F403076

General Info

Members Datasets Scaffolds Average Seq Length
315 215 630 122

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_101210534|Ga0070693_1012105341
Length 140
Sequence MPIVGIEHVQLAMPEGEEDRARAFYSGLLGITEAAKPPELAKRGGVWFEHGAIRVHLGVERDFRPAKKAHPAFLVRDLAELTRRLRDAGVQVVDDGLFPGYDRVYVEDPFGNRIELMERATKSRRAGESADPVCAGRMKP

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
214 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
215 2854911287 Brucella lupini LUP21 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0.32
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 1.27
Rhizosphere 93.97
Stem 0
Stem Tuber 0
Unclassified 10.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_101210534 3300005547 Unclassified 580
2 JGI24737J22298_10064873 3300001990 Bacteria 1095
3 JGI25157J39369_1006007 3300002741 Bacteria 1901
4 rootH1_10277039 3300003323 Bacteria 2194
5 Ga0006562J51391_1011684 3300003578 Bacteria 2050
6 Ga0065712_10175652 3300005290 Unclassified 1219
7 Ga0065707_10359958 3300005295 Bacteria 905
8 Ga0070658_11647566 3300005327 Unclassified 556
9 Ga0070683_100682050 3300005329 Bacteria 984
10 Ga0070690_100368861 3300005330 Bacteria 1047
11 Ga0070670_100721390 3300005331 Bacteria 897
12 Ga0068869_100880400 3300005334 Bacteria 774
13 Ga0068869_101062779 3300005334 Bacteria 707
14 Ga0070682_100489890 3300005337 Unclassified 950
15 Ga0070661_100017612 3300005344 Bacteria 5070
16 Ga0070669_101081630 3300005353 Bacteria 690
17 Ga0070675_100189982 3300005354 Unclassified 1779
18 Ga0070667_101784415 3300005367 Unclassified 579
19 Ga0070713_101404803 3300005436 Bacteria 677
20 Ga0070710_10130879 3300005437 Bacteria 1530
21 Ga0070708_100911308 3300005445 Unclassified 825
22 Ga0070681_10039192 3300005458 Unclassified 4750
23 Ga0070699_101825609 3300005518 Bacteria 556
24 Ga0070679_100168200 3300005530 Bacteria 2165
25 Ga0070679_100249486 3300005530 Bacteria 1731
26 Ga0070679_100486812 3300005530 Bacteria 1178
27 Ga0070684_100342756 3300005535 Bacteria 1374
28 Ga0070697_100164498 3300005536 Bacteria 1876
29 Ga0068853_101887619 3300005539 Bacteria 579
30 Ga0068853_102432395 3300005539 Bacteria 507
31 Ga0070696_101258027 3300005546 Bacteria 627
32 Ga0068855_100072102 3300005563 Bacteria 4015
33 Ga0070664_100007934 3300005564 Bacteria 8576
34 Ga0068854_101310781 3300005578 Bacteria 652
35 Ga0068856_100018691 3300005614 Bacteria 6717
36 Ga0068852_100047919 3300005616 Bacteria 3649
37 Ga0068859_100030015 3300005617 Bacteria 5454
38 Ga0068859_101567158 3300005617 Bacteria 727
39 Ga0068861_101287530 3300005719 Bacteria 710
40 Ga0068861_101521586 3300005719 Bacteria 657
41 Ga0068861_101607623 3300005719 Bacteria 640
42 Ga0068858_100158858 3300005842 Bacteria 2128
43 Ga0068858_100292782 3300005842 Bacteria 1552
44 Ga0081455_10021389 3300005937 Bacteria 6068
45 Ga0081455_10291641 3300005937 Bacteria 1174
46 Ga0081455_10714180 3300005937 Bacteria 637
47 Ga0070717_11483387 3300006028 Viruses 615
48 Ga0075366_10166379 3300006195 Bacteria 1337
