 Ga0450907_035258 3300042146 Bacteria 853
134 Ga0439446_0000817 3300042156 Bacteria 6635
135 Ga0439435_0190853 3300042436 Bacteria 672
136 Ga0439440_0224491 3300042993 Unclassified 564
137 Ga0451576_0098802 3300045051 Bacteria 3036
138 Ga0466967_2444730 3300045976 Bacteria 517
139 Ga0495590_0037468 3300046457 Bacteria 1691
140 Ga0495591_063645 3300046458 Bacteria 974
141 Ga0495596_0196902 3300046500 Unclassified 783
142 Ga0495620_0132866 3300046515 Bacteria 976
143 Ga0495631_0052628 3300046518 Unclassified 1778
144 Ga0495644_0029937 3300046523 Bacteria 2056
145 Ga0495642_0048189 3300046528 Bacteria 1747
146 Ga0495654_0122096 3300046530 Unclassified 1178
147 Ga0495609_0165559 3300046538 Bacteria 935
148 Ga0495621_0053127 3300046539 Bacteria 1454
149 Ga0495597_0382710 3300046542 Bacteria 536
150 Ga0495656_0167943 3300046615 Unclassified 1070
151 Ga0495656_0724596 3300046615 Bacteria 536
152 Ga0495659_0302639 3300046664 Bacteria 676
153 Ga0495661_0382421 3300046665 Bacteria 687
154 Ga0495669_0066119 3300046684 Bacteria 1642
155 Ga0495670_0544914 3300046691 Bacteria 631
156 Ga0495671_0188045 3300046692 Bacteria 1003
157 Ga0495649_0616648 3300046694 Bacteria 535
158 Ga0495660_0094040 3300046810 Bacteria 1553
159 Ga0495626_0201922 3300048091 Bacteria 815
160 Ga0496111_0830694 3300048914 Bacteria 668
161 Ga0501031_0001532 3300049568 Bacteria 14367
162 Ga0501031_0126927 3300049568 Bacteria 1666
163 Ga0501032_0003135 3300049569 Bacteria 12726
164 Ga0501032_0007688 3300049569 Bacteria 7857
165 Ga0501032_0097796 3300049569 Bacteria 1945
166 Ga0501033_0000321 3300049570 Bacteria 45516
167 Ga0501033_0058594 3300049570 Bacteria 2844
168 Ga0501036_0000038 3300049572 Bacteria 84269
169 Ga0501036_0056537 3300049572 Bacteria 3324
170 Ga0501036_0981740 3300049572 Bacteria 692
171 Ga0501036_1291499 3300049572 Bacteria 593
172 Ga0501036_1735261 3300049572 Bacteria 503
173 Ga0501037_0078973 3300049573 Archaea 2388
174 Ga0501037_0568270 3300049573 Bacteria 764
175 Ga0501038_0000382 3300049574 Bacteria 38262
176 Ga0501038_0002755 3300049574 Bacteria 16365
177 Ga0501038_0106584 3300049574 Bacteria 2326
178 Ga0501039_0000115 3300049575 Bacteria 54548
179 Ga0501039_0010780 3300049575 Bacteria 6960
180 Ga0501039_0111726 3300049575 Bacteria 2136
181 Ga0501039_0167643 3300049575 Bacteria 1726
182 Ga0501040_0000587 3300049576 Bacteria 22211
183 Ga0501040_0005377 3300049576 Bacteria 8281
184 Ga0501040_0018955 3300049576 Bacteria 4574
185 Ga0501040_0094053 3300049576 Bacteria 2085
186 Ga0501040_0222249 3300049576 Bacteria 1344
187 Ga0501040_0257174 3300049576 Bacteria 1246
188 Ga0501040_1224397 3300049576 Bacteria 545
189 Ga0501040_1407410 3300049576 Unclassified 506
190 Ga0501041_0000001 3300049577 Bacteria 96328
191 Ga0501041_0016869 3300049577 Bacteria 4345
192 Ga0501041_0017014 3300049577 Bacteria 4326
193 Ga0501041_0775201 3300049577 Bacteria 615
194 Ga0501042_0000002 3300049578 Bacteria 79574
195 Ga0501042_0002969 3300049578 Bacteria 10550
