F402634
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 314 | 183 | 314 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300006846|Ga0075430_101284693|Ga0075430_1012846931 |
| Length | 140 |
| Sequence | MVSPSDTVMPRAMVGAMIRQIAPQFFTTDLPATLAYYRDTLGFECLGTWDDPPVYAIVARDNHRIHFRCADPPTPNPDKYADELLDAYLLIESADALYAEYAARGVEFTRALGDTPWHSREFVVKDCDGRLLAFGATRSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 74 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 111 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 115 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 116 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 120 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 121 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 127 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 128 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 132 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 133 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 134 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 135 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 136 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 137 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 138 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 139 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 140 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 141 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 142 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 153 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 154 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 155 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 156 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 165 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 166 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 167 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 169 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 170 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 182 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 183 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.64 |
| Rhizosphere | 98.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001552 | 3300003203 | Bacteria | 10854 |
| 2 | JGI25406J46586_10084203 | 3300003203 | Bacteria | 970 |
| 3 | Ga0065715_10103785 | 3300005293 | Bacteria | 3009 |
| 4 | Ga0070676_10028256 | 3300005328 | Bacteria | 3185 |
| 5 | Ga0070670_100086028 | 3300005331 | Unclassified | 2701 |
| 6 | Ga0070670_100300513 | 3300005331 | Bacteria | 1404 |
| 7 | Ga0068869_100821628 | 3300005334 | Bacteria | 800 |
| 8 | Ga0070680_100982536 | 3300005336 | Unclassified | 729 |
| 9 | Ga0068868_100145272 | 3300005338 | Bacteria | 1950 |
| 10 | Ga0068868_100312171 | 3300005338 | Unclassified | 1338 |
| 11 | Ga0070689_100436171 | 3300005340 | Unclassified | 1112 |
| 12 | Ga0070689_101996084 | 3300005340 | Bacteria | 530 |
| 13 | Ga0070691_10092379 | 3300005341 | Bacteria | 1493 |
| 14 | Ga0070687_100579421 | 3300005343 | Unclassified | 768 |
| 15 | Ga0070687_101403514 | 3300005343 | Unclassified | 522 |
| 16 | Ga0070661_100090813 | 3300005344 | Bacteria | 2262 |
| 17 | Ga0070692_10406356 | 3300005345 | Unclassified | 861 |
| 18 | Ga0070692_10550503 | 3300005345 | Bacteria | 756 |
| 19 | Ga0070669_100175613 | 3300005353 | Bacteria | 1673 |
| 20 | Ga0070675_100017494 | 3300005354 | Bacteria | 5696 |
| 21 | Ga0070675_100068773 | 3300005354 | Bacteria | 2933 |
| 22 | Ga0070675_100076834 | 3300005354 | Bacteria | 2778 |
| 23 | Ga0070675_100864535 | 3300005354 | Unclassified | 828 |
| 24 | Ga0070671_100087466 | 3300005355 | Bacteria | 2608 |