49 Ga0097620_100030016 3300006931 Bacteria 5454
50 Ga0097620_101567564 3300006931 Bacteria 727
51 Ga0105240_10012456 3300009093 Bacteria 11737
52 Ga0105240_10061094 3300009093 Bacteria 4696
53 Ga0105240_11351631 3300009093 Bacteria 750
54 Ga0105243_10244620 3300009148 Bacteria 1598
55 Ga0105243_13074971 3300009148 Bacteria 505
56 Ga0105242_10213265 3300009176 Bacteria 1722
57 Ga0105242_10792646 3300009176 Unclassified 937
58 Ga0105242_11245194 3300009176 Bacteria 765
59 Ga0105237_10362293 3300009545 Unclassified 1454
60 Ga0105237_10764430 3300009545 Unclassified 973
61 Ga0105238_10033196 3300009551 Bacteria 5253
62 Ga0157373_10099805 3300013100 Bacteria 2043
63 Ga0157371_10002645 3300013102 Bacteria 16988
64 Ga0157369_10002448 3300013105 Bacteria 22283
65 Ga0157369_11226659 3300013105 Bacteria 765
66 Ga0171462_1018 3300013250 Bacteria 157875
67 Ga0157372_10001714 3300013307 Bacteria 23796
68 Ga0157372_10142085 3300013307 Bacteria 2767
69 Ga0157372_10233393 3300013307 Bacteria 2133
70 Ga0157375_10061675 3300013308 Unclassified 3724
71 Ga0157375_13477331 3300013308 Bacteria 524
72 Ga0163163_10474611 3300014325 Bacteria 1312
73 Ga0163163_10602222 3300014325 Bacteria 1162
74 Ga0157379_10680289 3300014968 Bacteria 965
75 Ga0157379_12578757 3300014968 Bacteria 509
76 Ga0157376_10916879 3300014969 Bacteria 895
77 Ga0209026_1000383 3300025250 Bacteria 40563
78 Ga0207426_1001884 3300025302 Bacteria 15318
79 Ga0207705_10204110 3300025909 Unclassified 1498
80 Ga0207707_10102801 3300025912 Bacteria 2498
81 Ga0207695_10011576 3300025913 Bacteria 10671
82 Ga0207657_10956431 3300025919 Bacteria 658
83 Ga0207652_10004522 3300025921 Bacteria 11287
84 Ga0207652_10148675 3300025921 Bacteria 2097
85 Ga0207652_10410256 3300025921 Bacteria 1222
86 Ga0207681_10983379 3300025923 Bacteria 708
87 Ga0207681_11369826 3300025923 Unclassified 594
88 Ga0207694_10018161 3300025924 Bacteria 5317
89 Ga0207650_10768026 3300025925 Bacteria 816
90 Ga0207650_11597559 3300025925 Bacteria 553
91 Ga0207659_10014661 3300025926 Bacteria 5061
92 Ga0207700_10669241 3300025928 Bacteria 926
93 Ga0207664_10040920 3300025929 Bacteria 3608
94 Ga0207664_10048800 3300025929 Bacteria 3331
95 Ga0207706_10124221 3300025933 Bacteria 2270
96 Ga0207686_10125896 3300025934 Unclassified 1751
97 Ga0207689_10804060 3300025942 Bacteria 794
98 Ga0207667_10029121 3300025949 Bacteria 5991
99 Ga0207651_11056443 3300025960 Bacteria 727
100 Ga0207668_10235061 3300025972 Bacteria 1480
101 Ga0207677_10576267 3300026023 Unclassified 984
102 Ga0207703_10207169 3300026035 Bacteria 1746
103 Ga0207702_10007162 3300026078 Bacteria 9545
104 Ga0207676_11807342 3300026095 Bacteria 610
105 Ga0207675_100608380 3300026118 Bacteria 1096
106 Ga0268265_11571284 3300028380 Bacteria 662
107 Ga0265336_10004190 3300028666 Bacteria 5491
108 Ga0265338_10003672 3300028800 Bacteria 21389
109 Ga0265324_10156088 3300029957 Bacteria 775
110 Ga0265325_10260066 3300031241 Bacteria 784
111 Ga0265313_10013721 3300031595 Bacteria 4836