196 Ga0501042_0017132 3300049578 Bacteria 4992
197 Ga0501042_0476838 3300049578 Unclassified 905
198 Ga0501043_0000077 3300049579 Bacteria 86054
199 Ga0501043_0010437 3300049579 Bacteria 7275
200 Ga0501043_0200747 3300049579 Bacteria 1548
201 Ga0501043_0380049 3300049579 Bacteria 1069
202 Ga0501046_0000175 3300049580 Bacteria 65364
203 Ga0501046_0155409 3300049580 Bacteria 1724
204 Ga0501046_0198478 3300049580 Bacteria 1493
205 Ga0501047_0000162 3300049581 Bacteria 81578
206 Ga0501048_0000021 3300049582 Bacteria 69380
207 Ga0501048_0007399 3300049582 Bacteria 8319
208 Ga0501048_0034457 3300049582 Bacteria 3652
209 Ga0501048_0045948 3300049582 Bacteria 3117
210 Ga0501068_0000020 3300049584 Bacteria 59613
211 Ga0501068_0000388 3300049584 Bacteria 22270
212 Ga0501068_0143613 3300049584 Bacteria 1497
213 Ga0501068_0194120 3300049584 Bacteria 1287
214 Ga0501069_0038812 3300049585 Bacteria 2629
215 Ga0501069_0910134 3300049585 Bacteria 535
216 Ga0501070_0000652 3300049586 Bacteria 31934
217 Ga0501070_0009522 3300049586 Bacteria 8210
218 Ga0501070_0253202 3300049586 Bacteria 1440
219 Ga0501071_0000236 3300049587 Bacteria 25285
220 Ga0501071_0004749 3300049587 Bacteria 8648
221 Ga0501071_0029396 3300049587 Bacteria 3878
222 Ga0501071_0433663 3300049587 Bacteria 1005
223 Ga0501072_0000074 3300049588 Bacteria 72534
224 Ga0501072_0004518 3300049588 Bacteria 10578
225 Ga0501072_0018846 3300049588 Bacteria 5323
226 Ga0501072_0246002 3300049588 Bacteria 1424
227 Ga0501072_0801735 3300049588 Bacteria 738
228 Ga0501073_0002924 3300049589 Bacteria 12818
229 Ga0501073_0061749 3300049589 Bacteria 2614
230 Ga0501073_1109358 3300049589 Bacteria 544
231 Ga0501074_0000013 3300049590 Bacteria 81009
232 Ga0501074_0004916 3300049590 Bacteria 9576
233 Ga0501074_0041294 3300049590 Bacteria 3340
234 Ga0501075_0022966 3300049591 Bacteria 4562
235 Ga0501075_0080256 3300049591 Bacteria 2469
236 Ga0501075_0147272 3300049591 Bacteria 1794
237 Ga0501075_0209102 3300049591 Bacteria 1488
238 Ga0501075_0377524 3300049591 Bacteria 1081
239 Ga0501075_0384551 3300049591 Bacteria 1070
240 Ga0501076_0008070 3300049592 Bacteria 7693
241 Ga0501076_0015433 3300049592 Bacteria 5771
242 Ga0501076_0265527 3300049592 Bacteria 1405
243 Ga0501076_0270844 3300049592 Bacteria 1390
244 Ga0501076_0441821 3300049592 Bacteria 1071
245 Ga0501076_0871138 3300049592 Bacteria 743
246 Ga0501076_1663980 3300049592 Unclassified 524
247 Ga0501077_0000476 3300049593 Bacteria 24358
248 Ga0501077_0008444 3300049593 Bacteria 6381
249 Ga0501077_0029007 3300049593 Bacteria 3517
250 Ga0501077_0058037 3300049593 Bacteria 2457
251 Ga0501079_0000357 3300049741 Bacteria 29340
252 Ga0501079_0002362 3300049741 Bacteria 13707
253 Ga0501079_0112364 3300049741 Bacteria 2117
254 Ga0501079_0627425 3300049741 Bacteria 846
255 Ga0501079_0652546 3300049741 Bacteria 828
256 Ga0501079_1098969 3300049741 Bacteria 626
257 Ga0501079_1350011 3300049741 Unclassified 561