| 25 | Ga0070673_100080279 | 3300005364 | Bacteria | 2643 |
| 26 | Ga0070673_101228295 | 3300005364 | Bacteria | 703 |
| 27 | Ga0070688_100068523 | 3300005365 | Bacteria | 2262 |
| 28 | Ga0070713_100263420 | 3300005436 | Bacteria | 1576 |
| 29 | Ga0070701_10116492 | 3300005438 | Bacteria | 1500 |
| 30 | Ga0070700_100011227 | 3300005441 | Bacteria | 4959 |
| 31 | Ga0070694_100249164 | 3300005444 | Bacteria | 1343 |
| 32 | Ga0070694_100465375 | 3300005444 | Unclassified | 1001 |
| 33 | Ga0070694_100720585 | 3300005444 | Bacteria | 812 |
| 34 | Ga0070694_101066091 | 3300005444 | Unclassified | 673 |
| 35 | Ga0070678_100849995 | 3300005456 | Unclassified | 831 |
| 36 | Ga0070678_101783443 | 3300005456 | Unclassified | 580 |
| 37 | Ga0068867_100374209 | 3300005459 | Unclassified | 1195 |
| 38 | Ga0068867_100924176 | 3300005459 | Bacteria | 786 |
| 39 | Ga0070685_10157594 | 3300005466 | Unclassified | 1444 |
| 40 | Ga0070706_101611832 | 3300005467 | Unclassified | 592 |
| 41 | Ga0070699_101013213 | 3300005518 | Unclassified | 761 |
| 42 | Ga0070699_101137734 | 3300005518 | Unclassified | 716 |
| 43 | Ga0070699_101137985 | 3300005518 | Unclassified | 716 |
| 44 | Ga0070695_100070307 | 3300005545 | Archaea | 2289 |
| 45 | Ga0070695_100181814 | 3300005545 | Unclassified | 1490 |
| 46 | Ga0070696_100024257 | 3300005546 | Bacteria | 4121 |
| 47 | Ga0070665_100022135 | 3300005548 | Bacteria | 6393 |
| 48 | Ga0070665_100234347 | 3300005548 | Bacteria | 1836 |
| 49 | Ga0070704_100072293 | 3300005549 | Bacteria | 2509 |
| 50 | Ga0070704_100119653 | 3300005549 | Bacteria | 2020 |
| 51 | Ga0070664_100041802 | 3300005564 | Bacteria | 3869 |
| 52 | Ga0068857_100095229 | 3300005577 | Bacteria | 2667 |
| 53 | Ga0068854_100102137 | 3300005578 | Archaea | 2151 |
| 54 | Ga0070702_100059499 | 3300005615 | Bacteria | 2217 |
| 55 | Ga0068861_100694813 | 3300005719 | Unclassified | 944 |
| 56 | Ga0068870_10640731 | 3300005840 | Bacteria | 727 |
| 57 | Ga0068858_100181267 | 3300005842 | Bacteria | 1989 |
| 58 | Ga0068860_100584866 | 3300005843 | Unclassified | 1121 |
| 59 | Ga0068862_101182107 | 3300005844 | Bacteria | 763 |
| 60 | Ga0081539_10000993 | 3300005985 | Bacteria | 52701 |
| 61 | Ga0081539_10004888 | 3300005985 | Bacteria | 14303 |
| 62 | Ga0070717_10541238 | 3300006028 | Bacteria | 1054 |
| 63 | Ga0097621_100066839 | 3300006237 | Bacteria | 2962 |
| 64 | Ga0068871_101296702 | 3300006358 | Unclassified | 685 |
| 65 | Ga0075428_100001406 | 3300006844 | Bacteria | 25623 |
| 66 | Ga0075428_100065691 | 3300006844 | Bacteria | 3973 |
| 67 | Ga0075428_100171030 | 3300006844 | Unclassified | 2355 |
| 68 | Ga0075428_100608349 | 3300006844 | Unclassified | 1167 |
| 69 | Ga0075430_100006398 | 3300006846 | Bacteria | 9930 |
| 70 | Ga0075430_100069754 | 3300006846 | Unclassified | 2948 |
| 71 | Ga0075430_100130731 | 3300006846 | Bacteria | 2092 |
| 72 | Ga0075430_101284693 | 3300006846 | Unclassified | 602 |
| 73 | Ga0075431_100007546 | 3300006847 | Bacteria | 10829 |
| 74 | Ga0075431_100068632 | 3300006847 | Bacteria | 3658 |
| 75 | Ga0075431_100112652 | 3300006847 | Archaea | 2807 |
| 76 | Ga0075431_101388832 | 3300006847 | Unclassified | 662 |
| 77 | Ga0075433_10017327 | 3300006852 | Bacteria | 5965 |
| 78 | Ga0075434_100009269 | 3300006871 | Bacteria | 9174 |
| 79 | Ga0075434_100020643 | 3300006871 | Bacteria | 6394 |
| 80 | Ga0075434_100355126 | 3300006871 | Unclassified | 1487 |
| 81 | Ga0075429_100003580 | 3300006880 | Bacteria | 13238 |
| 82 | Ga0075429_100319179 | 3300006880 | Unclassified | 1360 |
| 83 | Ga0075429_100357369 | 3300006880 | Unclassified | 1279 |
| 84 | Ga0075429_101602938 | 3300006880 | Archaea | 566 |
