F402661

General Info

Members Datasets Scaffolds Average Seq Length
314 212 628 133

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10009491|Ga0114129_1000949110
Length 144
Sequence MWALVPAGRKETAMTQLPHVFKRIRLDLARSKEFPTGSTRHGYEFVAPLDARGHIDPELWAKHRDHCRVRRFWGGEEEIGRLVHKPGGPEHARWIFDYDETAEEDDEAGYRFGAHAFRPGEYVSIRDEEGEMHTFKVVSVEPAT

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
128 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 2.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 9.24
Rhizosphere 89.17
Stem 0
Stem Tuber 0
Unclassified 15.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10009491 3300009147 Bacteria 13873
2 JGI25406J46586_10004094 3300003203 Bacteria 6816
3 JGI25406J46586_10121891 3300003203 Bacteria 767
4 rootH1_10063918 3300003323 Bacteria 1061
5 Ga0058862_11449583 3300004803 Unclassified 519
6 Ga0065704_10234693 3300005289 Bacteria 998
7 Ga0065704_10322861 3300005289 Bacteria 850
8 Ga0065715_10491686 3300005293 Unclassified 787
9 Ga0065715_10534999 3300005293 Bacteria 752
10 Ga0065707_10627768 3300005295 Unclassified 675
11 Ga0070658_10048180 3300005327 Bacteria 3449
12 Ga0070658_10052834 3300005327 Bacteria 3296
13 Ga0070683_100562316 3300005329 Bacteria 1091
14 Ga0070670_100499066 3300005331 Bacteria 1082
15 Ga0070677_10078002 3300005333 Unclassified 1410
16 Ga0068869_100665342 3300005334 Bacteria 885
17 Ga0070666_10477527 3300005335 Bacteria 902
18 Ga0070660_100038042 3300005339 Bacteria 3650
19 Ga0070689_100309418 3300005340 Bacteria 1317
20 Ga0070687_100112340 3300005343 Bacteria 1544
21 Ga0070661_100412433 3300005344 Bacteria 1069
22 Ga0070669_100638177 3300005353 Bacteria 895
23 Ga0070675_100005321 3300005354 Bacteria 9834
24 Ga0070671_100074373 3300005355 Bacteria 2839
25 Ga0070674_100009396 3300005356 Bacteria 5854
26 Ga0070673_100132322 3300005364 Bacteria 2095
27 Ga0070688_100953252 3300005365 Bacteria 679
28 Ga0070667_101286219 3300005367 Bacteria 685
29 Ga0070709_10171028 3300005434 Bacteria 1518
30 Ga0070714_100230486 3300005435 Bacteria 1706
31 Ga0070714_100360099 3300005435 Bacteria 1367
32 Ga0070713_100307414 3300005436 Bacteria 1461
33 Ga0070713_101086696 3300005436 Unclassified 773
34 Ga0070711_100489314 3300005439 Bacteria 1012
35 Ga0070711_101323393 3300005439 Bacteria 625
36 Ga0070711_101442274 3300005439 Bacteria 600
37 Ga0070708_100634490 3300005445 Bacteria 1007
38 Ga0070662_100383445 3300005457 Bacteria 1157
39 Ga0070681_10789468 3300005458 Bacteria 866
40 Ga0070681_11059444 3300005458 Unclassified 731
41 Ga0070679_100166349 3300005530 Bacteria 2179
42 Ga0070679_100232051 3300005530 Bacteria 1804
43 Ga0070679_100757399 3300005530 Bacteria 914
44 Ga0070684_100666277 3300005535 Bacteria 969
45 Ga0070672_100025625 3300005543 Bacteria 4377
46 Ga0068855_100139767 3300005563 Bacteria 2762
47 Ga0068855_101118610 3300005563 Bacteria 822
48 Ga0068857_100031654 3300005577 Bacteria 4675
49 Ga0068854_100196624 3300005578 Bacteria 1583
50 Ga0068856_100118146 3300005614 Bacteria 2652
51 Ga0068856_100360791 3300005614 Bacteria 1472