112 Ga0307415_102418319 3300032126 Bacteria 517
113 Ga0373944_0258652 3300035089 Bacteria 644
114 Ga0373923_0237607 3300035111 Bacteria 850
115 Ga0373943_0040206 3300035170 Unclassified 2257
116 Ga0373946_0009425 3300035171 Unclassified 3596
117 Ga0373935_0641376 3300035692 Bacteria 779
118 Ga0373933_0398186 3300035724 Unclassified 898
119 Ga0373947_0079620 3300035725 Bacteria 2025
120 Ga0373947_0795710 3300035725 Bacteria 645
121 Ga0373937_0019832 3300036401 Bacteria 6021
122 Ga0373937_0220503 3300036401 Bacteria 1785
123 Ga0373925_0000213 3300037068 Bacteria 63190
124 Ga0373925_0267049 3300037068 Bacteria 1376
125 Ga0395900_1002952 3300037418 Bacteria 755
126 Ga0395898_0155014 3300037466 Bacteria 2191
127 Ga0436365_0455457 3300039437 Bacteria 922
128 Ga0439448_0009893 3300042005 Bacteria 2817
129 Ga0453683_0931618 3300044673 Bacteria 575
130 Ga0466965_0528112 3300044683 Bacteria 664
131 Ga0466963_0004254 3300044694 Bacteria 8308
132 Ga0453684_0106248 3300044712 Bacteria 3421
133 Ga0466971_0049433 3300044719 Bacteria 1892
134 Ga0466971_0072532 3300044719 Bacteria 1564
135 Ga0466957_0055300 3300044842 Bacteria 2426
136 Ga0451576_0513588 3300045051 Bacteria 1259
137 Ga0466958_0034398 3300045836 Bacteria 3023
138 Ga0495592_0010058 3300046454 Bacteria 7125
139 Ga0495603_0026759 3300046455 Bacteria 3484
140 Ga0495603_0130656 3300046455 Bacteria 1462
141 Ga0495603_0344063 3300046455 Bacteria 855
142 Ga0495629_0182910 3300046459 Bacteria 1452
143 Ga0495629_0384125 3300046459 Bacteria 955
144 Ga0495638_0077740 3300046460 Bacteria 2020
145 Ga0495638_0084151 3300046460 Bacteria 1925
146 Ga0495641_0030064 3300046461 Bacteria 2610
147 Ga0495651_0047075 3300046462 Bacteria 3336
148 Ga0495653_0613097 3300046463 Bacteria 668
149 Ga0495653_0967365 3300046463 Unclassified 505
150 Ga0495580_0689821 3300046472 Bacteria 669
151 Ga0495582_0066423 3300046473 Bacteria 1993
152 Ga0495605_0011087 3300046474 Bacteria 5034
153 Ga0495639_0000040 3300046475 Bacteria 57045
154 Ga0495662_0126109 3300046476 Bacteria 1257
155 Ga0495664_0003333 3300046477 Bacteria 8729
156 Ga0495584_0045696 3300046491 Bacteria 2209
157 Ga0495585_0033586 3300046492 Bacteria 2903
158 Ga0495594_0048442 3300046499 Bacteria 2334
159 Ga0495594_0112692 3300046499 Unclassified 1534
160 Ga0495594_0158383 3300046499 Bacteria 1286
161 Ga0495596_0055874 3300046500 Bacteria 1542
162 Ga0495607_0057852 3300046501 Bacteria 2219
163 Ga0495607_0422941 3300046501 Unclassified 602
164 Ga0495583_0041011 3300046506 Bacteria 2170
165 Ga0495583_0085806 3300046506 Bacteria 1362
166 Ga0495583_0105518 3300046506 Bacteria 1198
167 Ga0495583_0271776 3300046506 Bacteria 676
168 Ga0495606_0031343 3300046507 Bacteria 3698
169 Ga0495606_0137524 3300046507 Bacteria 1445
170 Ga0495608_0509407 3300046511 Bacteria 728
171 Ga0495616_0004153 3300046513 Bacteria 9181
172 Ga0495616_0102074 3300046513 Bacteria 1344
173 Ga0495618_0079661 3300046514 Bacteria 2089
174 Ga0495618_0267105 3300046514 Bacteria 1070
175 Ga0495620_0068250 3300046515 Bacteria 1460
