F402887

General Info

Members Datasets Scaffolds Average Seq Length
314 179 297 287

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0055797|Ga0501034_0055797_2481_3422
Length 313
Sequence MVPRRGAERGSRFVTDTPAEHIAQATSPAGDIVGTRNRWYLGLLLVAAPVLLVCWLIIYPILAAVVQTVWLPTEGGGHTFSLETYRFFFSDGYSLNNLWITLWTTFVCAVFLLLICLPIALYLRFSEGRLPAYVQALAIFPMFVPSIILSYAFIRVLGPNGMVDILLNAVHLPKIRSPYLTPWGPVIGLVWDHIPLTVLILLSGLGNVSNQSIEAARDVGAGRLTVLWHIILPRMGNSVLVAASFAVLGIFSAFTIPYVLGPAAPEMMGPFMQRTFRELYDPTGAITQAVVSFGFCIVFGLFYVRSVARNQRT

Samples

Sample ID Description Type Environment
1 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
2 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
3 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
4 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
5 2643221580 Devosia sp. Root635 Isolate Unclassified
6 2643221591 Devosia sp. Root685 Isolate Unclassified
7 2643221629 Devosia sp. Root105 Isolate Unclassified
8 2643221662 Devosia sp. Root413D1 Isolate Unclassified
9 2643221674 Devosia sp. Root436 Isolate Unclassified
10 2791355267 Rhizobium sp. L18 Isolate Nodule
11 2996887358 Rhizobium sp. R711 Isolate Nodule
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
166 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
167 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
170 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
171 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
174 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
175 8005321885 Rhizobium sp. R72 Isolate Nodule
176 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
177 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
178 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
179 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.59
Metatranscriptomes 0
Isolates 5.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.43
Nodule 2.55
Rhizoplane 1.59
Rhizosphere 61.15
Stem 0
Stem Tuber 0
Unclassified 8.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001890 3300002773 Bacteria 8405
2 JGI25152J39213_1003678 3300002773 Bacteria 5152
3 JGI25150J39212_1006640 3300002774 Bacteria 2372
4 JGI25159J45721_1000494 3300002987 Bacteria 18045
5 JGI25159J45721_1000617 3300002987 Bacteria 15842
6 JGI25151J46595_10003710 3300003187 Bacteria 8300
7 JGI25151J46595_10047659 3300003187 Bacteria 1488
8 JGI25165J46597_1006201 3300003214 Bacteria 2151
9 JGI25153J46596_10000066 3300003215 Bacteria 123268
10 rootH2_10025492 3300003320 Bacteria 3359
11 rootH1_10030555 3300003323 Bacteria 4039
12 JGI25160J50197_1000023 3300003354 Bacteria 200692
13 JGI25160J50197_1032569 3300003354 Bacteria 1322
14 JGI25161J50226_1000012 3300003374 Bacteria 200668
15 JGI25161J50226_1000603 3300003374 Bacteria 14876
16 Ga0055526_1004682 3300003771 Bacteria 8126
17 Ga0055526_1020414 3300003771 Bacteria 2358
18 Ga0055524_1002195 3300003775 Bacteria 10248
19 Ga0055524_1003632 3300003775 Bacteria 7419
20 Ga0055524_1014733 3300003775 Bacteria 2883
21 Ga0055528_1001688 3300003790 Bacteria 12898
22 Ga0055540_1000661 3300003792 Bacteria 24169
23 Ga0055531_10029440 3300003794 Bacteria 1870
24 Ga0055543_1000009 3300004625 Bacteria 200706
25 Ga0055543_1000056 3300004625 Bacteria 103704
26 Ga0065165_1000064 3300005262 Bacteria 175153
27 Ga0070658_10015959 3300005327 Bacteria 6008
28 Ga0070658_10017551 3300005327 Bacteria 5725
29 Ga0070682_100015618 3300005337 Bacteria 4402
30 Ga0070660_100095846 3300005339 Bacteria 2345
31 Ga0070661_100000896 3300005344 Bacteria 21350
32 Ga0070661_100241955 3300005344 Bacteria 1390
33 Ga0070668_100162640 3300005347 Bacteria 1812
34 Ga0070668_100205462 3300005347 Bacteria 1618
35 Ga0070675_100121690 3300005354 Bacteria 2218
36 Ga0070671_100100789 3300005355 Bacteria 2423
37 Ga0070674_100007681 3300005356 Bacteria 6371
38 Ga0070673_100190882 3300005364 Bacteria 1760
39 Ga0070659_100069769 3300005366 Bacteria 2790
40 Ga0070663_100101156 3300005455 Bacteria 2151
41 Ga0070662_100168237 3300005457 Bacteria 1719
42 Ga0068867_100036354 3300005459 Bacteria 3575
43 Ga0070684_100300401 3300005535 Bacteria 1473
44 Ga0070684_100403708 3300005535 Bacteria 1260
45 Ga0068853_100002929 3300005539 Bacteria 12979
46 Ga0068853_100005068 3300005539 Bacteria 10278
47 Ga0068853_100014249 3300005539 Bacteria 6507
48 Ga0068853_100019152 3300005539 Bacteria 5672
49 Ga0068853_100176138 3300005539 Bacteria 1937
50 Ga0070665_100340865 3300005548 Bacteria 1504
51 Ga0068855_100127668 3300005563 Bacteria 2907
52 Ga0068855_100146427 3300005563 Bacteria 2688
53 Ga0068855_100391455 3300005563 Bacteria 1524