| 85 | Ga0075436_100039400 | 3300006914 | Bacteria | 3261 |
| 86 | Ga0075436_100078259 | 3300006914 | Bacteria | 2291 |
| 87 | Ga0075435_100000304 | 3300007076 | Bacteria | 30337 |
| 88 | Ga0075435_100415285 | 3300007076 | Bacteria | 1158 |
| 89 | Ga0105240_10000545 | 3300009093 | Bacteria | 69562 |
| 90 | Ga0105240_10024540 | 3300009093 | Bacteria | 7946 |
| 91 | Ga0105240_10027385 | 3300009093 | Bacteria | 7461 |
| 92 | Ga0105240_11670129 | 3300009093 | Unclassified | 665 |
| 93 | Ga0111539_10000322 | 3300009094 | Bacteria | 58508 |
| 94 | Ga0111539_10034744 | 3300009094 | Bacteria | 6107 |
| 95 | Ga0111539_10121648 | 3300009094 | Bacteria | 3058 |
| 96 | Ga0111539_12164599 | 3300009094 | Unclassified | 645 |
| 97 | Ga0105245_10051685 | 3300009098 | Bacteria | 3684 |
| 98 | Ga0105245_10139930 | 3300009098 | Unclassified | 2278 |
| 99 | Ga0105245_11121475 | 3300009098 | Unclassified | 833 |
| 100 | Ga0114129_10000592 | 3300009147 | Bacteria | 44838 |
| 101 | Ga0114129_10003765 | 3300009147 | Bacteria | 21379 |
| 102 | Ga0114129_10082032 | 3300009147 | Bacteria | 4481 |
| 103 | Ga0114129_10286572 | 3300009147 | Unclassified | 2199 |
| 104 | Ga0114129_10344055 | 3300009147 | Bacteria | 1977 |
| 105 | Ga0114129_10629582 | 3300009147 | Bacteria | 1387 |
| 106 | Ga0114129_10732332 | 3300009147 | Bacteria | 1268 |
| 107 | Ga0114129_12496561 | 3300009147 | Unclassified | 618 |
| 108 | Ga0105243_12591402 | 3300009148 | Unclassified | 547 |
| 109 | Ga0105241_10003311 | 3300009174 | Bacteria | 11985 |
| 110 | Ga0105248_10000726 | 3300009177 | Bacteria | 37162 |
| 111 | Ga0105248_10746979 | 3300009177 | Bacteria | 1104 |
| 112 | Ga0105237_10542294 | 3300009545 | Unclassified | 1170 |
| 113 | Ga0105238_10005856 | 3300009551 | Bacteria | 12176 |
| 114 | Ga0105249_10366298 | 3300009553 | Unclassified | 1464 |
| 115 | Ga0105249_10472953 | 3300009553 | Bacteria | 1295 |
| 116 | Ga0105249_11014426 | 3300009553 | Bacteria | 899 |
| 117 | Ga0105249_11930037 | 3300009553 | Bacteria | 663 |
| 118 | Ga0105239_10011817 | 3300010375 | Bacteria | 9745 |
| 119 | Ga0157369_11759031 | 3300013105 | Unclassified | 630 |
| 120 | Ga0157369_12419036 | 3300013105 | Bacteria | 532 |
| 121 | Ga0157374_10059769 | 3300013296 | Bacteria | 3565 |
| 122 | Ga0157378_10109722 | 3300013297 | Bacteria | 2528 |
| 123 | Ga0157378_10198905 | 3300013297 | Bacteria | 1895 |
| 124 | Ga0157378_11270798 | 3300013297 | Unclassified | 777 |
| 125 | Ga0163162_10123506 | 3300013306 | Bacteria | 2694 |
| 126 | Ga0163162_10131402 | 3300013306 | Bacteria | 2612 |
| 127 | Ga0157372_10207038 | 3300013307 | Unclassified | 2273 |
| 128 | Ga0157372_10465981 | 3300013307 | Bacteria | 1473 |
| 129 | Ga0157375_11246102 | 3300013308 | Bacteria | 873 |
| 130 | Ga0157375_12191318 | 3300013308 | Unclassified | 658 |
| 131 | Ga0163163_10090402 | 3300014325 | Bacteria | 3075 |
| 132 | Ga0157380_10097630 | 3300014326 | Bacteria | 2439 |
| 133 | Ga0157380_10992252 | 3300014326 | Unclassified | 873 |
| 134 | Ga0157380_10992398 | 3300014326 | Unclassified | 872 |
| 135 | Ga0157377_10132681 | 3300014745 | Unclassified | 1523 |
| 136 | Ga0157376_10012514 | 3300014969 | Bacteria | 6299 |
| 137 | Ga0157376_11437621 | 3300014969 | Unclassified | 722 |
| 138 | Ga0213875_10457575 | 3300021388 | Unclassified | 611 |
| 139 | Ga0207697_10288699 | 3300025315 | Unclassified | 727 |
| 140 | Ga0207682_10339388 | 3300025893 | Bacteria | 707 |
| 141 | Ga0207643_10452741 | 3300025908 | Bacteria | 817 |
| 142 | Ga0207684_10832035 | 3300025910 | Unclassified | 779 |
| 143 | Ga0207654_10049288 | 3300025911 | Bacteria | 2415 |
| 144 | Ga0207695_10000329 | 3300025913 | Bacteria | 113344 |