176 Ga0495628_0099601 3300046516 Bacteria 2244
177 Ga0495628_0621948 3300046516 Bacteria 769
178 Ga0495630_0331194 3300046517 Bacteria 1164
179 Ga0495631_0018641 3300046518 Bacteria 3264
180 Ga0495631_0143023 3300046518 Bacteria 1027
181 Ga0495632_0073003 3300046519 Bacteria 1646
182 Ga0495643_0018872 3300046522 Bacteria 3995
183 Ga0495644_0113990 3300046523 Bacteria 1026
184 Ga0495648_0050499 3300046524 Bacteria 2540
185 Ga0495648_0125006 3300046524 Bacteria 1376
186 Ga0495666_0031256 3300046526 Bacteria 2608
187 Ga0495666_0071818 3300046526 Bacteria 1645
188 Ga0495666_0216772 3300046526 Bacteria 877
189 Ga0495642_0103734 3300046528 Bacteria 1212
190 Ga0495652_0154377 3300046529 Bacteria 1789
191 Ga0495654_0177920 3300046530 Bacteria 923
192 Ga0495640_0049462 3300046533 Bacteria 2898
193 Ga0495586_0000769 3300046535 Bacteria 18414
194 Ga0495598_0001848 3300046537 Bacteria 4264
195 Ga0495609_0367931 3300046538 Unclassified 578
196 Ga0495597_0179342 3300046542 Bacteria 856
197 Ga0495622_0003105 3300046557 Bacteria 7872
198 Ga0495622_0273628 3300046557 Bacteria 739
199 Ga0495622_0351905 3300046557 Bacteria 638
200 Ga0495633_0025165 3300046558 Bacteria 2932
201 Ga0495633_0058229 3300046558 Bacteria 1814
202 Ga0495656_0255507 3300046615 Bacteria 886
203 Ga0495656_0490497 3300046615 Unclassified 651
204 Ga0495668_0066846 3300046616 Bacteria 1977
205 Ga0495668_0274488 3300046616 Bacteria 923
206 Ga0495634_0240549 3300046642 Bacteria 1110
207 Ga0495611_0122402 3300046648 Bacteria 1213
208 Ga0495611_0163099 3300046648 Bacteria 1041
209 Ga0495611_0262980 3300046648 Bacteria 798
210 Ga0495625_0226954 3300046660 Bacteria 1221
211 Ga0495625_0316522 3300046660 Bacteria 994
212 Ga0495635_0031726 3300046663 Bacteria 3666
213 Ga0495635_0148086 3300046663 Bacteria 1598
214 Ga0495657_0111046 3300046675 Bacteria 1736
215 Ga0495623_0152425 3300046679 Bacteria 1365
216 Ga0495646_0122519 3300046680 Bacteria 1470
217 Ga0495647_0001632 3300046681 Bacteria 6938
218 Ga0495613_0106178 3300046689 Bacteria 2026
219 Ga0495613_0136179 3300046689 Bacteria 1757
220 Ga0495613_0201607 3300046689 Bacteria 1402
221 Ga0495613_0515654 3300046689 Bacteria 803
222 Ga0495624_0025370 3300046690 Bacteria 3892
223 Ga0495624_0097661 3300046690 Bacteria 1809
224 Ga0495670_0714586 3300046691 Bacteria 546
225 Ga0495671_0150045 3300046692 Bacteria 1135
226 Ga0495671_0415136 3300046692 Bacteria 644
227 Ga0495649_0056197 3300046694 Bacteria 2125
228 Ga0495589_0009307 3300046794 Bacteria 5110
229 Ga0495589_0159122 3300046794 Bacteria 1076
230 Ga0495600_0823885 3300046809 Unclassified 552
231 Ga0495660_0069196 3300046810 Bacteria 1876
232 Ga0495660_0230314 3300046810 Bacteria 869
233 Ga0495581_0035573 3300047315 Unclassified 2881
234 Ga0495604_0075950 3300047317 Bacteria 2528
235 Ga0495604_0171963 3300047317 Bacteria 1522
236 Ga0495636_0064034 3300047318 Bacteria 1559
237 Ga0495636_0124859 3300047318 Bacteria 1141
238 Ga0495674_0224100 3300047319 Bacteria 1553
239 Ga0495676_0002851 3300047321 Bacteria 15582