54 Ga0070664_100422786 3300005564 Bacteria 1221
55 Ga0068857_100032633 3300005577 Bacteria 4604
56 Ga0068857_100047495 3300005577 Bacteria 3811
57 Ga0068854_100078409 3300005578 Bacteria 2433
58 Ga0068854_100083166 3300005578 Bacteria 2367
59 Ga0068856_100006424 3300005614 Bacteria 11534
60 Ga0068856_100046683 3300005614 Bacteria 4265
61 Ga0068856_100067043 3300005614 Bacteria 3546
62 Ga0068856_100095719 3300005614 Bacteria 2957
63 Ga0068856_100152104 3300005614 Bacteria 2323
64 Ga0068852_100035188 3300005616 Bacteria 4174
65 Ga0068852_100161203 3300005616 Bacteria 2094
66 Ga0068851_10002793 3300005834 Bacteria 7694
67 Ga0068851_10049753 3300005834 Bacteria 2127
68 Ga0075365_10225281 3300006038 Bacteria 1316
69 Ga0075364_10067045 3300006051 Bacteria 2359
70 Ga0075362_10093452 3300006177 Bacteria 1398
71 Ga0075367_10006595 3300006178 Bacteria 5879
72 Ga0075367_10149235 3300006178 Bacteria 1450
73 Ga0075366_10019116 3300006195 Bacteria 3959
74 Ga0075370_10112220 3300006353 Bacteria 1584
75 Ga0068871_100184822 3300006358 Bacteria 1793
76 Ga0105244_10178519 3300009036 Bacteria 1008
77 Ga0105240_10090090 3300009093 Bacteria 3750
78 Ga0105240_10669638 3300009093 Bacteria 1135
79 Ga0105241_10010453 3300009174 Bacteria 6811
80 Ga0105241_10025156 3300009174 Bacteria 4424
81 Ga0105241_10409996 3300009174 Bacteria 1190
82 Ga0105248_10224134 3300009177 Bacteria 2116
83 Ga0105237_10009497 3300009545 Bacteria 10413
84 Ga0105237_10206615 3300009545 Bacteria 1964
85 Ga0105237_10247583 3300009545 Bacteria 1784
86 Ga0105238_10068883 3300009551 Bacteria 3539
87 Ga0105238_10098579 3300009551 Bacteria 2906
88 Ga0105238_10135568 3300009551 Bacteria 2439
89 Ga0105238_10266125 3300009551 Bacteria 1694
90 Ga0105249_10054168 3300009553 Bacteria 3668
91 Ga0105249_10333063 3300009553 Bacteria 1532
92 Ga0105239_10043456 3300010375 Bacteria 4926
93 Ga0105239_10068251 3300010375 Bacteria 3907
94 Ga0105246_10088924 3300011119 Bacteria 2221
95 Ga0157373_10035688 3300013100 Bacteria 3569
96 Ga0157371_10006936 3300013102 Bacteria 9237
97 Ga0157370_10015316 3300013104 Bacteria 7800
98 Ga0157370_10022562 3300013104 Bacteria 6263
99 Ga0157369_10027508 3300013105 Bacteria 6303
100 Ga0157369_10053956 3300013105 Bacteria 4341
101 Ga0157369_10669009 3300013105 Bacteria 1070
102 Ga0157372_10020951 3300013307 Bacteria 7057
103 Ga0157372_10088697 3300013307 Bacteria 3512
104 Ga0157372_10138290 3300013307 Bacteria 2806
105 Ga0209436_100008 3300025208 Bacteria 145772
106 Ga0209436_109121 3300025208 Bacteria 1916
107 Ga0207427_104479 3300025231 Unclassified 2334
108 Ga0207425_1001212 3300025245 Bacteria 11377
109 Ga0207425_1020276 3300025245 Bacteria 1423
110 Ga0209129_1000019 3300025258 Bacteria 460802
111 Ga0209129_1000360 3300025258 Bacteria 37819
112 Ga0209233_1000473 3300025261 Bacteria 25011
113 Ga0209673_1000182 3300025273 Bacteria 127522
114 Ga0209673_1004630 3300025273 Bacteria 7280
115 Ga0209673_1005110 3300025273 Bacteria 6734
116 Ga0209130_1000019 3300025284 Bacteria 381993
117 Ga0209130_1000048 3300025284 Bacteria 233357
118 Ga0209676_1011553 3300025292 Bacteria 3550
119 Ga0209025_1000309 3300025294 Bacteria 108378
120 Ga0209025_1002274 3300025294 Bacteria 20979
121 Ga0209025_1004778 3300025294 Bacteria 11496
122 Ga0209564_1001042 3300025295 Bacteria 33942
123 Ga0209564_1001102 3300025295 Bacteria 32029
124 Ga0209564_1005411 3300025295 Bacteria 7306
125 Ga0209758_1000028 3300025297 Bacteria 530102
126 Ga0209758_1001820 3300025297 Bacteria 23538
127 Ga0209758_1003042 3300025297 Bacteria 15971
128 Ga0209050_1021306 3300025298 Bacteria 2369
129 Ga0209256_1001190 3300025299 Bacteria 29182
130 Ga0209256_1002680 3300025299 Bacteria 13956
131 Ga0209256_1002817 3300025299 Bacteria 13290
132 Ga0207426_1000005 3300025302 Bacteria 1037188
133 Ga0207426_1000136 3300025302 Bacteria 201401
134 Ga0207426_1001419 3300025302 Bacteria 20004
135 Ga0209051_1000070 3300025303 Bacteria 215616
136 Ga0209051_1025826 3300025303 Bacteria 2381
137 Ga0209051_1042996 3300025303 Bacteria 1590
138 Ga0209257_1000448 3300025304 Bacteria 77551
139 Ga0209257_1002971 3300025304 Bacteria 15490
140 Ga0209257_1032049 3300025304 Bacteria 1671
141 Ga0207656_10002383 3300025321 Bacteria 6319
142 Ga0207656_10073547 3300025321 Bacteria 1524
143 Ga0207688_10115359 3300025901 Bacteria 1563
144 Ga0207647_10040820 3300025904 Bacteria 2920
145 Ga0207645_10178041 3300025907 Bacteria 1395
146 Ga0207705_10001177 3300025909 Bacteria 21250
147 Ga0207705_10045364 3300025909 Bacteria 3159
148 Ga0207654_10068464 3300025911 Bacteria 2100