| 145 | Ga0207695_10041626 | 3300025913 | Bacteria | 4916 |
| 146 | Ga0207695_10171344 | 3300025913 | Bacteria | 2096 |
| 147 | Ga0207671_10346666 | 3300025914 | Unclassified | 1177 |
| 148 | Ga0207662_10352820 | 3300025918 | Bacteria | 988 |
| 149 | Ga0207681_10020942 | 3300025923 | Bacteria | 4150 |
| 150 | Ga0207681_10137848 | 3300025923 | Bacteria | 1813 |
| 151 | Ga0207694_10001631 | 3300025924 | Bacteria | 18864 |
| 152 | Ga0207650_10524521 | 3300025925 | Bacteria | 991 |
| 153 | Ga0207659_10002098 | 3300025926 | Bacteria | 11802 |
| 154 | Ga0207659_10004251 | 3300025926 | Bacteria | 8657 |
| 155 | Ga0207659_10006483 | 3300025926 | Bacteria | 7172 |
| 156 | Ga0207659_10364305 | 3300025926 | Viruses | 1202 |
| 157 | Ga0207659_10745195 | 3300025926 | Unclassified | 840 |
| 158 | Ga0207659_11349075 | 3300025926 | Bacteria | 612 |
| 159 | Ga0207687_10024221 | 3300025927 | Bacteria | 4052 |
| 160 | Ga0207687_10601528 | 3300025927 | Bacteria | 927 |
| 161 | Ga0207687_10605359 | 3300025927 | Unclassified | 924 |
| 162 | Ga0207700_11108974 | 3300025928 | Unclassified | 707 |
| 163 | Ga0207664_10033377 | 3300025929 | Bacteria | 3953 |
| 164 | Ga0207644_10061674 | 3300025931 | Bacteria | 2717 |
| 165 | Ga0207644_11874608 | 3300025931 | Unclassified | 501 |
| 166 | Ga0207706_10345832 | 3300025933 | Unclassified | 1293 |
| 167 | Ga0207709_10089076 | 3300025935 | Bacteria | 2011 |
| 168 | Ga0207670_10047043 | 3300025936 | Bacteria | 2870 |
| 169 | Ga0207670_10447062 | 3300025936 | Unclassified | 1041 |
| 170 | Ga0207691_10394731 | 3300025940 | Bacteria | 1180 |
| 171 | Ga0207711_10001971 | 3300025941 | Bacteria | 18618 |
| 172 | Ga0207689_10617127 | 3300025942 | Bacteria | 913 |
| 173 | Ga0207712_11079925 | 3300025961 | Unclassified | 714 |
| 174 | Ga0207668_10332709 | 3300025972 | Unclassified | 1264 |
| 175 | Ga0207668_10886904 | 3300025972 | Viruses | 793 |
| 176 | Ga0207640_10077503 | 3300025981 | Archaea | 2260 |
| 177 | Ga0207677_10348230 | 3300026023 | Bacteria | 1240 |
| 178 | Ga0207703_10421919 | 3300026035 | Unclassified | 1241 |
| 179 | Ga0207708_10006354 | 3300026075 | Bacteria | 8758 |
| 180 | Ga0207648_10043712 | 3300026089 | Bacteria | 3933 |
| 181 | Ga0207674_10304137 | 3300026116 | Unclassified | 1544 |
| 182 | Ga0207683_11710794 | 3300026121 | Unclassified | 578 |
| 183 | Ga0207428_10001161 | 3300027907 | Bacteria | 28406 |
| 184 | Ga0207428_10057371 | 3300027907 | Bacteria | 3091 |
| 185 | Ga0268266_10896606 | 3300028379 | Unclassified | 857 |
| 186 | Ga0268266_11009055 | 3300028379 | Bacteria | 805 |
| 187 | Ga0268265_11244776 | 3300028380 | Unclassified | 743 |
| 188 | Ga0265338_10011137 | 3300028800 | Bacteria | 10426 |
| 189 | Ga0265324_10058897 | 3300029957 | Bacteria | 1313 |
| 190 | Ga0316182_1371493 | 3300030745 | Unclassified | 635 |
| 191 | Ga0265328_10008227 | 3300031239 | Bacteria | 4312 |
| 192 | Ga0265339_10012081 | 3300031249 | Bacteria | 5290 |
| 193 | Ga0265327_10199791 | 3300031251 | Bacteria | 906 |
| 194 | Ga0265316_10006255 | 3300031344 | Bacteria | 11410 |
| 195 | Ga0307408_100077177 | 3300031548 | Bacteria | 2480 |
| 196 | Ga0307408_100113197 | 3300031548 | Bacteria | 2088 |
| 197 | Ga0307408_100315529 | 3300031548 | Bacteria | 1315 |
| 198 | Ga0307408_100807357 | 3300031548 | Bacteria | 852 |
| 199 | Ga0307408_100907595 | 3300031548 | Unclassified | 807 |
| 200 | Ga0265314_10010971 | 3300031711 | Bacteria | 7519 |
| 201 | Ga0307405_10055254 | 3300031731 | Bacteria | 2484 |
| 202 | Ga0307405_10449851 | 3300031731 | Unclassified | 1021 |
| 203 | Ga0307413_10326983 | 3300031824 | Unclassified | 1174 |