52 Ga0068856_100375321 3300005614 Bacteria 1441
53 Ga0068856_100856958 3300005614 Unclassified 928
54 Ga0070702_100578616 3300005615 Unclassified 838
55 Ga0068852_100077735 3300005616 Bacteria 2934
56 Ga0068852_100144569 3300005616 Bacteria 2204
57 Ga0068852_101643426 3300005616 Unclassified 665
58 Ga0068859_100017187 3300005617 Bacteria 7263
59 Ga0068864_100052846 3300005618 Bacteria 3503
60 Ga0081455_10003574 3300005937 Bacteria 17845
61 Ga0081455_10220525 3300005937 Unclassified 1406
62 Ga0081540_1000128 3300005983 Bacteria 80512
63 Ga0081539_10002027 3300005985 Bacteria 30522
64 Ga0081539_10045635 3300005985 Bacteria 2518
65 Ga0081539_10075336 3300005985 Bacteria 1793
66 Ga0070717_10480024 3300006028 Bacteria 1122
67 Ga0070717_10542499 3300006028 Bacteria 1053
68 Ga0070717_10659967 3300006028 Unclassified 949
69 Ga0075367_10682340 3300006178 Bacteria 653
70 Ga0075366_10061302 3300006195 Bacteria 2236
71 Ga0068871_102236234 3300006358 Bacteria 521
72 Ga0075428_100037545 3300006844 Bacteria 5333
73 Ga0075428_100897585 3300006844 Bacteria 940
74 Ga0075428_101752847 3300006844 Bacteria 647
75 Ga0075430_100122505 3300006846 Bacteria 2168
76 Ga0075430_100347177 3300006846 Bacteria 1226
77 Ga0075431_101321326 3300006847 Bacteria 682
78 Ga0075434_101107552 3300006871 Bacteria 805
79 Ga0097620_100017188 3300006931 Bacteria 7263
80 Ga0075435_100052113 3300007076 Bacteria 3298
81 Ga0075435_101474394 3300007076 Bacteria 596
82 Ga0105240_10404031 3300009093 Bacteria 1538
83 Ga0111539_10061993 3300009094 Bacteria 4428
84 Ga0111539_11267080 3300009094 Bacteria 856
85 Ga0105245_10387169 3300009098 Bacteria 1394
86 Ga0105247_10103534 3300009101 Bacteria 1823
87 Ga0114129_10113759 3300009147 Bacteria 3731
88 Ga0105243_10276434 3300009148 Bacteria 1511
89 Ga0105243_10993335 3300009148 Unclassified 841
90 Ga0105241_10548907 3300009174 Bacteria 1037
91 Ga0105242_10227173 3300009176 Bacteria 1671
92 Ga0105238_10149522 3300009551 Bacteria 2311
93 Ga0105238_10952299 3300009551 Unclassified 878
94 Ga0157371_10156142 3300013102 Bacteria 1628
95 Ga0157370_10315970 3300013104 Bacteria 1441
96 Ga0157370_10332982 3300013104 Bacteria 1399
97 Ga0157370_11351719 3300013104 Bacteria 641
98 Ga0157369_10752317 3300013105 Bacteria 1003
99 Ga0157369_10829782 3300013105 Bacteria 949
100 Ga0157374_11883870 3300013296 Bacteria 624
101 Ga0163162_12222710 3300013306 Unclassified 630
102 Ga0157372_12275847 3300013307 Bacteria 622
103 Ga0157375_10856511 3300013308 Bacteria 1055
104 Ga0163163_10001825 3300014325 Bacteria 17971
105 Ga0157380_10185093 3300014326 Bacteria 1833
106 Ga0157380_12007412 3300014326 Unclassified 640
107 Ga0157376_10446933 3300014969 Bacteria 1260
108 Ga0157376_12251870 3300014969 Bacteria 584
109 Ga0163161_10658866 3300017792 Bacteria 868
110 Ga0206356_10547741 3300020070 Bacteria 5404
111 Ga0206349_1894443 3300020075 Unclassified 564
112 Ga0206350_11579858 3300020080 Unclassified 647
113 Ga0206354_10084215 3300020081 Bacteria 1662
114 Ga0206353_10670992 3300020082 Bacteria 5078
115 Ga0224712_10385985 3300022467 Unclassified 666