149 Ga0207654_10157512 3300025911 Bacteria 1464
150 Ga0207695_10029732 3300025913 Bacteria 6029
151 Ga0207695_10036826 3300025913 Bacteria 5285
152 Ga0207695_10063608 3300025913 Bacteria 3803
153 Ga0207671_10081432 3300025914 Bacteria 2428
154 Ga0207657_10002020 3300025919 Bacteria 21931
155 Ga0207657_10036427 3300025919 Bacteria 4403
156 Ga0207657_10071969 3300025919 Bacteria 2926
157 Ga0207657_10083837 3300025919 Bacteria 2673
158 Ga0207649_10001470 3300025920 Bacteria 13819
159 Ga0207649_10112664 3300025920 Bacteria 1820
160 Ga0207694_10029342 3300025924 Bacteria 4198
161 Ga0207690_10057374 3300025932 Bacteria 2630
162 Ga0207706_10130957 3300025933 Bacteria 2206
163 Ga0207669_10160056 3300025937 Bacteria 1589
164 Ga0207691_10042232 3300025940 Bacteria 4204
165 Ga0207667_10014483 3300025949 Bacteria 8988
166 Ga0207667_10020389 3300025949 Bacteria 7374
167 Ga0207667_10038032 3300025949 Bacteria 5142
168 Ga0207651_10416502 3300025960 Bacteria 1146
169 Ga0207668_10270900 3300025972 Bacteria 1388
170 Ga0207640_10017484 3300025981 Bacteria 4197
171 Ga0207640_10054027 3300025981 Bacteria 2624
172 Ga0207639_10006162 3300026041 Bacteria 8141
173 Ga0207639_10009494 3300026041 Bacteria 6716
174 Ga0207639_10075335 3300026041 Bacteria 2653
175 Ga0207639_10200219 3300026041 Bacteria 1712
176 Ga0207678_10075975 3300026067 Bacteria 2877
177 Ga0207702_10023728 3300026078 Bacteria 5088
178 Ga0207702_10056218 3300026078 Bacteria 3340
179 Ga0207702_10171505 3300026078 Bacteria 1990
180 Ga0207702_10733060 3300026078 Bacteria 975
181 Ga0207648_10035185 3300026089 Bacteria 4413
182 Ga0207674_10015057 3300026116 Bacteria 8518
183 Ga0207674_10021011 3300026116 Bacteria 7040
184 Ga0207698_10014168 3300026142 Bacteria 5289
185 Ga0207698_10035989 3300026142 Bacteria 3628
186 Ga0207698_10040260 3300026142 Bacteria 3470
187 Ga0268266_10306446 3300028379 Bacteria 1483
188 Ga0265332_10019072 3300031238 Bacteria 3028
189 Ga0265327_10072694 3300031251 Bacteria 1717
190 Ga0265314_10021790 3300031711 Bacteria 4920
191 Ga0307409_100466000 3300031995 Bacteria 1223
192 Ga0307414_10142084 3300032004 Bacteria 1881
193 Ga0373939_0013145 3300035114 Bacteria 2124
194 Ga0373931_0015493 3300035691 Bacteria 3741
195 Ga0373935_0280188 3300035692 Bacteria 1174
196 Ga0395900_0114894 3300037418 Bacteria 2762
197 Ga0395905_0411493 3300037471 Bacteria 1248
198 Ga0395901_0126011 3300038443 Bacteria 2691
199 Ga0395901_0598677 3300038443 Bacteria 1112
200 Ga0439465_0020514 3300041413 Bacteria 2071
201 Ga0439465_0033623 3300041413 Bacteria 1640
202 Ga0495610_0000354 3300046512 Bacteria 48077
203 Ga0495610_0126703 3300046512 Bacteria 1113
204 Ga0495620_0011211 3300046515 Bacteria 4686
205 Ga0495620_0022709 3300046515 Bacteria 3016
206 Ga0495632_0198344 3300046519 Bacteria 915
207 Ga0495643_0002546 3300046522 Bacteria 14270
208 Ga0495686_0014928 3300047472 Bacteria 5328
209 Ga0495686_0023964 3300047472 Bacteria 4014
210 Ga0496106_0000128 3300048909 Bacteria 58226
211 Ga0496106_0066838 3300048909 Bacteria 2739
212 Ga0496108_0224664 3300048911 Bacteria 1632
213 Ga0496108_0293706 3300048911 Bacteria 1415
214 Ga0496111_0014218 3300048914 Bacteria 5432
215 Ga0496119_0006256 3300048922 Bacteria 11114
216 Ga0496120_0015758 3300048923 Bacteria 4970
217 Ga0496121_0061307 3300048924 Bacteria 3087
218 Ga0496121_0075815 3300048924 Bacteria 2685
219 Ga0496121_0141755 3300048924 Bacteria 1781
220 Ga0496121_0158110 3300048924 Bacteria 1660
221 Ga0496121_0201772 3300048924 Bacteria 1417
222 Ga0496121_0278158 3300048924 Bacteria 1146
223 Ga0496122_0023669 3300048925 Bacteria 5401
224 Ga0496124_0019480 3300048927 Bacteria 6312
225 Ga0496124_0037407 3300048927 Bacteria 4221
226 Ga0496124_0113804 3300048927 Bacteria 2174
227 Ga0496124_0204881 3300048927 Bacteria 1497
228 Ga0496124_0346023 3300048927 Bacteria 1053
229 Ga0496125_0001535 3300048928 Bacteria 33104
230 Ga0496125_0052632 3300048928 Bacteria 3347
231 Ga0496126_0212338 3300048929 Bacteria 1629
232 Ga0496126_0453191 3300048929 Bacteria 1032
233 Ga0501031_0007938 3300049568 Bacteria 6910
234 Ga0501031_0042836 3300049568 Bacteria 2955
235 Ga0501031_0222793 3300049568 Bacteria 1228
236 Ga0501032_0028402 3300049569 Bacteria 3844
237 Ga0501032_0146988 3300049569 Bacteria 1551
238 Ga0501033_0016444 3300049570 Bacteria 5604
239 Ga0501033_0054785 3300049570 Bacteria 2949
240 Ga0501033_0138930 3300049570 Bacteria 1757
241 Ga0501034_0017016 3300049571 Bacteria 7454
242 Ga0501034_0034958 3300049571 Bacteria 5096
243 Ga0501034_0055797 3300049571 Bacteria 3975
244 Ga0501034_0092243 3300049571 Bacteria 3026