| 204 | Ga0307413_11442363 | 3300031824 | Unclassified | 607 |
| 205 | Ga0307410_10427859 | 3300031852 | Unclassified | 1075 |
| 206 | Ga0307410_11133566 | 3300031852 | Unclassified | 679 |
| 207 | Ga0307406_10290582 | 3300031901 | Bacteria | 1251 |
| 208 | Ga0307407_10524688 | 3300031903 | Bacteria | 872 |
| 209 | Ga0307407_10635861 | 3300031903 | Bacteria | 798 |
| 210 | Ga0307407_10987609 | 3300031903 | Unclassified | 650 |
| 211 | Ga0307412_10324146 | 3300031911 | Bacteria | 1227 |
| 212 | Ga0307412_10582336 | 3300031911 | Unclassified | 945 |
| 213 | Ga0307412_10807213 | 3300031911 | Unclassified | 815 |
| 214 | Ga0307409_100200529 | 3300031995 | Bacteria | 1785 |
| 215 | Ga0307409_100606425 | 3300031995 | Bacteria | 1082 |
| 216 | Ga0307416_100272308 | 3300032002 | Bacteria | 1663 |
| 217 | Ga0307416_100626186 | 3300032002 | Bacteria | 1158 |
| 218 | Ga0307416_102311897 | 3300032002 | Unclassified | 638 |
| 219 | Ga0307414_10681804 | 3300032004 | Unclassified | 929 |
| 220 | Ga0307411_10083288 | 3300032005 | Bacteria | 2209 |
| 221 | Ga0307411_10383461 | 3300032005 | Bacteria | 1157 |
| 222 | Ga0307411_11237377 | 3300032005 | Unclassified | 678 |
| 223 | Ga0307411_11814357 | 3300032005 | Unclassified | 566 |
| 224 | Ga0307415_100425921 | 3300032126 | Bacteria | 1140 |
| 225 | Ga0373946_0687809 | 3300035171 | Bacteria | 534 |
| 226 | Ga0373933_0627577 | 3300035724 | Unclassified | 706 |
| 227 | Ga0395900_1783087 | 3300037418 | Unclassified | 526 |
| 228 | Ga0436364_0920232 | 3300037853 | Unclassified | 607 |
| 229 | Ga0436360_0177441 | 3300039438 | Unclassified | 845 |
| 230 | Ga0439441_123882 | 3300042001 | Unclassified | 595 |
| 231 | Ga0450920_011834 | 3300042122 | Unclassified | 1630 |
| 232 | Ga0450896_003598 | 3300042133 | Unclassified | 2066 |
| 233 | Ga0450898_024427 | 3300042134 | Unclassified | 1080 |
| 234 | Ga0450906_087748 | 3300042145 | Unclassified | 563 |
| 235 | Ga0450908_025753 | 3300042184 | Unclassified | 1027 |
| 236 | Ga0439435_0001814 | 3300042436 | Bacteria | 4073 |
| 237 | Ga0439435_0303928 | 3300042436 | Unclassified | 547 |
| 238 | Ga0439460_0044200 | 3300042461 | Unclassified | 1318 |
| 239 | Ga0439460_0243872 | 3300042461 | Unclassified | 620 |
| 240 | Ga0450918_034776 | 3300042531 | Unclassified | 895 |
| 241 | Ga0439440_0116958 | 3300042993 | Bacteria | 739 |
| 242 | Ga0466967_1240409 | 3300045976 | Bacteria | 743 |
| 243 | Ga0495629_0076615 | 3300046459 | Bacteria | 2335 |
| 244 | Ga0495598_0072255 | 3300046537 | Bacteria | 1089 |
| 245 | Ga0495635_0720958 | 3300046663 | Unclassified | 646 |
| 246 | Ga0495613_0114334 | 3300046689 | Bacteria | 1943 |
| 247 | Ga0495613_0229842 | 3300046689 | Bacteria | 1300 |
| 248 | Ga0495600_0193852 | 3300046809 | Bacteria | 1306 |
| 249 | Ga0495636_0123928 | 3300047318 | Unclassified | 1145 |
| 250 | Ga0495675_0070175 | 3300047444 | Bacteria | 2212 |
| 251 | Ga0496110_0587932 | 3300048913 | Bacteria | 1010 |
| 252 | Ga0496112_0060864 | 3300048915 | Bacteria | 3721 |
| 253 | Ga0501291_030156 | 3300049514 | Bacteria | 911 |
| 254 | Ga0501298_084160 | 3300049521 | Bacteria | 704 |
| 255 | Ga0501299_167664 | 3300049522 | Unclassified | 565 |
| 256 | Ga0501299_198286 | 3300049522 | Unclassified | 532 |
| 257 | Ga0501038_0937334 | 3300049574 | Unclassified | 638 |
| 258 | Ga0501040_0352379 | 3300049576 | Unclassified | 1055 |
| 259 | Ga0501040_1070071 | 3300049576 | Bacteria | 585 |
| 260 | Ga0501041_0018754 | 3300049577 | Bacteria | 4121 |
| 261 | Ga0501043_1134676 | 3300049579 | Bacteria | 551 |
| 262 | Ga0501068_0380740 | 3300049584 | Bacteria | 909 |
| 263 | Ga0501071_0129994 | 3300049587 | Bacteria | 1870 |
| 264 | Ga0501072_0118827 | 3300049588 | Bacteria | 2106 |