116 Ga0207682_10043682 3300025893 Unclassified 1835
117 Ga0207688_10135724 3300025901 Bacteria 1445
118 Ga0207645_10441264 3300025907 Bacteria 878
119 Ga0207707_10098316 3300025912 Bacteria 2558
120 Ga0207707_10186445 3300025912 Bacteria 1810
121 Ga0207695_10150027 3300025913 Bacteria 2271
122 Ga0207660_10010654 3300025917 Bacteria 5975
123 Ga0207660_10633926 3300025917 Bacteria 871
124 Ga0207662_10301091 3300025918 Bacteria 1066
125 Ga0207657_10077672 3300025919 Bacteria 2797
126 Ga0207657_11251952 3300025919 Unclassified 562
127 Ga0207649_10823598 3300025920 Bacteria 725
128 Ga0207652_10728995 3300025921 Bacteria 883
129 Ga0207687_11243164 3300025927 Unclassified 640
130 Ga0207664_10048802 3300025929 Bacteria 3331
131 Ga0207664_10474098 3300025929 Bacteria 1119
132 Ga0207644_10044025 3300025931 Unclassified 3170
133 Ga0207690_10292203 3300025932 Bacteria 1273
134 Ga0207709_11050967 3300025935 Unclassified 667
135 Ga0207669_10114927 3300025937 Unclassified 1813
136 Ga0207669_11134717 3300025937 Bacteria 661
137 Ga0207704_10707436 3300025938 Bacteria 835
138 Ga0207665_11114928 3300025939 Bacteria 629
139 Ga0207691_10641274 3300025940 Bacteria 898
140 Ga0207661_10187187 3300025944 Bacteria 1813
141 Ga0207667_10172054 3300025949 Bacteria 2226
142 Ga0207667_10213012 3300025949 Bacteria 1980
143 Ga0207667_10481944 3300025949 Bacteria 1259
144 Ga0207651_11721665 3300025960 Bacteria 564
145 Ga0207651_11747298 3300025960 Unclassified 560
146 Ga0207640_10246988 3300025981 Bacteria 1382
147 Ga0207658_10273028 3300025986 Bacteria 1446
148 Ga0207702_10386343 3300026078 Bacteria 1347
149 Ga0207702_11676016 3300026078 Unclassified 629
150 Ga0207676_10035694 3300026095 Bacteria 3776
151 Ga0207674_10049608 3300026116 Bacteria 4292
152 Ga0207675_100449586 3300026118 Bacteria 1276
153 Ga0207698_10064247 3300026142 Bacteria 2876
154 Ga0207698_11049925 3300026142 Bacteria 826
155 Ga0265334_10130359 3300028573 Bacteria 895
156 Ga0265336_10082041 3300028666 Bacteria 962
157 Ga0265338_10350539 3300028800 Bacteria 1062
158 Ga0265338_10361457 3300028800 Bacteria 1041
159 Ga0265330_10045758 3300031235 Bacteria 1929
160 Ga0265330_10059813 3300031235 Bacteria 1659
161 Ga0265332_10010257 3300031238 Bacteria 4170
162 Ga0265325_10000062 3300031241 Bacteria 74697
163 Ga0265325_10012499 3300031241 Bacteria 4854
164 Ga0265325_10033302 3300031241 Bacteria 2747
165 Ga0265325_10064689 3300031241 Bacteria 1849
166 Ga0265329_10058249 3300031242 Unclassified 1224
167 Ga0265340_10033751 3300031247 Bacteria 2546
168 Ga0265340_10054747 3300031247 Bacteria 1923
169 Ga0265339_10012544 3300031249 Bacteria 5171
170 Ga0265339_10027211 3300031249 Bacteria 3266
171 Ga0265331_10018070 3300031250 Bacteria 3664
172 Ga0265331_10169443 3300031250 Unclassified 988
173 Ga0265316_10258601 3300031344 Bacteria 1277
174 Ga0265313_10007771 3300031595 Bacteria 7250
175 Ga0265313_10023883 3300031595 Bacteria 3283
176 Ga0265313_10181022 3300031595 Bacteria 886
177 Ga0265313_10184889 3300031595 Bacteria 874
178 Ga0265314_10058255 3300031711 Bacteria 2648