245 Ga0501036_0010500 3300049572 Bacteria 7650
246 Ga0501036_0077919 3300049572 Bacteria 2804
247 Ga0501037_0022967 3300049573 Bacteria 4613
248 Ga0501037_0108771 3300049573 Bacteria 1997
249 Ga0501038_0076428 3300049574 Bacteria 2828
250 Ga0501038_0243520 3300049574 Bacteria 1427
251 Ga0501039_0004669 3300049575 Bacteria 10363
252 Ga0501043_0043382 3300049579 Bacteria 3535
253 Ga0501043_0050361 3300049579 Bacteria 3273
254 Ga0501043_0061871 3300049579 Bacteria 2939
255 Ga0501043_0090899 3300049579 Bacteria 2400
256 Ga0501043_0234765 3300049579 Bacteria 1416
257 Ga0501047_0067660 3300049581 Bacteria 3441
258 Ga0501047_0163848 3300049581 Bacteria 2094
259 Ga0501047_0282886 3300049581 Bacteria 1503
260 Ga0501048_0128259 3300049582 Bacteria 1794
261 Ga0501068_0029103 3300049584 Bacteria 3270
262 Ga0501070_0012846 3300049586 Bacteria 7057
263 Ga0501070_0021980 3300049586 Bacteria 5345
264 Ga0501070_0031438 3300049586 Bacteria 4448
265 Ga0501070_0065995 3300049586 Bacteria 2997
266 Ga0501070_0195225 3300049586 Bacteria 1663
267 Ga0501071_0096754 3300049587 Bacteria 2173
268 Ga0501073_0093357 3300049589 Bacteria 2091
269 Ga0501073_0187915 3300049589 Bacteria 1429
270 Ga0501080_0092412 3300049742 Bacteria 2810
271 Ga0501080_0165204 3300049742 Bacteria 2043
272 Ga0501083_0029890 3300049744 Bacteria 3744
273 Ga0501083_0050727 3300049744 Bacteria 2791
274 Ga0501035_0006917 3300049822 Bacteria 10593
275 Ga0501035_0018516 3300049822 Bacteria 6416
276 Ga0501035_0027441 3300049822 Bacteria 5204
277 Ga0501044_0025029 3300049823 Bacteria 6329
278 Ga0501044_0035064 3300049823 Bacteria 5256
279 Ga0501044_0093184 3300049823 Bacteria 3037
280 Ga0501044_0112893 3300049823 Bacteria 2724
281 Ga0501044_0720373 3300049823 Bacteria 882
282 nmdc:mga0k408_45224_c1 3300050493 Bacteria 2540
283 nmdc:mga06z11_104744_c1 3300050494 Bacteria 1558
284 nmdc:mga06z11_16885_c1 3300050494 Bacteria 3299
285 nmdc:mga07m45_40200_c2 3300050496 Bacteria 1511
286 nmdc:mga07m45_48686_c1 3300050496 Bacteria 2384
287 nmdc:mga07m45_58675_c1 3300050496 Bacteria 2177
288 Ga0500578_0089931 3300053086 Bacteria 1949
289 Ga0500651_0008673 3300053093 Bacteria 6001
290 Ga0500595_008620 3300053119 Bacteria 4161
291 Ga0500658_0001968 3300053134 Bacteria 8032
292 Ga0500568_0001872 3300053139 Bacteria 12962
293 Ga0500577_0073713 3300053142 Bacteria 1345
294 Ga0500588_0000942 3300053146 Bacteria 5165
295 Ga0500604_0000179 3300053151 Bacteria 18176
296 Ga0500622_0000709 3300053156 Bacteria 29268
297 Ga0500634_0000014 3300053161 Bacteria 114625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003794 Ga0055531_10029440 Ga0055531_100294401 240
2 3300025298 Ga0209050_1021306 Ga0209050_10213062 240
3 3300025303 Ga0209051_1025826 Ga0209051_10258262 240
4 3300025304 Ga0209257_1000448 Ga0209257_100044866 240
5 3300049579 Ga0501043_0234765 Ga0501043_0234765_327_1217 249
6 3300049742 Ga0501080_0092412 Ga0501080_0092412_1261_2151 249
7 3300049744 Ga0501083_0029890 Ga0501083_0029890_1129_2019 249
8 3300049589 Ga0501073_0187915 Ga0501073_0187915_165_1055 250
9 3300031251 Ga0265327_10072694 Ga0265327_100726942 251
10 3300053161 Ga0500634_0000014 Ga0500634_0000014_27249_28058 253
11 3300053086 Ga0500578_0089931 Ga0500578_0089931_250_1146 254
12 3300048928 Ga0496125_0001535 Ga0496125_0001535_31274_32086 259
13 3300049574 Ga0501038_0076428 Ga0501038_0076428_1987_2766 259
14 3300049586 Ga0501070_0065995 Ga0501070_0065995_2204_2983 259
15 3300037471 Ga0395905_0411493 Ga0395905_0411493_115_906 260
16 3300005347 Ga0070668_100162640 Ga0070668_1001626402 261
17 3300005354 Ga0070675_100121690 Ga0070675_1001216902 261
18 3300005356 Ga0070674_100007681 Ga0070674_1000076813 261
19 3300005539 Ga0068853_100002929 Ga0068853_1000029296 261
20 3300005548 Ga0070665_100340865 Ga0070665_1003408651 261
21 3300011119 Ga0105246_10088924 Ga0105246_100889241 261
22 3300025297 Ga0209758_1000028 Ga0209758_100002888 261
23 3300025937 Ga0207669_10160056 Ga0207669_101600562 261
24 3300026041 Ga0207639_10009494 Ga0207639_100094942 261
25 3300028379 Ga0268266_10306446 Ga0268266_103064462 261
26 3300049579 Ga0501043_0043382 Ga0501043_0043382_1872_2747 261
27 3300049586 Ga0501070_0031438 Ga0501070_0031438_202_1077 261
28 3300049742 Ga0501080_0165204 Ga0501080_0165204_1002_1877 261
29 3300049822 Ga0501035_0006917 Ga0501035_0006917_4225_5100 261
30 3300049823 Ga0501044_0025029 Ga0501044_0025029_4818_5693 261
31 3300053119 Ga0500595_008620 Ga0500595_008620_2624_3520 262
32 3300049568 Ga0501031_0222793 Ga0501031_0222793_233_1078 264