258 Ga0501079_1586760 3300049741 Bacteria 515
259 Ga0501080_0000031 3300049742 Bacteria 86869
260 Ga0501080_0012703 3300049742 Bacteria 7723
261 Ga0501080_0334826 3300049742 Bacteria 1368
262 Ga0501080_0794785 3300049742 Bacteria 830
263 Ga0501081_0000004 3300049743 Bacteria 94770
264 Ga0501081_0006256 3300049743 Bacteria 7719
265 Ga0501081_0013077 3300049743 Bacteria 5459
266 Ga0501081_0132693 3300049743 Bacteria 1780
267 Ga0501081_0492991 3300049743 Bacteria 913
268 Ga0501081_0629802 3300049743 Unclassified 804
269 Ga0501083_0000179 3300049744 Bacteria 40905
270 Ga0501083_0032764 3300049744 Bacteria 3562
271 Ga0501035_0000244 3300049822 Bacteria 65327
272 Ga0501035_0051432 3300049822 Bacteria 3689
273 Ga0501044_0022157 3300049823 Bacteria 6773
274 Ga0501044_0028494 3300049823 Bacteria 5895
275 Ga0501045_0009783 3300049824 Bacteria 6706
276 Ga0501045_0072735 3300049824 Bacteria 2531
277 Ga0501045_0184891 3300049824 Bacteria 1552
278 Ga0501045_0264869 3300049824 Bacteria 1279
279 nmdc:mga03683_240802_c1 3300050489 Bacteria 838
280 nmdc:mga00v17_139417_c1 3300050491 Bacteria 1554
281 nmdc:mga0yw44_870789_c1 3300050492 Unclassified 611
282 nmdc:mga05p37_1450549_c1 3300050507 Bacteria 687
283 nmdc:mga05p37_1638_c1 3300050507 Bacteria 25966
284 nmdc:mga05p37_1706590_c1 3300050507 Unclassified 614
285 nmdc:mga09592_2091_c1 3300050508 Bacteria 16114
286 nmdc:mga0qj67_42984_c1 3300050509 Bacteria 3559
287 nmdc:mga0qj67_442195_c1 3300050509 Bacteria 1048
288 nmdc:mga0qj67_711396_c1 3300050509 Unclassified 799
289 nmdc:mga06r32_122133_c1 3300050510 Bacteria 2570
290 nmdc:mga06r32_1338884_c1 3300050510 Bacteria 659
291 nmdc:mga06r32_1458012_c1 3300050510 Bacteria 625
292 nmdc:mga06r32_259722_c1 3300050510 Bacteria 1725
293 nmdc:mga08y16_1226236_c1 3300050511 Bacteria 720
294 nmdc:mga08y16_452829_c1 3300050511 Bacteria 1309
295 nmdc:mga08y16_47470_c1 3300050511 Bacteria 4494
296 nmdc:mga0n895_10169_c1 3300050512 Bacteria 8286
297 nmdc:mga0rr50_2246_c1 3300050513 Bacteria 10846
298 nmdc:mga08x19_420434_c1 3300050514 Unclassified 939
299 nmdc:mga0a205_1311991_c1 3300050515 Bacteria 571
300 nmdc:mga0a205_13168_c2 3300050515 Bacteria 3689
301 Ga0495655_0061200 3300053083 Bacteria 1027
302 Ga0501084_0010356 3300054114 Bacteria 7714
303 Ga0501084_0041689 3300054114 Bacteria 3840
304 Ga0501084_0060947 3300054114 Archaea 3158
305 Ga0501084_0129796 3300054114 Bacteria 2122
306 Ga0501084_0131989 3300054114 Bacteria 2102
307 Ga0501084_0363083 3300054114 Bacteria 1224
308 Ga0590075_004751 3300059424 Bacteria 3215
309 Ga0501082_0000481 3300060353 Bacteria 35235
310 Ga0501082_0078806 3300060353 Archaea 2841
311 Ga0501082_0730277 3300060353 Bacteria 867
312 Ga0530510_0000067 3300061734 Bacteria 52070
313 Ga0530510_0007871 3300061734 Bacteria 7432
314 Ga0530510_0161673 3300061734 Bacteria 1656
315 Ga0530510_0864888 3300061734 Unclassified 690
316 Ga0081538_10195474
317 JGI25407J50210_10001578
318 JGI25407J50210_10008490