179 Ga0265314_10076394 3300031711 Bacteria 2225
180 Ga0265314_10142695 3300031711 Bacteria 1478
181 Ga0265342_10000109 3300031712 Bacteria 91321
182 Ga0265342_10000348 3300031712 Bacteria 51971
183 Ga0265342_10083391 3300031712 Bacteria 1842
184 Ga0373934_0084945 3300035086 Bacteria 1273
185 Ga0373923_0060599 3300035111 Bacteria 1607
186 Ga0373923_0229796 3300035111 Unclassified 864
187 Ga0373954_0114135 3300035118 Bacteria 1308
188 Ga0373956_0029309 3300035119 Bacteria 2399
189 Ga0373957_0004866 3300035120 Bacteria 4120
190 Ga0373960_0138239 3300035121 Bacteria 823
191 Ga0373955_0008165 3300035172 Bacteria 4846
192 Ga0373924_0230701 3300035410 Bacteria 818
193 Ga0373935_1061204 3300035692 Bacteria 602
194 Ga0373933_0002255 3300035724 Bacteria 10997
195 Ga0373933_0863821 3300035724 Bacteria 596
196 Ga0373937_0005513 3300036401 Bacteria 10849
197 Ga0373937_0032176 3300036401 Bacteria 4757
198 Ga0436364_0488213 3300037853 Bacteria 1968
199 Ga0436364_0996012 3300037853 Bacteria 3741
200 Ga0439446_0015957 3300042156 Bacteria 2089
201 Ga0439440_0126709 3300042993 Bacteria 715
202 Ga0466961_0163067 3300044693 Bacteria 1389
203 Ga0466963_0079658 3300044694 Bacteria 2216
204 Ga0466963_1049436 3300044694 Unclassified 573
205 Ga0466971_0031797 3300044719 Bacteria 2364
206 Ga0466971_0176656 3300044719 Bacteria 1003
207 Ga0466957_0016164 3300044842 Bacteria 4363
208 Ga0466959_0314158 3300045049 Bacteria 1072
209 Ga0466958_0040608 3300045836 Bacteria 2796
210 Ga0495617_136740 3300046452 Bacteria 784
211 Ga0495653_0138656 3300046463 Bacteria 1713
212 Ga0495584_0043067 3300046491 Bacteria 2279
213 Ga0495594_0508772 3300046499 Unclassified 684
214 Ga0495608_0048283 3300046511 Bacteria 2829
215 Ga0495608_0571043 3300046511 Bacteria 680
216 Ga0495628_0218543 3300046516 Bacteria 1432
217 Ga0495652_0085366 3300046529 Bacteria 2594
218 Ga0495640_0154056 3300046533 Bacteria 1476
219 Ga0495667_0157309 3300046559 Bacteria 1462
220 Ga0495656_0809845 3300046615 Unclassified 506
221 Ga0495647_0537670 3300046681 Unclassified 546
222 Ga0495658_0097147 3300046683 Bacteria 1753
223 Ga0495613_0027239 3300046689 Bacteria 4253
224 Ga0495600_0202976 3300046809 Unclassified 1272
225 Ga0495604_0019733 3300047317 Bacteria 5393
226 Ga0495674_0075272 3300047319 Bacteria 2905
227 Ga0495680_0028610 3300047322 Bacteria 4569
228 Ga0495680_0364458 3300047322 Bacteria 1004
229 Ga0496100_0010374 3300048903 Bacteria 5270
230 Ga0496101_0000455 3300048904 Bacteria 26007
231 Ga0496102_0001696 3300048905 Bacteria 19325
232 Ga0496104_0000410 3300048907 Bacteria 37646
233 Ga0496104_0006407 3300048907 Bacteria 10352
234 Ga0496104_1323866 3300048907 Unclassified 623
235 Ga0496105_0004253 3300048908 Bacteria 10769
236 Ga0496105_0015986 3300048908 Bacteria 5985
237 Ga0496106_0001532 3300048909 Bacteria 17382
238 Ga0496107_0007963 3300048910 Bacteria 7314
239 Ga0496108_0002431 3300048911 Bacteria 14887
240 Ga0496108_0008557 3300048911 Bacteria 8298
241 Ga0496108_0142709 3300048911 Bacteria 2063
242 Ga0496109_0003909 3300048912 Bacteria 12447