33 3300049574 Ga0501038_0243520 Ga0501038_0243520_259_1104 264
34 3300049586 Ga0501070_0021980 Ga0501070_0021980_4137_4982 264
35 3300049823 Ga0501044_0035064 Ga0501044_0035064_1447_2292 264
36 3300049823 Ga0501044_0720373 Ga0501044_0720373_21_860 264
37 3300005563 Ga0068855_100146427 Ga0068855_1001464274 266
38 3300025909 Ga0207705_10001177 Ga0207705_100011778 266
39 3300025919 Ga0207657_10002020 Ga0207657_1000202021 266
40 3300026067 Ga0207678_10075975 Ga0207678_100759753 266
41 3300032004 Ga0307414_10142084 Ga0307414_101420842 266
42 3300041413 Ga0439465_0020514 Ga0439465_0020514_83_886 267
43 3300046519 Ga0495632_0198344 Ga0495632_0198344_36_839 267
44 3300049569 Ga0501032_0028402 Ga0501032_0028402_1637_2524 267
45 3300048924 Ga0496121_0201772 Ga0496121_0201772_458_1336 268
46 3300005327 Ga0070658_10015959 Ga0070658_100159595 270
47 3300005539 Ga0068853_100014249 Ga0068853_1000142494 270
48 3300005563 Ga0068855_100391455 Ga0068855_1003914552 270
49 3300005614 Ga0068856_100006424 Ga0068856_1000064249 270
50 3300005616 Ga0068852_100035188 Ga0068852_1000351882 270
51 3300009551 Ga0105238_10068883 Ga0105238_100688833 270
52 3300013104 Ga0157370_10022562 Ga0157370_100225625 270
53 3300013105 Ga0157369_10053956 Ga0157369_100539564 270
54 3300013307 Ga0157372_10088697 Ga0157372_100886973 270
55 3300025913 Ga0207695_10029732 Ga0207695_100297324 270
56 3300025919 Ga0207657_10071969 Ga0207657_100719693 270
57 3300025920 Ga0207649_10112664 Ga0207649_101126642 270
58 3300025932 Ga0207690_10057374 Ga0207690_100573743 270
59 3300025949 Ga0207667_10014483 Ga0207667_100144833 270
60 3300050494 nmdc:mga06z11_16885_c1 nmdc:mga06z11_16885_c1_20_832 270
61 iso_pu_bacteria 2996887358 2996887868 270
62 iso_pu_bacteria 8005321885 8005322395 270
63 3300003215 JGI25153J46596_10000066 JGI25153J46596_1000006642 271
64 3300002987 JGI25159J45721_1000617 JGI25159J45721_100061711 272
65 3300003354 JGI25160J50197_1000023 JGI25160J50197_100002362 272
66 3300003374 JGI25161J50226_1000012 JGI25161J50226_100001262 272
67 3300004625 Ga0055543_1000009 Ga0055543_100000962 272
68 3300005262 Ga0065165_1000064 Ga0065165_1000064136 272
69 3300025208 Ga0209436_109121 Ga0209436_1091212 272
70 3300025284 Ga0209130_1000048 Ga0209130_1000048136 272
71 3300025302 Ga0207426_1000136 Ga0207426_1000136136 272
72 3300035692 Ga0373935_0280188 Ga0373935_0280188_134_1051 272
73 3300048928 Ga0496125_0052632 Ga0496125_0052632_33_932 272
74 3300009545 Ga0105237_10206615 Ga0105237_102066152 273
75 3300053151 Ga0500604_0000179 Ga0500604_0000179_1197_2075 273
76 3300053093 Ga0500651_0008673 Ga0500651_0008673_953_1849 275
77 3300053142 Ga0500577_0073713 Ga0500577_0073713_19_915 275
78 3300009545 Ga0105237_10247583 Ga0105237_102475832 276
79 3300048927 Ga0496124_0204881 Ga0496124_0204881_219_1097 277
80 3300013105 Ga0157369_10027508 Ga0157369_100275084 278
81 3300031995 Ga0307409_100466000 Ga0307409_1004660002 278
82 3300003323 rootH1_10030555 rootH1_100305555 280
83 3300048927 Ga0496124_0113804 Ga0496124_0113804_1165_2043 280
84 3300050496 nmdc:mga07m45_58675_c1 nmdc:mga07m45_58675_c1_190_1065 280
85 3300005455 Ga0070663_100101156 Ga0070663_1001011562 281
86 3300009551 Ga0105238_10135568 Ga0105238_101355682 281
87 3300041413 Ga0439465_0033623 Ga0439465_0033623_398_1264 281
88 3300048929 Ga0496126_0453191 Ga0496126_0453191_18_893 282
89 3300006051 Ga0075364_10067045 Ga0075364_100670453 285
90 3300006177 Ga0075362_10093452 Ga0075362_100934522 285
91 3300006178 Ga0075367_10149235 Ga0075367_101492352 285
92 3300006195 Ga0075366_10019116 Ga0075366_100191162 285
93 3300006353 Ga0075370_10112220 Ga0075370_101122202 285
94 3300050493 nmdc:mga0k408_45224_c1 nmdc:mga0k408_45224_c1_1218_2096 285
95 3300050494 nmdc:mga06z11_104744_c1 nmdc:mga06z11_104744_c1_165_1043 285
96 3300050496 nmdc:mga07m45_48686_c1 nmdc:mga07m45_48686_c1_1242_2120 285
97 iso_pu_bacteria 8057575449 8057578856 285
98 3300003771 Ga0055526_1020414 Ga0055526_10204142 286
99 3300003775 Ga0055524_1014733 Ga0055524_10147332 286
100 3300025273 Ga0209673_1005110 Ga0209673_10051106 286
101 3300025295 Ga0209564_1001102 Ga0209564_100110222 286
102 3300025299 Ga0209256_1002680 Ga0209256_10026805 286
103 iso_pu_bacteria 2643221591 2643966130 287
104 iso_pu_bacteria 2643221629 2644166526 287
105 iso_pu_bacteria 2643221662 2644347901 287
106 iso_pu_bacteria 2643221580 2643910166 288
107 iso_pu_bacteria 2643221674 2644410923 288
108 3300003214 JGI25165J46597_1006201 JGI25165J46597_10062012 289
109 3300025231 Ga0207427_104479 Ga0207427_1044792 289
110 3300025261 Ga0209233_1000473 Ga0209233_100047313 289