319 JGI25407J50210_10014062
320 JGI25407J50210_10021213
321 JGI25407J50210_10041236
322 Ga0070683_102076459
323 Ga0070701_10982734
324 Ga0070662_100617357
325 Ga0070684_101962933
326 Ga0081455_10006341
327 Ga0081455_10013726
328 Ga0081455_10029115
329 Ga0081455_10044879
330 Ga0081455_10099425
331 Ga0081455_10119076
332 Ga0081455_10137765
333 Ga0081455_10576912
334 Ga0081455_10663166
335 Ga0081538_10000051
336 Ga0081538_10000411
337 Ga0081538_10001344
338 Ga0081538_10001353
339 Ga0081538_10002084
340 Ga0081538_10003916
341 Ga0081538_10007437
342 Ga0081538_10016672
343 Ga0081538_10025870
344 Ga0081538_10029515
345 Ga0081538_10043162
346 Ga0081538_10045008
347 Ga0081538_10048896
348 Ga0081538_10075838
349 Ga0081538_10341077
350 Ga0075365_10668863
351 Ga0075363_100574599
352 Ga0075363_100979235
353 Ga0075364_10003358
354 Ga0075432_10179021
355 Ga0075432_10274133
356 Ga0075367_10329109
357 Ga0075428_100038908
358 Ga0075428_100385957
359 Ga0075428_101286192
360 Ga0075430_100059169
361 Ga0075430_100143919
362 Ga0075430_100930599
363 Ga0075431_100224893
364 Ga0075431_100309600
365 Ga0075431_100326547
366 Ga0075433_11558229
367 Ga0075434_100003231
368 Ga0075429_100005640
369 Ga0075429_100581328
370 Ga0075436_100158646
371 Ga0075435_100032320
372 Ga0111539_10036113
373 Ga0111539_10106122
374 Ga0111539_10269926
375 Ga0111539_11689744
376 Ga0114129_10027685
377 Ga0114129_11130201
378 Ga0114129_11762139
379 Ga0114129_12144285
380 Ga0114129_13106452
381 Ga0182008_10066033
382 Ga0207428_10055854
383 Ga0307408_100049452
384 Ga0307405_10003617
385 Ga0307405_10204739
386 Ga0307413_10108097
387 Ga0307410_10028691
388 Ga0307406_10110380
389 Ga0307406_11635195
390 Ga0307407_10122932
391 Ga0307412_10374746
392 Ga0307409_100369574
393 Ga0307409_101975635
394 Ga0307416_100071440
395 Ga0307414_10197721
396 Ga0307411_10020281
397 Ga0307415_100043474
398 Ga0373962_0137632
399 Ga0373931_0564509
400 Ga0395899_0007614
401 Ga0395899_0433021
402 Ga0395899_0549937
403 Ga0395900_0032360
404 Ga0395900_0182661
405 Ga0395900_0191632
406 Ga0395900_0264375
407 Ga0395900_0759194
408 Ga0395900_0937917
409 Ga0395898_0036663
410 Ga0395898_0138399
411 Ga0395898_0255975
412 Ga0395898_0315648
413 Ga0395898_0391513
414 Ga0395898_0468965
415 Ga0395898_0772699
416 Ga0395898_0997810
417 Ga0395905_0123237
418 Ga0395905_0153035
419 Ga0395905_0240654
420 Ga0395905_0604289
421 Ga0395905_0665490
422 Ga0395905_0677873
423 Ga0395905_0751546
424 Ga0395901_0062485
425 Ga0395901_0099925
426 Ga0395901_0114504
427 Ga0395901_0144105
428 Ga0395901_0152993
429 Ga0395901_0346960
430 Ga0395901_0445238
431 Ga0395901_0460087
432 Ga0395901_0696686
433 Ga0395901_0719039
434 Ga0439436_0049844
435 Ga0439439_0001252
436 Ga0439431_0012532
437 Ga0439433_0005990
438 Ga0439442_012629
439 Ga0439448_0066863
440 Ga0439448_0241022
441 Ga0439450_140841
442 Ga0439451_017560
443 Ga0439462_0005116
444 Ga0439463_134645
445 Ga0450912_033947
446 Ga0450913_025963
447 Ga0450915_001926