243 Ga0496109_0006920 3300048912 Bacteria 9568
244 Ga0496109_0016456 3300048912 Bacteria 6466
245 Ga0496110_0020230 3300048913 Bacteria 5617
246 Ga0496110_0095111 3300048913 Bacteria 2668
247 Ga0496110_0118647 3300048913 Bacteria 2382
248 Ga0496110_0636250 3300048913 Unclassified 966
249 Ga0496111_0003748 3300048914 Bacteria 9469
250 Ga0496111_0014585 3300048914 Bacteria 5373
251 Ga0496111_0252428 3300048914 Bacteria 1309
252 Ga0496112_0007734 3300048915 Bacteria 9564
253 Ga0496112_0215977 3300048915 Bacteria 1874
254 Ga0496112_0467665 3300048915 Unclassified 1198
255 Ga0496113_0009343 3300048916 Bacteria 6429
256 Ga0496114_0328816 3300048917 Bacteria 1351
257 Ga0496115_0068608 3300048918 Unclassified 2871
258 Ga0501031_0788612 3300049568 Bacteria 609
259 Ga0501034_0936068 3300049571 Unclassified 753
260 Ga0501034_1003095 3300049571 Bacteria 719
261 Ga0501036_0221917 3300049572 Bacteria 1587
262 Ga0501036_0727921 3300049572 Bacteria 819
263 Ga0501036_1718710 3300049572 Bacteria 506
264 Ga0501037_0526898 3300049573 Bacteria 799
265 Ga0501039_0060975 3300049575 Bacteria 2921
266 Ga0501039_0374527 3300049575 Unclassified 1118
267 Ga0501040_0222953 3300049576 Unclassified 1341
268 Ga0501040_0487058 3300049576 Bacteria 889
269 Ga0501041_0837653 3300049577 Bacteria 590
270 Ga0501042_0048799 3300049578 Bacteria 3019
271 Ga0501042_0147925 3300049578 Bacteria 1693
272 Ga0501046_0106623 3300049580 Bacteria 2144
273 Ga0501047_0068716 3300049581 Bacteria 3412
274 Ga0501047_0151834 3300049581 Bacteria 2192
275 Ga0501048_0146926 3300049582 Bacteria 1667
276 Ga0501048_0282316 3300049582 Bacteria 1181
277 Ga0501068_0130519 3300049584 Bacteria 1571
278 Ga0501071_0293914 3300049587 Bacteria 1231
279 Ga0501072_0000464 3300049588 Bacteria 29314
280 Ga0501072_0178226 3300049588 Unclassified 1695
281 Ga0501072_1252283 3300049588 Unclassified 576
282 Ga0501074_0385627 3300049590 Unclassified 994
283 Ga0501074_0466804 3300049590 Bacteria 895
284 Ga0501076_0293995 3300049592 Bacteria 1331
285 Ga0501076_0415762 3300049592 Bacteria 1106
286 Ga0501077_0096732 3300049593 Bacteria 1871
287 Ga0501079_0020269 3300049741 Bacteria 5082
288 Ga0501079_0076408 3300049741 Bacteria 2591
289 Ga0501079_0774917 3300049741 Bacteria 755
290 Ga0501083_0104508 3300049744 Bacteria 1866
291 Ga0501035_0557667 3300049822 Bacteria 938
292 Ga0501035_0595685 3300049822 Unclassified 901
293 Ga0501044_0854344 3300049823 Unclassified 787
294 Ga0501045_0017356 3300049824 Bacteria 5109
295 nmdc:mga05p37_184128_c1 3300050507 Bacteria 2540
296 nmdc:mga05p37_538933_c1 3300050507 Bacteria 1331
297 nmdc:mga09592_1197411_c1 3300050508 Bacteria 628
298 nmdc:mga0qj67_112028_c1 3300050509 Bacteria 2203
299 nmdc:mga06r32_1099566_c1 3300050510 Unclassified 744
300 nmdc:mga06r32_258790_c1 3300050510 Unclassified 1728
301 nmdc:mga08y16_166701_c1 3300050511 Bacteria 2288
302 nmdc:mga0rr50_95354_c1 3300050513 Bacteria 2325
303 nmdc:mga08x19_1190450_c1 3300050514 Bacteria 540
304 nmdc:mga0a205_164544_c1 3300050515 Bacteria 2114
305 Ga0495601_0012152 3300053077 Bacteria 5162