111 3300053146 Ga0500588_0000942 Ga0500588_0000942_265_1167 289
112 iso_pu_bacteria 8005658619 8005660314 290
113 iso_pu_bacteria 8018150411 8018152981 290
114 3300003320 rootH2_10025492 rootH2_100254922 291
115 3300003354 JGI25160J50197_1032569 JGI25160J50197_10325691 291
116 3300009177 Ga0105248_10224134 Ga0105248_102241342 291
117 3300009553 Ga0105249_10333063 Ga0105249_103330631 291
118 3300038443 Ga0395901_0598677 Ga0395901_0598677_111_992 291
119 3300046515 Ga0495620_0011211 Ga0495620_0011211_1742_2620 291
120 3300047472 Ga0495686_0023964 Ga0495686_0023964_1065_1943 291
121 3300048911 Ga0496108_0224664 Ga0496108_0224664_173_1051 291
122 3300048914 Ga0496111_0014218 Ga0496111_0014218_2951_3829 291
123 3300048922 Ga0496119_0006256 Ga0496119_0006256_3990_4868 291
124 3300048923 Ga0496120_0015758 Ga0496120_0015758_1484_2362 291
125 3300048924 Ga0496121_0075815 Ga0496121_0075815_318_1193 291
126 3300048925 Ga0496122_0023669 Ga0496122_0023669_668_1546 291
127 3300048927 Ga0496124_0019480 Ga0496124_0019480_5327_6205 291
128 3300048929 Ga0496126_0212338 Ga0496126_0212338_104_982 291
129 3300049568 Ga0501031_0042836 Ga0501031_0042836_348_1226 291
130 3300049569 Ga0501032_0146988 Ga0501032_0146988_85_963 291
131 3300049570 Ga0501033_0054785 Ga0501033_0054785_1982_2860 291
132 3300049570 Ga0501033_0138930 Ga0501033_0138930_739_1614 291
133 3300049571 Ga0501034_0034958 Ga0501034_0034958_2875_3753 291
134 3300049572 Ga0501036_0077919 Ga0501036_0077919_669_1547 291
135 3300049573 Ga0501037_0022967 Ga0501037_0022967_1229_2107 291
136 3300049579 Ga0501043_0061871 Ga0501043_0061871_1342_2220 291
137 3300049581 Ga0501047_0163848 Ga0501047_0163848_1131_2009 291
138 3300049586 Ga0501070_0012846 Ga0501070_0012846_4181_5059 291
139 3300049822 Ga0501035_0018516 Ga0501035_0018516_1332_2210 291
140 3300049823 Ga0501044_0093184 Ga0501044_0093184_1972_2850 291
141 iso_pu_bacteria 2513237088 2513595887 291
142 iso_pu_bacteria 2582581298 2585227326 291
143 iso_pu_bacteria 2585427529 2585550740 291
144 iso_pu_bacteria 2791355267 2793368498 291
145 iso_pu_bacteria 8056375014 8056376348 291
146 3300005337 Ga0070682_100015618 Ga0070682_1000156185 292
147 3300005344 Ga0070661_100000896 Ga0070661_1000008964 292
148 3300005535 Ga0070684_100300401 Ga0070684_1003004012 292
149 3300005539 Ga0068853_100005068 Ga0068853_1000050689 292
150 3300005577 Ga0068857_100047495 Ga0068857_1000474953 292
151 3300005578 Ga0068854_100078409 Ga0068854_1000784092 292
152 3300005614 Ga0068856_100067043 Ga0068856_1000670433 292
153 3300005614 Ga0068856_100152104 Ga0068856_1001521042 292
154 3300005616 Ga0068852_100161203 Ga0068852_1001612032 292
155 3300005834 Ga0068851_10002793 Ga0068851_100027937 292
156 3300009093 Ga0105240_10090090 Ga0105240_100900902 292
157 3300009093 Ga0105240_10669638 Ga0105240_106696382 292
158 3300009174 Ga0105241_10409996 Ga0105241_104099962 292
159 3300009545 Ga0105237_10009497 Ga0105237_100094976 292
160 3300009551 Ga0105238_10098579 Ga0105238_100985792 292
161 3300009551 Ga0105238_10266125 Ga0105238_102661251 292
162 3300010375 Ga0105239_10068251 Ga0105239_100682514 292
163 3300025321 Ga0207656_10002383 Ga0207656_100023833 292
164 3300025911 Ga0207654_10068464 Ga0207654_100684642 292
165 3300025913 Ga0207695_10036826 Ga0207695_100368262 292
166 3300025913 Ga0207695_10063608 Ga0207695_100636082 292
167 3300025914 Ga0207671_10081432 Ga0207671_100814322 292
168 3300025919 Ga0207657_10083837 Ga0207657_100838373 292
169 3300025920 Ga0207649_10001470 Ga0207649_100014706 292
170 3300025924 Ga0207694_10029342 Ga0207694_100293422 292
171 3300025949 Ga0207667_10020389 Ga0207667_100203893 292
172 3300025981 Ga0207640_10017484 Ga0207640_100174845 292
173 3300026041 Ga0207639_10006162 Ga0207639_100061625 292
174 3300026078 Ga0207702_10171505 Ga0207702_101715052 292
175 3300026078 Ga0207702_10733060 Ga0207702_107330601 292
176 3300026116 Ga0207674_10015057 Ga0207674_100150577 292
177 3300026142 Ga0207698_10014168 Ga0207698_100141686 292
178 3300046512 Ga0495610_0000354 Ga0495610_0000354_33145_34026 292
179 3300046515 Ga0495620_0022709 Ga0495620_0022709_1558_2439 292
180 3300047472 Ga0495686_0014928 Ga0495686_0014928_2552_3433 292
181 3300049568 Ga0501031_0007938 Ga0501031_0007938_1546_2427 292
182 3300049570 Ga0501033_0016444 Ga0501033_0016444_1170_2051 292
183 3300049571 Ga0501034_0017016 Ga0501034_0017016_2177_3058 292
184 3300049572 Ga0501036_0010500 Ga0501036_0010500_2522_3403 292
185 3300049573 Ga0501037_0108771 Ga0501037_0108771_186_1067 292