| 265 | Ga0501077_0624111 | 3300049593 | Bacteria | 693 |
| 266 | Ga0501206_067386 | 3300049653 | Unclassified | 599 |
| 267 | Ga0501216_178924 | 3300049660 | Unclassified | 516 |
| 268 | Ga0501227_197191 | 3300049665 | Unclassified | 569 |
| 269 | Ga0501079_0557699 | 3300049741 | Bacteria | 901 |
| 270 | Ga0501268_159433 | 3300049765 | Unclassified | 526 |
| 271 | Ga0501282_054303 | 3300049778 | Unclassified | 501 |
| 272 | Ga0501045_0032359 | 3300049824 | Bacteria | 3790 |
| 273 | nmdc:mga05p37_1012_c1 | 3300050507 | Bacteria | 31983 |
| 274 | nmdc:mga05p37_114155_c1 | 3300050507 | Bacteria | 3320 |
| 275 | nmdc:mga05p37_1396_c1 | 3300050507 | Bacteria | 28112 |
| 276 | nmdc:mga05p37_211248_c1 | 3300050507 | Unclassified | 2346 |
| 277 | nmdc:mga05p37_2921_c1 | 3300050507 | Bacteria | 19832 |
| 278 | nmdc:mga05p37_656737_c1 | 3300050507 | Unclassified | 1173 |
| 279 | nmdc:mga05p37_90717_c1 | 3300050507 | Bacteria | 3766 |
| 280 | nmdc:mga09592_181834_c1 | 3300050508 | Bacteria | 1819 |
| 281 | nmdc:mga09592_3220_c1 | 3300050508 | Bacteria | 13220 |
| 282 | nmdc:mga09592_330295_c1 | 3300050508 | Unclassified | 1320 |
| 283 | nmdc:mga09592_993000_c1 | 3300050508 | Bacteria | 702 |
| 284 | nmdc:mga0qj67_1019836_c1 | 3300050509 | Unclassified | 649 |
| 285 | nmdc:mga0qj67_1022500_c1 | 3300050509 | Unclassified | 648 |
| 286 | nmdc:mga0qj67_34517_c1 | 3300050509 | Bacteria | 3952 |
| 287 | nmdc:mga0qj67_6870_c1 | 3300050509 | Bacteria | 8370 |
| 288 | nmdc:mga0qj67_75817_c1 | 3300050509 | Unclassified | 2689 |
| 289 | nmdc:mga06r32_120865_c1 | 3300050510 | Bacteria | 2584 |
| 290 | nmdc:mga06r32_145693_c1 | 3300050510 | Bacteria | 2346 |
| 291 | nmdc:mga06r32_62045_c1 | 3300050510 | Bacteria | 3600 |
| 292 | nmdc:mga06r32_988388_c1 | 3300050510 | Unclassified | 795 |
| 293 | nmdc:mga08y16_10210_c1 | 3300050511 | Bacteria | 9858 |
| 294 | nmdc:mga08y16_1461798_c1 | 3300050511 | Unclassified | 645 |
| 295 | nmdc:mga08y16_1661_c1 | 3300050511 | Bacteria | 22561 |
| 296 | nmdc:mga08y16_1940204_c1 | 3300050511 | Bacteria | 539 |
| 297 | nmdc:mga08y16_2109654_c1 | 3300050511 | Unclassified | 511 |
| 298 | nmdc:mga08y16_741_c1 | 3300050511 | Bacteria | 31071 |
| 299 | nmdc:mga0n895_1161465_c1 | 3300050512 | Unclassified | 747 |
| 300 | nmdc:mga0n895_2219854_c1 | 3300050512 | Unclassified | 504 |
| 301 | nmdc:mga0n895_65928_c1 | 3300050512 | Bacteria | 3585 |
| 302 | nmdc:mga0n895_76864_c1 | 3300050512 | Bacteria | 3320 |
| 303 | nmdc:mga0rr50_20389_c1 | 3300050513 | Bacteria | 4501 |
| 304 | nmdc:mga0rr50_693028_c1 | 3300050513 | Unclassified | 869 |
| 305 | nmdc:mga0rr50_699464_c1 | 3300050513 | Bacteria | 865 |
| 306 | nmdc:mga0rr50_830620_c1 | 3300050513 | Unclassified | 788 |
| 307 | nmdc:mga08x19_6293_c1 | 3300050514 | Bacteria | 7028 |
| 308 | nmdc:mga08x19_69112_c1 | 3300050514 | Bacteria | 2300 |
| 309 | nmdc:mga0a205_136147_c1 | 3300050515 | Unclassified | 2357 |
| 310 | nmdc:mga0a205_74166_c1 | 3300050515 | Bacteria | 3288 |
| 311 | Ga0501084_0244660 | 3300054114 | Bacteria | 1514 |
| 312 | Ga0590071_074258 | 3300059421 | Unclassified | 840 |
| 313 | Ga0590075_018685 | 3300059424 | Unclassified | 1716 |
| 314 | Ga0530510_0589756 | 3300061734 | Unclassified | 845 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10629582 | Ga0114129_106295822 | 105 |
| 2 | 3300050507 | nmdc:mga05p37_656737_c1 | nmdc:mga05p37_656737_c1_709_1056 | 105 |
| 3 | 3300049521 | Ga0501298_084160 | Ga0501298_084160_206_562 | 118 |
| 4 | 3300006028 | Ga0070717_10541238 | Ga0070717_105412382 | 120 |
| 5 | 3300005338 | Ga0068868_100145272 | Ga0068868_1001452721 | 121 |