306 Ga0495601_0021831 3300053077 Bacteria 3924
307 Ga0495612_0070812 3300053078 Bacteria 1454
308 Ga0495595_0002735 3300053084 Bacteria 6921
309 Ga0495595_0052265 3300053084 Bacteria 1895
310 Ga0495619_0000134 3300053085 Bacteria 54869
311 Ga0495619_0025825 3300053085 Bacteria 3775
312 Ga0501084_0284088 3300054114 Bacteria 1397
313 Ga0501082_0348229 3300060353 Bacteria 1291
314 Ga0530510_0044868 3300061734 Bacteria 3195
315 Ga0114129_10009491
316 JGI25406J46586_10004094
317 JGI25406J46586_10121891
318 rootH1_10063918
319 Ga0058862_11449583
320 Ga0065704_10234693
321 Ga0065704_10322861
322 Ga0065715_10491686
323 Ga0065715_10534999
324 Ga0065707_10627768
325 Ga0070658_10048180
326 Ga0070658_10052834
327 Ga0070683_100562316
328 Ga0070670_100499066
329 Ga0070677_10078002
330 Ga0068869_100665342
331 Ga0070666_10477527
332 Ga0070660_100038042
333 Ga0070689_100309418
334 Ga0070687_100112340
335 Ga0070661_100412433
336 Ga0070669_100638177
337 Ga0070675_100005321
338 Ga0070671_100074373
339 Ga0070674_100009396
340 Ga0070673_100132322
341 Ga0070688_100953252
342 Ga0070667_101286219
343 Ga0070709_10171028
344 Ga0070714_100230486
345 Ga0070714_100360099
346 Ga0070713_100307414
347 Ga0070713_101086696
348 Ga0070711_100489314
349 Ga0070711_101323393
350 Ga0070711_101442274
351 Ga0070708_100634490
352 Ga0070662_100383445
353 Ga0070681_10789468
354 Ga0070681_11059444
355 Ga0070679_100166349
356 Ga0070679_100232051
357 Ga0070679_100757399
358 Ga0070684_100666277
359 Ga0070672_100025625
360 Ga0068855_100139767
361 Ga0068855_101118610
362 Ga0068857_100031654
363 Ga0068854_100196624
364 Ga0068856_100118146
365 Ga0068856_100360791
366 Ga0068856_100375321
367 Ga0068856_100856958
368 Ga0070702_100578616
369 Ga0068852_100077735
370 Ga0068852_100144569
371 Ga0068852_101643426
372 Ga0068859_100017187
373 Ga0068864_100052846
374 Ga0081455_10003574
375 Ga0081455_10220525
376 Ga0081540_1000128
377 Ga0081539_10002027
378 Ga0081539_10045635
379 Ga0081539_10075336
380 Ga0070717_10480024
381 Ga0070717_10542499
382 Ga0070717_10659967
383 Ga0075367_10682340
384 Ga0075366_10061302
385 Ga0068871_102236234
386 Ga0075428_100037545
387 Ga0075428_100897585
388 Ga0075428_101752847
389 Ga0075430_100122505
390 Ga0075430_100347177
391 Ga0075431_101321326
392 Ga0075434_101107552
393 Ga0097620_100017188
394 Ga0075435_100052113
395 Ga0075435_101474394
396 Ga0105240_10404031
397 Ga0111539_10061993
398 Ga0111539_11267080
399 Ga0105245_10387169
400 Ga0105247_10103534
401 Ga0114129_10113759
402 Ga0105243_10276434
403 Ga0105243_10993335
404 Ga0105241_10548907
405 Ga0105242_10227173
406 Ga0105238_10149522
407 Ga0105238_10952299
408 Ga0157371_10156142
409 Ga0157370_10315970
410 Ga0157370_10332982
411 Ga0157370_11351719
412 Ga0157369_10752317
413 Ga0157369_10829782
414 Ga0157374_11883870
415 Ga0163162_12222710
416 Ga0157372_12275847
417 Ga0157375_10856511
418 Ga0163163_10001825
419 Ga0157380_10185093
420 Ga0157380_12007412
421 Ga0157376_10446933
422 Ga0157376_12251870
423 Ga0163161_10658866
424 Ga0206356_10547741
425 Ga0206349_1894443