186 3300049575 Ga0501039_0004669 Ga0501039_0004669_4567_5448 292
187 3300049579 Ga0501043_0050361 Ga0501043_0050361_1739_2620 292
188 3300049581 Ga0501047_0067660 Ga0501047_0067660_1779_2660 292
189 3300049582 Ga0501048_0128259 Ga0501048_0128259_471_1352 292
190 3300049587 Ga0501071_0096754 Ga0501071_0096754_174_1055 292
191 3300049822 Ga0501035_0027441 Ga0501035_0027441_1290_2171 292
192 3300049823 Ga0501044_0112893 Ga0501044_0112893_1405_2286 292
193 iso_pu_bacteria 2513237144 2513910062 292
194 iso_pu_bacteria 8005289223 8005290120 292
195 3300005327 Ga0070658_10017551 Ga0070658_100175514 293
196 3300005339 Ga0070660_100095846 Ga0070660_1000958462 293
197 3300005364 Ga0070673_100190882 Ga0070673_1001908822 293
198 3300005366 Ga0070659_100069769 Ga0070659_1000697693 293
199 3300005457 Ga0070662_100168237 Ga0070662_1001682372 293
200 3300005459 Ga0068867_100036354 Ga0068867_1000363544 293
201 3300005535 Ga0070684_100403708 Ga0070684_1004037082 293
202 3300005539 Ga0068853_100019152 Ga0068853_1000191523 293
203 3300005539 Ga0068853_100176138 Ga0068853_1001761382 293
204 3300005563 Ga0068855_100127668 Ga0068855_1001276683 293
205 3300005564 Ga0070664_100422786 Ga0070664_1004227862 293
206 3300005577 Ga0068857_100032633 Ga0068857_1000326333 293
207 3300005578 Ga0068854_100083166 Ga0068854_1000831662 293
208 3300005614 Ga0068856_100046683 Ga0068856_1000466833 293
209 3300005614 Ga0068856_100095719 Ga0068856_1000957193 293
210 3300005834 Ga0068851_10049753 Ga0068851_100497532 293
211 3300006358 Ga0068871_100184822 Ga0068871_1001848222 293
212 3300009174 Ga0105241_10010453 Ga0105241_100104536 293
213 3300009174 Ga0105241_10025156 Ga0105241_100251563 293
214 3300010375 Ga0105239_10043456 Ga0105239_100434564 293
215 3300013100 Ga0157373_10035688 Ga0157373_100356883 293
216 3300013102 Ga0157371_10006936 Ga0157371_100069365 293
217 3300013104 Ga0157370_10015316 Ga0157370_100153165 293
218 3300013105 Ga0157369_10669009 Ga0157369_106690092 293
219 3300013307 Ga0157372_10020951 Ga0157372_100209513 293
220 3300013307 Ga0157372_10138290 Ga0157372_101382902 293
221 3300025321 Ga0207656_10073547 Ga0207656_100735472 293
222 3300025901 Ga0207688_10115359 Ga0207688_101153592 293
223 3300025904 Ga0207647_10040820 Ga0207647_100408202 293
224 3300025907 Ga0207645_10178041 Ga0207645_101780412 293
225 3300025909 Ga0207705_10045364 Ga0207705_100453643 293
226 3300025911 Ga0207654_10157512 Ga0207654_101575122 293
227 3300025919 Ga0207657_10036427 Ga0207657_100364274 293
228 3300025933 Ga0207706_10130957 Ga0207706_101309572 293
229 3300025940 Ga0207691_10042232 Ga0207691_100422323 293
230 3300025949 Ga0207667_10038032 Ga0207667_100380323 293
231 3300025960 Ga0207651_10416502 Ga0207651_104165022 293
232 3300025981 Ga0207640_10054027 Ga0207640_100540273 293
233 3300026041 Ga0207639_10075335 Ga0207639_100753352 293
234 3300026041 Ga0207639_10200219 Ga0207639_102002192 293
235 3300026078 Ga0207702_10023728 Ga0207702_100237283 293
236 3300026078 Ga0207702_10056218 Ga0207702_100562182 293
237 3300026089 Ga0207648_10035185 Ga0207648_100351852 293
238 3300026116 Ga0207674_10021011 Ga0207674_100210114 293
239 3300026142 Ga0207698_10035989 Ga0207698_100359892 293
240 3300026142 Ga0207698_10040260 Ga0207698_100402603 293
241 3300031238 Ga0265332_10019072 Ga0265332_100190722 293
242 3300031711 Ga0265314_10021790 Ga0265314_100217903 293
243 3300035114 Ga0373939_0013145 Ga0373939_0013145_213_1100 293
244 3300035691 Ga0373931_0015493 Ga0373931_0015493_1348_2235 293
245 3300037418 Ga0395900_0114894 Ga0395900_0114894_1854_2738 293
246 3300038443 Ga0395901_0126011 Ga0395901_0126011_438_1322 293
247 3300048911 Ga0496108_0293706 Ga0496108_0293706_489_1376 293
248 3300049571 Ga0501034_0055797 Ga0501034_0055797_2481_3422 293
249 3300049571 Ga0501034_0092243 Ga0501034_0092243_1597_2481 293
250 3300049589 Ga0501073_0093357 Ga0501073_0093357_475_1356 293
251 3300049586 Ga0501070_0195225 Ga0501070_0195225_122_1036 294
252 3300002773 JGI25152J39213_1003678 JGI25152J39213_10036783 295
253 3300002774 JGI25150J39212_1006640 JGI25150J39212_10066401 295
254 3300002987 JGI25159J45721_1000494 JGI25159J45721_10004947 295
255 3300003374 JGI25161J50226_1000603 JGI25161J50226_10006033 295
256 3300003771 Ga0055526_1004682 Ga0055526_10046825 295
257 3300003775 Ga0055524_1002195 Ga0055524_10021959 295
258 3300003792 Ga0055540_1000661 Ga0055540_10006617 295
259 3300004625 Ga0055543_1000056 Ga0055543_100005689 295
260 3300005344 Ga0070661_100241955 Ga0070661_1002419552 295
261 3300005347 Ga0070668_100205462 Ga0070668_1002054622 295