448 Ga0450907_035258
449 Ga0439446_0000817
450 Ga0439435_0190853
451 Ga0439440_0224491
452 Ga0451576_0098802
453 Ga0466967_2444730
454 Ga0495590_0037468
455 Ga0495591_063645
456 Ga0495596_0196902
457 Ga0495620_0132866
458 Ga0495631_0052628
459 Ga0495644_0029937
460 Ga0495642_0048189
461 Ga0495654_0122096
462 Ga0495609_0165559
463 Ga0495621_0053127
464 Ga0495597_0382710
465 Ga0495656_0167943
466 Ga0495656_0724596
467 Ga0495659_0302639
468 Ga0495661_0382421
469 Ga0495669_0066119
470 Ga0495670_0544914
471 Ga0495671_0188045
472 Ga0495649_0616648
473 Ga0495660_0094040
474 Ga0495626_0201922
475 Ga0496111_0830694
476 Ga0501031_0001532
477 Ga0501031_0126927
478 Ga0501032_0003135
479 Ga0501032_0007688
480 Ga0501032_0097796
481 Ga0501033_0000321
482 Ga0501033_0058594
483 Ga0501036_0000038
484 Ga0501036_0056537
485 Ga0501036_0981740
486 Ga0501036_1291499
487 Ga0501036_1735261
488 Ga0501037_0078973
489 Ga0501037_0568270
490 Ga0501038_0000382
491 Ga0501038_0002755
492 Ga0501038_0106584
493 Ga0501039_0000115
494 Ga0501039_0010780
495 Ga0501039_0111726
496 Ga0501039_0167643
497 Ga0501040_0000587
498 Ga0501040_0005377
499 Ga0501040_0018955
500 Ga0501040_0094053
501 Ga0501040_0222249
502 Ga0501040_0257174
503 Ga0501040_1224397
504 Ga0501040_1407410
505 Ga0501041_0000001
506 Ga0501041_0016869
507 Ga0501041_0017014
508 Ga0501041_0775201
509 Ga0501042_0000002
510 Ga0501042_0002969
511 Ga0501042_0017132
512 Ga0501042_0476838
513 Ga0501043_0000077
514 Ga0501043_0010437
515 Ga0501043_0200747
516 Ga0501043_0380049
517 Ga0501046_0000175
518 Ga0501046_0155409
519 Ga0501046_0198478
520 Ga0501047_0000162
521 Ga0501048_0000021
522 Ga0501048_0007399
523 Ga0501048_0034457
524 Ga0501048_0045948
525 Ga0501068_0000020
526 Ga0501068_0000388
527 Ga0501068_0143613
528 Ga0501068_0194120
529 Ga0501069_0038812
530 Ga0501069_0910134
531 Ga0501070_0000652
532 Ga0501070_0009522
533 Ga0501070_0253202
534 Ga0501071_0000236
535 Ga0501071_0004749
536 Ga0501071_0029396
537 Ga0501071_0433663
538 Ga0501072_0000074
539 Ga0501072_0004518
540 Ga0501072_0018846
541 Ga0501072_0246002
542 Ga0501072_0801735
543 Ga0501073_0002924
544 Ga0501073_0061749
545 Ga0501073_1109358
546 Ga0501074_0000013
547 Ga0501074_0004916
548 Ga0501074_0041294
549 Ga0501075_0022966
550 Ga0501075_0080256
551 Ga0501075_0147272
552 Ga0501075_0209102
553 Ga0501075_0377524
554 Ga0501075_0384551
555 Ga0501076_0008070
556 Ga0501076_0015433
557 Ga0501076_0265527
558 Ga0501076_0270844
559 Ga0501076_0441821
560 Ga0501076_0871138
561 Ga0501076_1663980
562 Ga0501077_0000476
563 Ga0501077_0008444
564 Ga0501077_0029007
565 Ga0501077_0058037
566 Ga0501079_0000357
567 Ga0501079_0002362
568 Ga0501079_0112364
569 Ga0501079_0627425
570 Ga0501079_0652546
571 Ga0501079_1098969
572 Ga0501079_1350011
573 Ga0501079_1586760
574 Ga0501080_0000031
575 Ga0501080_0012703
576 Ga0501080_0334826
577 Ga0501080_0794785
578 Ga0501081_0000004
579 Ga0501081_0006256
580 Ga0501081_0013077
581 Ga0501081_0132693