240 Ga0495676_0032025 3300047321 Bacteria 4442
241 Ga0495676_0080437 3300047321 Bacteria 2474
242 Ga0495676_0148812 3300047321 Bacteria 1669
243 Ga0495676_0552641 3300047321 Bacteria 752
244 Ga0495680_0008739 3300047322 Bacteria 9174
245 Ga0495680_0999820 3300047322 Bacteria 534
246 Ga0495687_028747 3300047443 Bacteria 2581
247 Ga0495687_076730 3300047443 Bacteria 1321
248 Ga0495687_080666 3300047443 Bacteria 1275
249 Ga0495687_117643 3300047443 Bacteria 964
250 Ga0495675_0040361 3300047444 Bacteria 2974
251 Ga0495677_0073681 3300047445 Bacteria 1274
252 Ga0495685_014410 3300047447 Bacteria 2686
253 Ga0495685_037450 3300047447 Bacteria 1663
254 Ga0495685_181737 3300047447 Unclassified 677
255 Ga0495681_0307935 3300047470 Unclassified 611
256 Ga0495686_0049001 3300047472 Bacteria 2660
257 Ga0495593_0075187 3300047673 Bacteria 1751
258 Ga0495593_0079740 3300047673 Bacteria 1694
259 Ga0495593_0378896 3300047673 Bacteria 707
260 Ga0495614_0016566 3300048089 Bacteria 3206
261 Ga0495614_0054815 3300048089 Bacteria 1710
262 Ga0495614_0355308 3300048089 Bacteria 683
263 Ga0495626_0015793 3300048091 Bacteria 3854
264 Ga0495626_0361834 3300048091 Bacteria 565
265 Ga0496108_0398195 3300048911 Bacteria 1202
266 Ga0496109_0064153 3300048912 Bacteria 3361
267 Ga0496109_0221508 3300048912 Bacteria 1779
268 Ga0496110_0726638 3300048913 Bacteria 895
269 Ga0495678_047075 3300049459 Bacteria 1691
270 Ga0501033_0907808 3300049570 Bacteria 592
271 Ga0501034_0023433 3300049571 Bacteria 6290
272 Ga0501034_0091462 3300049571 Bacteria 3040
273 Ga0501036_0318180 3300049572 Bacteria 1300
274 Ga0501036_0384097 3300049572 Bacteria 1172
275 Ga0501036_0648106 3300049572 Bacteria 874
276 Ga0501037_0789644 3300049573 Bacteria 627
277 Ga0501037_1144707 3300049573 Bacteria 503
278 Ga0501038_0000244 3300049574 Bacteria 46048
279 Ga0501038_0912155 3300049574 Bacteria 648
280 Ga0501039_0421295 3300049575 Bacteria 1049
281 Ga0501042_1095535 3300049578 Bacteria 581
282 Ga0501043_0016261 3300049579 Bacteria 5835
283 Ga0501043_0097817 3300049579 Bacteria 2307
284 Ga0501046_1182880 3300049580 Unclassified 526
285 Ga0501047_0091497 3300049581 Bacteria 2920
286 Ga0501047_0109407 3300049581 Bacteria 2646
287 Ga0501047_0329488 3300049581 Bacteria 1365
288 Ga0501048_0177715 3300049582 Bacteria 1509
289 Ga0501070_0412589 3300049586 Bacteria 1091
290 Ga0501070_0876024 3300049586 Unclassified 701
291 Ga0501070_1096084 3300049586 Bacteria 614
292 Ga0501073_0122445 3300049589 Bacteria 1803
293 Ga0501076_0204986 3300049592 Bacteria 1611
294 Ga0501080_0102381 3300049742 Bacteria 2656
295 Ga0501080_0290916 3300049742 Bacteria 1483
296 Ga0501083_0352990 3300049744 Bacteria 956
297 Ga0501035_0079207 3300049822 Bacteria 2902
298 Ga0501035_0097274 3300049822 Bacteria 2585
299 Ga0501044_0028813 3300049823 Bacteria 5857
300 Ga0501044_0043382 3300049823 Bacteria 4671
301 Ga0501044_0103193 3300049823 Bacteria 2866
302 Ga0501045_0595447 3300049824 Bacteria 819
303 nmdc:mga0k408_163765_c1 3300050493 Bacteria 995