| 6 | 3300005355 | Ga0070671_100087466 | Ga0070671_1000874662 | 121 |
| 7 | 3300006237 | Ga0097621_100066839 | Ga0097621_1000668394 | 121 |
| 8 | 3300009098 | Ga0105245_10139930 | Ga0105245_101399303 | 121 |
| 9 | 3300009174 | Ga0105241_10003311 | Ga0105241_1000331111 | 121 |
| 10 | 3300009177 | Ga0105248_10000726 | Ga0105248_1000072623 | 121 |
| 11 | 3300009545 | Ga0105237_10542294 | Ga0105237_105422942 | 121 |
| 12 | 3300010375 | Ga0105239_10011817 | Ga0105239_100118176 | 121 |
| 13 | 3300013296 | Ga0157374_10059769 | Ga0157374_100597694 | 121 |
| 14 | 3300013297 | Ga0157378_10109722 | Ga0157378_101097222 | 121 |
| 15 | 3300013307 | Ga0157372_10465981 | Ga0157372_104659812 | 121 |
| 16 | 3300013308 | Ga0157375_12191318 | Ga0157375_121913182 | 121 |
| 17 | 3300014969 | Ga0157376_10012514 | Ga0157376_100125143 | 121 |
| 18 | 3300025893 | Ga0207682_10339388 | Ga0207682_103393881 | 121 |
| 19 | 3300025911 | Ga0207654_10049288 | Ga0207654_100492885 | 121 |
| 20 | 3300025913 | Ga0207695_10000329 | Ga0207695_1000032954 | 121 |
| 21 | 3300025931 | Ga0207644_10061674 | Ga0207644_100616742 | 121 |
| 22 | 3300025941 | Ga0207711_10001971 | Ga0207711_1000197110 | 121 |
| 23 | 3300026023 | Ga0207677_10348230 | Ga0207677_103482302 | 121 |
| 24 | 3300028800 | Ga0265338_10011137 | Ga0265338_100111372 | 121 |
| 25 | 3300029957 | Ga0265324_10058897 | Ga0265324_100588972 | 121 |
| 26 | 3300031239 | Ga0265328_10008227 | Ga0265328_100082274 | 121 |
| 27 | 3300031249 | Ga0265339_10012081 | Ga0265339_100120812 | 121 |
| 28 | 3300031251 | Ga0265327_10199791 | Ga0265327_101997912 | 121 |
| 29 | 3300031344 | Ga0265316_10006255 | Ga0265316_100062559 | 121 |
| 30 | 3300031711 | Ga0265314_10010971 | Ga0265314_100109717 | 121 |
| 31 | 3300005336 | Ga0070680_100982536 | Ga0070680_1009825361 | 122 |
| 32 | 3300005344 | Ga0070661_100090813 | Ga0070661_1000908131 | 122 |
| 33 | 3300005548 | Ga0070665_100022135 | Ga0070665_1000221352 | 122 |
| 34 | 3300005840 | Ga0068870_10640731 | Ga0068870_106407312 | 122 |
| 35 | 3300009093 | Ga0105240_10000545 | Ga0105240_100005456 | 122 |
| 36 | 3300009093 | Ga0105240_10024540 | Ga0105240_100245409 | 122 |
| 37 | 3300009551 | Ga0105238_10005856 | Ga0105238_100058564 | 122 |
| 38 | 3300009553 | Ga0105249_11014426 | Ga0105249_110144262 | 122 |
| 39 | 3300013105 | Ga0157369_12419036 | Ga0157369_124190361 | 122 |
| 40 | 3300013297 | Ga0157378_10198905 | Ga0157378_101989052 | 122 |
| 41 | 3300013306 | Ga0163162_10131402 | Ga0163162_101314022 | 122 |
| 42 | 3300013307 | Ga0157372_10207038 | Ga0157372_102070384 | 122 |
| 43 | 3300025908 | Ga0207643_10452741 | Ga0207643_104527412 | 122 |
| 44 | 3300025913 | Ga0207695_10171344 | Ga0207695_101713441 | 122 |
| 45 | 3300025914 | Ga0207671_10346666 | Ga0207671_103466662 | 122 |
| 46 | 3300025924 | Ga0207694_10001631 | Ga0207694_100016311 | 122 |
| 47 | 3300025927 | Ga0207687_10605359 | Ga0207687_106053591 | 122 |
| 48 | 3300025929 | Ga0207664_10033377 | Ga0207664_100333773 | 122 |
| 49 | 3300025936 | Ga0207670_10447062 | Ga0207670_104470622 | 122 |
| 50 | 3300026121 | Ga0207683_11710794 | Ga0207683_117107941 | 122 |
| 51 | 3300028379 | Ga0268266_10896606 | Ga0268266_108966062 | 122 |
| 52 | 3300035724 | Ga0373933_0627577 | Ga0373933_0627577_198_566 | 122 |
| 53 | 3300039438 | Ga0436360_0177441 | Ga0436360_0177441_415_783 | 122 |
| 54 | 3300046459 | Ga0495629_0076615 | Ga0495629_0076615_1907_2281 | 122 |
| 55 | 3300047444 | Ga0495675_0070175 | Ga0495675_0070175_765_1133 | 122 |
| 56 | 3300003203 | JGI25406J46586_10001552 | JGI25406J46586_100015522 | 123 |
| 57 | 3300003203 | JGI25406J46586_10084203 | JGI25406J46586_100842032 | 123 |