426 Ga0206350_11579858
427 Ga0206354_10084215
428 Ga0206353_10670992
429 Ga0224712_10385985
430 Ga0207682_10043682
431 Ga0207688_10135724
432 Ga0207645_10441264
433 Ga0207707_10098316
434 Ga0207707_10186445
435 Ga0207695_10150027
436 Ga0207660_10010654
437 Ga0207660_10633926
438 Ga0207662_10301091
439 Ga0207657_10077672
440 Ga0207657_11251952
441 Ga0207649_10823598
442 Ga0207652_10728995
443 Ga0207687_11243164
444 Ga0207664_10048802
445 Ga0207664_10474098
446 Ga0207644_10044025
447 Ga0207690_10292203
448 Ga0207709_11050967
449 Ga0207669_10114927
450 Ga0207669_11134717
451 Ga0207704_10707436
452 Ga0207665_11114928
453 Ga0207691_10641274
454 Ga0207661_10187187
455 Ga0207667_10172054
456 Ga0207667_10213012
457 Ga0207667_10481944
458 Ga0207651_11721665
459 Ga0207651_11747298
460 Ga0207640_10246988
461 Ga0207658_10273028
462 Ga0207702_10386343
463 Ga0207702_11676016
464 Ga0207676_10035694
465 Ga0207674_10049608
466 Ga0207675_100449586
467 Ga0207698_10064247
468 Ga0207698_11049925
469 Ga0265334_10130359
470 Ga0265336_10082041
471 Ga0265338_10350539
472 Ga0265338_10361457
473 Ga0265330_10045758
474 Ga0265330_10059813
475 Ga0265332_10010257
476 Ga0265325_10000062
477 Ga0265325_10012499
478 Ga0265325_10033302
479 Ga0265325_10064689
480 Ga0265329_10058249
481 Ga0265340_10033751
482 Ga0265340_10054747
483 Ga0265339_10012544
484 Ga0265339_10027211
485 Ga0265331_10018070
486 Ga0265331_10169443
487 Ga0265316_10258601
488 Ga0265313_10007771
489 Ga0265313_10023883
490 Ga0265313_10181022
491 Ga0265313_10184889
492 Ga0265314_10058255
493 Ga0265314_10076394
494 Ga0265314_10142695
495 Ga0265342_10000109
496 Ga0265342_10000348
497 Ga0265342_10083391
498 Ga0373934_0084945
499 Ga0373923_0060599
500 Ga0373923_0229796
501 Ga0373954_0114135
502 Ga0373956_0029309
503 Ga0373957_0004866
504 Ga0373960_0138239
505 Ga0373955_0008165
506 Ga0373924_0230701
507 Ga0373935_1061204
508 Ga0373933_0002255
509 Ga0373933_0863821
510 Ga0373937_0005513
511 Ga0373937_0032176
512 Ga0436364_0488213
513 Ga0436364_0996012
514 Ga0439446_0015957
515 Ga0439440_0126709
516 Ga0466961_0163067
517 Ga0466963_0079658
518 Ga0466963_1049436
519 Ga0466971_0031797
520 Ga0466971_0176656
521 Ga0466957_0016164
522 Ga0466959_0314158
523 Ga0466958_0040608
524 Ga0495617_136740
525 Ga0495653_0138656
526 Ga0495584_0043067
527 Ga0495594_0508772
528 Ga0495608_0048283
529 Ga0495608_0571043
530 Ga0495628_0218543
531 Ga0495652_0085366
532 Ga0495640_0154056
533 Ga0495667_0157309
534 Ga0495656_0809845
535 Ga0495647_0537670
536 Ga0495658_0097147
537 Ga0495613_0027239
538 Ga0495600_0202976
539 Ga0495604_0019733
540 Ga0495674_0075272
541 Ga0495680_0028610
542 Ga0495680_0364458
543 Ga0496100_0010374
544 Ga0496101_0000455
545 Ga0496102_0001696
546 Ga0496104_0000410
547 Ga0496104_0006407
548 Ga0496104_1323866
549 Ga0496105_0004253
550 Ga0496105_0015986
551 Ga0496106_0001532
552 Ga0496107_0007963
553 Ga0496108_0002431
554 Ga0496108_0008557
555 Ga0496108_0142709
556 Ga0496109_0003909
557 Ga0496109_0006920
558 Ga0496109_0016456
559 Ga0496110_0020230
560 Ga0496110_0095111