582 Ga0501081_0492991
583 Ga0501081_0629802
584 Ga0501083_0000179
585 Ga0501083_0032764
586 Ga0501035_0000244
587 Ga0501035_0051432
588 Ga0501044_0022157
589 Ga0501044_0028494
590 Ga0501045_0009783
591 Ga0501045_0072735
592 Ga0501045_0184891
593 Ga0501045_0264869
594 nmdc:mga03683_240802_c1
595 nmdc:mga00v17_139417_c1
596 nmdc:mga0yw44_870789_c1
597 nmdc:mga05p37_1450549_c1
598 nmdc:mga05p37_1638_c1
599 nmdc:mga05p37_1706590_c1
600 nmdc:mga09592_2091_c1
601 nmdc:mga0qj67_42984_c1
602 nmdc:mga0qj67_442195_c1
603 nmdc:mga0qj67_711396_c1
604 nmdc:mga06r32_122133_c1
605 nmdc:mga06r32_1338884_c1
606 nmdc:mga06r32_1458012_c1
607 nmdc:mga06r32_259722_c1
608 nmdc:mga08y16_1226236_c1
609 nmdc:mga08y16_452829_c1
610 nmdc:mga08y16_47470_c1
611 nmdc:mga0n895_10169_c1
612 nmdc:mga0rr50_2246_c1
613 nmdc:mga08x19_420434_c1
614 nmdc:mga0a205_1311991_c1
615 nmdc:mga0a205_13168_c2
616 Ga0495655_0061200
617 Ga0501084_0010356
618 Ga0501084_0041689
619 Ga0501084_0060947
620 Ga0501084_0129796
621 Ga0501084_0131989
622 Ga0501084_0363083
623 Ga0590075_004751
624 Ga0501082_0000481
625 Ga0501082_0078806
626 Ga0501082_0730277
627 Ga0530510_0000067
628 Ga0530510_0007871
629 Ga0530510_0161673
630 Ga0530510_0864888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22743

PspAA

PspA-Associated protein

19

99

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tbn-assembly2.cif.gz_B lov2-darpin fusion : d11 0.9871 17 50
5xfl-assembly3.cif.gz_C crystal structure of the force-sensing device region of alpha n-catenin 0.9839 17 53
4fj3-assembly1.cif.gz_A 14-3-3 isoform zeta in complex with a diphoyphorylated c-raf peptide 0.9798 21 49
8p1h-assembly1.cif.gz_B-2 crystal structure of the chimera of human 14-3-3 zeta and phosphorylated cytoplasmic loop fragment of the alpha7 acetylcholine receptor 0.9754 21 49
6e9r-assembly1.cif.gz_B dhf46 filament 0.9747 14 52
ID Description Score Start End Superfamily
af_I1KTD4_1_365_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 1.002 16 53 1.25.40.10
af_I1K4U3_1_326_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 1.001 16 53 1.25.40.10
af_Q54UJ0_1_336_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 1.001 17 53 1.25.40.10
af_Q06409_1390_1534_1.25.40.410 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DOCK DHR2 domain, lobe A 0.9942 17 50 1.25.40.410
5xflD02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.9886 17 53 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A0D2S6E8-F1-model_v4 PCI domain-containing protein 1.006 16 53 GO:0005737
GO:0008541
AF-B9T3F2-F1-model_v4 PCI domain-containing protein 1.004 16 53 GO:0005737
GO:0008541
AF-A0A7I8J3J3-F1-model_v4 PCI domain-containing protein 1.002 16 53 GO:0005737
GO:0008541
AF-A0A0L9TJ93-F1-model_v4 PCI domain-containing protein 1.002 16 53 GO:0005737
GO:0008541
GO:0008757
AF-A0A445KQB7-F1-model_v4 26S proteasome non-ATPase regulatory subunit 12-like A isoform D 1.001 16 53 GO:0005737
GO:0008541
GO:0008757

Map