304 nmdc:mga06r32_1594662_c1 3300050510 Unclassified 591
305 Ga0495601_0926108 3300053077 Bacteria 550
306 Ga0500578_0196088 3300053086 Bacteria 1238
307 Ga0500644_0039877 3300053088 Bacteria 1551
308 Ga0500644_0265135 3300053088 Unclassified 727
309 Ga0500583_0493657 3300053092 Unclassified 576
310 Ga0500616_0006144 3300053153 Bacteria 7940
311 Ga0501082_1337622 3300060353 Bacteria 626
312 Ga0466962_0307275 3300061719 Unclassified 785
313 2616695334 2616644814 Bacteria 11555299
314 2785369251 2784746768 Bacteria 10036182
315 2854912597 2854911287 Bacteria 5582813
316 Ga0070693_101210534
317 JGI24737J22298_10064873
318 JGI25157J39369_1006007
319 rootH1_10277039
320 Ga0006562J51391_1011684
321 Ga0065712_10175652
322 Ga0065707_10359958
323 Ga0070658_11647566
324 Ga0070683_100682050
325 Ga0070690_100368861
326 Ga0070670_100721390
327 Ga0068869_100880400
328 Ga0068869_101062779
329 Ga0070682_100489890
330 Ga0070661_100017612
331 Ga0070669_101081630
332 Ga0070675_100189982
333 Ga0070667_101784415
334 Ga0070713_101404803
335 Ga0070710_10130879
336 Ga0070708_100911308
337 Ga0070681_10039192
338 Ga0070699_101825609
339 Ga0070679_100168200
340 Ga0070679_100249486
341 Ga0070679_100486812
342 Ga0070684_100342756
343 Ga0070697_100164498
344 Ga0068853_101887619
345 Ga0068853_102432395
346 Ga0070696_101258027
347 Ga0068855_100072102
348 Ga0070664_100007934
349 Ga0068854_101310781
350 Ga0068856_100018691
351 Ga0068852_100047919
352 Ga0068859_100030015
353 Ga0068859_101567158
354 Ga0068861_101287530
355 Ga0068861_101521586
356 Ga0068861_101607623
357 Ga0068858_100158858
358 Ga0068858_100292782
359 Ga0081455_10021389
360 Ga0081455_10291641
361 Ga0081455_10714180
362 Ga0070717_11483387
363 Ga0075366_10166379
364 Ga0097620_100030016
365 Ga0097620_101567564
366 Ga0105240_10012456
367 Ga0105240_10061094
368 Ga0105240_11351631
369 Ga0105243_10244620
370 Ga0105243_13074971
371 Ga0105242_10213265
372 Ga0105242_10792646
373 Ga0105242_11245194
374 Ga0105237_10362293
375 Ga0105237_10764430
376 Ga0105238_10033196
377 Ga0157373_10099805
378 Ga0157371_10002645
379 Ga0157369_10002448
380 Ga0157369_11226659
381 Ga0171462_1018
382 Ga0157372_10001714
383 Ga0157372_10142085
384 Ga0157372_10233393
385 Ga0157375_10061675
386 Ga0157375_13477331
387 Ga0163163_10474611
388 Ga0163163_10602222
389 Ga0157379_10680289
390 Ga0157379_12578757
391 Ga0157376_10916879
392 Ga0209026_1000383
393 Ga0207426_1001884
394 Ga0207705_10204110
395 Ga0207707_10102801
396 Ga0207695_10011576
397 Ga0207657_10956431
398 Ga0207652_10004522
399 Ga0207652_10148675
400 Ga0207652_10410256
401 Ga0207681_10983379
402 Ga0207681_11369826
403 Ga0207694_10018161
404 Ga0207650_10768026
405 Ga0207650_11597559
406 Ga0207659_10014661
407 Ga0207700_10669241
408 Ga0207664_10040920
409 Ga0207664_10048800
410 Ga0207706_10124221
411 Ga0207686_10125896
412 Ga0207689_10804060
413 Ga0207667_10029121
414 Ga0207651_11056443
415 Ga0207668_10235061
416 Ga0207677_10576267
417 Ga0207703_10207169
418 Ga0207702_10007162