561 Ga0496110_0118647
562 Ga0496110_0636250
563 Ga0496111_0003748
564 Ga0496111_0014585
565 Ga0496111_0252428
566 Ga0496112_0007734
567 Ga0496112_0215977
568 Ga0496112_0467665
569 Ga0496113_0009343
570 Ga0496114_0328816
571 Ga0496115_0068608
572 Ga0501031_0788612
573 Ga0501034_0936068
574 Ga0501034_1003095
575 Ga0501036_0221917
576 Ga0501036_0727921
577 Ga0501036_1718710
578 Ga0501037_0526898
579 Ga0501039_0060975
580 Ga0501039_0374527
581 Ga0501040_0222953
582 Ga0501040_0487058
583 Ga0501041_0837653
584 Ga0501042_0048799
585 Ga0501042_0147925
586 Ga0501046_0106623
587 Ga0501047_0068716
588 Ga0501047_0151834
589 Ga0501048_0146926
590 Ga0501048_0282316
591 Ga0501068_0130519
592 Ga0501071_0293914
593 Ga0501072_0000464
594 Ga0501072_0178226
595 Ga0501072_1252283
596 Ga0501074_0385627
597 Ga0501074_0466804
598 Ga0501076_0293995
599 Ga0501076_0415762
600 Ga0501077_0096732
601 Ga0501079_0020269
602 Ga0501079_0076408
603 Ga0501079_0774917
604 Ga0501083_0104508
605 Ga0501035_0557667
606 Ga0501035_0595685
607 Ga0501044_0854344
608 Ga0501045_0017356
609 nmdc:mga05p37_184128_c1
610 nmdc:mga05p37_538933_c1
611 nmdc:mga09592_1197411_c1
612 nmdc:mga0qj67_112028_c1
613 nmdc:mga06r32_1099566_c1
614 nmdc:mga06r32_258790_c1
615 nmdc:mga08y16_166701_c1
616 nmdc:mga0rr50_95354_c1
617 nmdc:mga08x19_1190450_c1
618 nmdc:mga0a205_164544_c1
619 Ga0495601_0012152
620 Ga0495601_0021831
621 Ga0495612_0070812
622 Ga0495595_0002735
623 Ga0495595_0052265
624 Ga0495619_0000134
625 Ga0495619_0025825
626 Ga0501084_0284088
627 Ga0501082_0348229
628 Ga0530510_0044868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jd5-assembly2.cif.gz_B atpase 0.5061 102 131
2qmi-assembly1.cif.gz_E structure of the octameric penicillin-binding protein homologue from pyrococcus abyssi 0.5019 12 123
3c76-assembly1.cif.gz_X 1.07 a crystal structure of l133v mutant of nitrophorin 4 from rhodnius prolixus complexed with ammonia at ph 7.5 0.4791 6 130
5jk2-assembly8.cif.gz_H crystal structure of treponema pallidum tp0751 (pallilysin) 0.4737 12 123
2xdp-assembly1.cif.gz_A-2 crystal structure of the tudor domain of human jmjd2c 0.4726 83 128
ID Description Score Start End Superfamily
af_A4HYS3_91_210_3.10.330.10 Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; 0.7789 104 131 3.10.330.10
af_A0A1D6PZ26_96_197_3.10.330.10 Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; 0.7252 107 129 3.10.330.10
af_A0A1D6EWX1_851_994_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.6623 105 125 3.20.19.10
af_O05450_1144_1389_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6433 109 126 3.40.50.300
af_Q4CP65_211_293_3.10.330.10 Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; 0.6405 106 129 3.10.330.10
ID Description Score Start End GO Terms
AF-A0A1M7T5B4-F1-model_v4 Uncharacterized protein 0.9581 7 129
AF-A0A4R3DTG8-F1-model_v4 Uncharacterized protein 0.9537 8 131
AF-A0A327JIH3-F1-model_v4 deleted 0.9494 1 63
AF-A0A1I1DFK7-F1-model_v4 FHA domain-containing protein 0.9472 8 130
AF-A0A2W4QHH2-F1-model_v4 FHA domain-containing protein 0.9452 7 131

Map