262 3300005355 Ga0070671_100100789 Ga0070671_1001007893 295
263 3300006038 Ga0075365_10225281 Ga0075365_102252812 295
264 3300006178 Ga0075367_10006595 Ga0075367_100065955 295
265 3300009553 Ga0105249_10054168 Ga0105249_100541682 295
266 3300025208 Ga0209436_100008 Ga0209436_100008127 295
267 3300025245 Ga0207425_1001212 Ga0207425_10012124 295
268 3300025245 Ga0207425_1020276 Ga0207425_10202762 295
269 3300025258 Ga0209129_1000360 Ga0209129_100036012 295
270 3300025273 Ga0209673_1004630 Ga0209673_10046305 295
271 3300025284 Ga0209130_1000019 Ga0209130_100001991 295
272 3300025294 Ga0209025_1002274 Ga0209025_10022746 295
273 3300025295 Ga0209564_1001042 Ga0209564_100104213 295
274 3300025297 Ga0209758_1001820 Ga0209758_10018202 295
275 3300025297 Ga0209758_1003042 Ga0209758_100304211 295
276 3300025299 Ga0209256_1002817 Ga0209256_10028178 295
277 3300025302 Ga0207426_1000005 Ga0207426_1000005516 295
278 3300025302 Ga0207426_1001419 Ga0207426_100141915 295
279 3300025303 Ga0209051_1000070 Ga0209051_10000708 295
280 3300025303 Ga0209051_1042996 Ga0209051_10429962 295
281 3300025304 Ga0209257_1002971 Ga0209257_10029719 295
282 3300025972 Ga0207668_10270900 Ga0207668_102709001 295
283 3300046512 Ga0495610_0126703 Ga0495610_0126703_124_1014 295
284 3300046522 Ga0495643_0002546 Ga0495643_0002546_12673_13563 295
285 3300048909 Ga0496106_0000128 Ga0496106_0000128_41650_42540 295
286 3300048924 Ga0496121_0061307 Ga0496121_0061307_1737_2627 295
287 3300048927 Ga0496124_0037407 Ga0496124_0037407_2039_2929 295
288 3300049579 Ga0501043_0090899 Ga0501043_0090899_1026_1916 295
289 3300049581 Ga0501047_0282886 Ga0501047_0282886_212_1102 295
290 3300049584 Ga0501068_0029103 Ga0501068_0029103_1763_2653 295
291 3300049744 Ga0501083_0050727 Ga0501083_0050727_1357_2247 295
292 3300050496 nmdc:mga07m45_40200_c2 nmdc:mga07m45_40200_c2_286_1176 295
293 3300053134 Ga0500658_0001968 Ga0500658_0001968_2088_2978 295
294 3300053139 Ga0500568_0001872 Ga0500568_0001872_1434_2324 295
295 3300053156 Ga0500622_0000709 Ga0500622_0000709_19111_20001 295
296 3300002773 JGI25152J39213_1001890 JGI25152J39213_10018905 296
297 3300003187 JGI25151J46595_10003710 JGI25151J46595_100037107 296
298 3300003187 JGI25151J46595_10047659 JGI25151J46595_100476592 296
299 3300003775 Ga0055524_1003632 Ga0055524_10036324 296
300 3300003790 Ga0055528_1001688 Ga0055528_10016887 296
301 3300009036 Ga0105244_10178519 Ga0105244_101785191 296
302 3300025258 Ga0209129_1000019 Ga0209129_1000019326 296
303 3300025273 Ga0209673_1000182 Ga0209673_100018293 296
304 3300025292 Ga0209676_1011553 Ga0209676_10115533 296
305 3300025294 Ga0209025_1000309 Ga0209025_100030979 296
306 3300025294 Ga0209025_1004778 Ga0209025_10047783 296
307 3300025295 Ga0209564_1005411 Ga0209564_10054113 296
308 3300025299 Ga0209256_1001190 Ga0209256_100119021 296
309 3300025304 Ga0209257_1032049 Ga0209257_10320492 296
310 3300048909 Ga0496106_0066838 Ga0496106_0066838_1271_2161 296
311 3300048924 Ga0496121_0141755 Ga0496121_0141755_377_1267 296
312 3300048924 Ga0496121_0158110 Ga0496121_0158110_584_1474 296
313 3300048924 Ga0496121_0278158 Ga0496121_0278158_21_911 296
314 3300048927 Ga0496124_0346023 Ga0496124_0346023_105_998 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

117

312

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7488 19 286
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7319 19 289
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.7278 19 288
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.7252 21 285
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7161 19 289
ID Description Score Start End Superfamily
af_P0AEB0_20_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7805 25 290 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7782 60 289 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7761 60 290 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7741 18 284 1.10.3720.10
af_P0AEB0_20_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7695 25 290 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4V1V140-F1-model_v4 Spermidine/putrescine ABC transporter permease 0.8824 11 189 GO:0005886
GO:0055085
AF-A0A4V1V140-F1-model_v4 Spermidine/putrescine ABC transporter permease 0.8558 11 189 GO:0005886
GO:0055085
AF-A0A178H2Y8-F1-model_v4 deleted 0.8416 16 293
AF-A0A087M5R5-F1-model_v4 Spermidine/putrescine ABC transporter permease 0.8415 16 292 GO:0005886
GO:0055085
AF-A0A024KF08-F1-model_v4 deleted 0.8375 23 296

Feature Viewer

pLDDT pTM Quality
72.29 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map