419 Ga0207676_11807342
420 Ga0207675_100608380
421 Ga0268265_11571284
422 Ga0265336_10004190
423 Ga0265338_10003672
424 Ga0265324_10156088
425 Ga0265325_10260066
426 Ga0265313_10013721
427 Ga0307415_102418319
428 Ga0373944_0258652
429 Ga0373923_0237607
430 Ga0373943_0040206
431 Ga0373946_0009425
432 Ga0373935_0641376
433 Ga0373933_0398186
434 Ga0373947_0079620
435 Ga0373947_0795710
436 Ga0373937_0019832
437 Ga0373937_0220503
438 Ga0373925_0000213
439 Ga0373925_0267049
440 Ga0395900_1002952
441 Ga0395898_0155014
442 Ga0436365_0455457
443 Ga0439448_0009893
444 Ga0453683_0931618
445 Ga0466965_0528112
446 Ga0466963_0004254
447 Ga0453684_0106248
448 Ga0466971_0049433
449 Ga0466971_0072532
450 Ga0466957_0055300
451 Ga0451576_0513588
452 Ga0466958_0034398
453 Ga0495592_0010058
454 Ga0495603_0026759
455 Ga0495603_0130656
456 Ga0495603_0344063
457 Ga0495629_0182910
458 Ga0495629_0384125
459 Ga0495638_0077740
460 Ga0495638_0084151
461 Ga0495641_0030064
462 Ga0495651_0047075
463 Ga0495653_0613097
464 Ga0495653_0967365
465 Ga0495580_0689821
466 Ga0495582_0066423
467 Ga0495605_0011087
468 Ga0495639_0000040
469 Ga0495662_0126109
470 Ga0495664_0003333
471 Ga0495584_0045696
472 Ga0495585_0033586
473 Ga0495594_0048442
474 Ga0495594_0112692
475 Ga0495594_0158383
476 Ga0495596_0055874
477 Ga0495607_0057852
478 Ga0495607_0422941
479 Ga0495583_0041011
480 Ga0495583_0085806
481 Ga0495583_0105518
482 Ga0495583_0271776
483 Ga0495606_0031343
484 Ga0495606_0137524
485 Ga0495608_0509407
486 Ga0495616_0004153
487 Ga0495616_0102074
488 Ga0495618_0079661
489 Ga0495618_0267105
490 Ga0495620_0068250
491 Ga0495628_0099601
492 Ga0495628_0621948
493 Ga0495630_0331194
494 Ga0495631_0018641
495 Ga0495631_0143023
496 Ga0495632_0073003
497 Ga0495643_0018872
498 Ga0495644_0113990
499 Ga0495648_0050499
500 Ga0495648_0125006
501 Ga0495666_0031256
502 Ga0495666_0071818
503 Ga0495666_0216772
504 Ga0495642_0103734
505 Ga0495652_0154377
506 Ga0495654_0177920
507 Ga0495640_0049462
508 Ga0495586_0000769
509 Ga0495598_0001848
510 Ga0495609_0367931
511 Ga0495597_0179342
512 Ga0495622_0003105
513 Ga0495622_0273628
514 Ga0495622_0351905
515 Ga0495633_0025165
516 Ga0495633_0058229
517 Ga0495656_0255507
518 Ga0495656_0490497
519 Ga0495668_0066846
520 Ga0495668_0274488
521 Ga0495634_0240549
522 Ga0495611_0122402
523 Ga0495611_0163099
524 Ga0495611_0262980
525 Ga0495625_0226954
526 Ga0495625_0316522
527 Ga0495635_0031726
528 Ga0495635_0148086
529 Ga0495657_0111046
530 Ga0495623_0152425
531 Ga0495646_0122519
532 Ga0495647_0001632
533 Ga0495613_0106178
534 Ga0495613_0136179
535 Ga0495613_0201607
536 Ga0495613_0515654
537 Ga0495624_0025370
538 Ga0495624_0097661
539 Ga0495670_0714586
540 Ga0495671_0150045
541 Ga0495671_0415136
542 Ga0495649_0056197
543 Ga0495589_0009307
544 Ga0495589_0159122
545 Ga0495600_0823885
546 Ga0495660_0069196
547 Ga0495660_0230314
548 Ga0495581_0035573
549 Ga0495604_0075950
550 Ga0495604_0171963
551 Ga0495636_0064034
552 Ga0495636_0124859
553 Ga0495674_0224100
554 Ga0495676_0002851
555 Ga0495676_0032025
556 Ga0495676_0080437
557 Ga0495676_0148812
558 Ga0495676_0552641
559 Ga0495680_0008739
560 Ga0495680_0999820
561 Ga0495687_028747
562 Ga0495687_076730
563 Ga0495687_080666
564 Ga0495687_117643
565 Ga0495675_0040361
566 Ga0495677_0073681
567 Ga0495685_014410
568 Ga0495685_037450
569 Ga0495685_181737
570 Ga0495681_0307935
571 Ga0495686_0049001
572 Ga0495593_0075187
573 Ga0495593_0079740
574 Ga0495593_0378896
575 Ga0495614_0016566
576 Ga0495614_0054815
577 Ga0495614_0355308
578 Ga0495626_0015793
579 Ga0495626_0361834
580 Ga0496108_0398195
581 Ga0496109_0064153
582 Ga0496109_0221508
583 Ga0496110_0726638
584 Ga0495678_047075
585 Ga0501033_0907808
586 Ga0501034_0023433
587 Ga0501034_0091462
588 Ga0501036_0318180
589 Ga0501036_0384097
590 Ga0501036_0648106
591 Ga0501037_0789644
592 Ga0501037_1144707
593 Ga0501038_0000244
594 Ga0501038_0912155
595 Ga0501039_0421295
596 Ga0501042_1095535
597 Ga0501043_0016261
598 Ga0501043_0097817
599 Ga0501046_1182880
600 Ga0501047_0091497
601 Ga0501047_0109407
602 Ga0501047_0329488
603 Ga0501048_0177715
604 Ga0501070_0412589
605 Ga0501070_0876024
606 Ga0501070_1096084
607 Ga0501073_0122445
608 Ga0501076_0204986
609 Ga0501080_0102381
610 Ga0501080_0290916
611 Ga0501083_0352990
612 Ga0501035_0079207
613 Ga0501035_0097274
614 Ga0501044_0028813
615 Ga0501044_0043382
616 Ga0501044_0103193
617 Ga0501045_0595447
618 nmdc:mga0k408_163765_c1
619 nmdc:mga06r32_1594662_c1
620 Ga0495601_0926108
621 Ga0500578_0196088
622 Ga0500644_0039877
623 Ga0500644_0265135
624 Ga0500583_0493657
625 Ga0500616_0006144
626 Ga0501082_1337622
627 Ga0466962_0307275
628 2616695334
629 2785369251
630 2854912597

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

5

116

0.83

PF18029

Glyoxalase_6

Glyoxalase-like domain

10

117

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.9497 1 120
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.9421 1 120
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8352 1 120
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.8272 3 118
1lqo-assembly1.cif.gz_B crystal strutcure of the fosfomycin resistance protein a (fosa) containing bound thallium cations 0.8257 2 120
ID Description Score Start End Superfamily
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9519 7 120 3.10.180.10
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9438 7 120 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8717 70 117 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.848 69 120 3.30.720.110
af_I1LTD0_10_138_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8364 3 117 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W0XIR7-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9879 2 119 GO:0004638
GO:0006189
GO:0034023
AF-A0A165X6C6-F1-model_v4 Glyoxalase-like domain protein 0.9879 1 119
AF-A0A7W0P2E9-F1-model_v4 VOC family protein 0.9873 1 120
AF-A0A537VLQ6-F1-model_v4 Glyoxalase 0.9868 13 120
AF-A0A1G9RTV8-F1-model_v4 Catechol 2,3-dioxygenase 0.986 1 120 GO:0051213

Map