| 58 | 3300005293 | Ga0065715_10103785 | Ga0065715_101037856 | 123 |
| 59 | 3300005328 | Ga0070676_10028256 | Ga0070676_100282563 | 123 |
| 60 | 3300005331 | Ga0070670_100086028 | Ga0070670_1000860283 | 123 |
| 61 | 3300005331 | Ga0070670_100300513 | Ga0070670_1003005132 | 123 |
| 62 | 3300005334 | Ga0068869_100821628 | Ga0068869_1008216282 | 123 |
| 63 | 3300005338 | Ga0068868_100312171 | Ga0068868_1003121712 | 123 |
| 64 | 3300005340 | Ga0070689_100436171 | Ga0070689_1004361712 | 123 |
| 65 | 3300005340 | Ga0070689_101996084 | Ga0070689_1019960841 | 123 |
| 66 | 3300005341 | Ga0070691_10092379 | Ga0070691_100923791 | 123 |
| 67 | 3300005343 | Ga0070687_100579421 | Ga0070687_1005794212 | 123 |
| 68 | 3300005343 | Ga0070687_101403514 | Ga0070687_1014035141 | 123 |
| 69 | 3300005345 | Ga0070692_10406356 | Ga0070692_104063561 | 123 |
| 70 | 3300005345 | Ga0070692_10550503 | Ga0070692_105505032 | 123 |
| 71 | 3300005353 | Ga0070669_100175613 | Ga0070669_1001756131 | 123 |
| 72 | 3300005354 | Ga0070675_100017494 | Ga0070675_1000174942 | 123 |
| 73 | 3300005354 | Ga0070675_100068773 | Ga0070675_1000687733 | 123 |
| 74 | 3300005354 | Ga0070675_100076834 | Ga0070675_1000768342 | 123 |
| 75 | 3300005354 | Ga0070675_100864535 | Ga0070675_1008645352 | 123 |
| 76 | 3300005364 | Ga0070673_100080279 | Ga0070673_1000802792 | 123 |
| 77 | 3300005364 | Ga0070673_101228295 | Ga0070673_1012282951 | 123 |
| 78 | 3300005365 | Ga0070688_100068523 | Ga0070688_1000685233 | 123 |
| 79 | 3300005436 | Ga0070713_100263420 | Ga0070713_1002634202 | 123 |
| 80 | 3300005438 | Ga0070701_10116492 | Ga0070701_101164922 | 123 |
| 81 | 3300005441 | Ga0070700_100011227 | Ga0070700_1000112275 | 123 |
| 82 | 3300005444 | Ga0070694_100249164 | Ga0070694_1002491642 | 123 |
| 83 | 3300005444 | Ga0070694_100465375 | Ga0070694_1004653752 | 123 |
| 84 | 3300005444 | Ga0070694_100720585 | Ga0070694_1007205852 | 123 |
| 85 | 3300005444 | Ga0070694_101066091 | Ga0070694_1010660911 | 123 |
| 86 | 3300005456 | Ga0070678_100849995 | Ga0070678_1008499952 | 123 |
| 87 | 3300005456 | Ga0070678_101783443 | Ga0070678_1017834431 | 123 |
| 88 | 3300005459 | Ga0068867_100374209 | Ga0068867_1003742092 | 123 |
| 89 | 3300005459 | Ga0068867_100924176 | Ga0068867_1009241761 | 123 |
| 90 | 3300005466 | Ga0070685_10157594 | Ga0070685_101575941 | 123 |
| 91 | 3300005467 | Ga0070706_101611832 | Ga0070706_1016118321 | 123 |
| 92 | 3300005518 | Ga0070699_101013213 | Ga0070699_1010132131 | 123 |
| 93 | 3300005518 | Ga0070699_101137734 | Ga0070699_1011377341 | 123 |
| 94 | 3300005518 | Ga0070699_101137985 | Ga0070699_1011379852 | 123 |
| 95 | 3300005545 | Ga0070695_100070307 | Ga0070695_1000703074 | 123 |
| 96 | 3300005545 | Ga0070695_100181814 | Ga0070695_1001818142 | 123 |
| 97 | 3300005546 | Ga0070696_100024257 | Ga0070696_1000242574 | 123 |
| 98 | 3300005548 | Ga0070665_100234347 | Ga0070665_1002343473 | 123 |
| 99 | 3300005549 | Ga0070704_100072293 | Ga0070704_1000722931 | 123 |
| 100 | 3300005549 | Ga0070704_100119653 | Ga0070704_1001196533 | 123 |
| 101 | 3300005564 | Ga0070664_100041802 | Ga0070664_1000418025 | 123 |
| 102 | 3300005577 | Ga0068857_100095229 | Ga0068857_1000952294 | 123 |
| 103 | 3300005578 | Ga0068854_100102137 | Ga0068854_1001021371 | 123 |
| 104 | 3300005615 | Ga0070702_100059499 | Ga0070702_1000594991 | 123 |
| 105 | 3300005719 | Ga0068861_100694813 | Ga0068861_1006948132 | 123 |
| 106 | 3300005842 | Ga0068858_100181267 | Ga0068858_1001812672 | 123 |
| 107 | 3300005843 | Ga0068860_100584866 | Ga0068860_1005848662 | 123 |
| 108 | 3300005844 | Ga0068862_101182107 | Ga0068862_1011821071 | 123 |
| 109 | 3300005985 | Ga0081539_10000993 | Ga0081539_1000099331 | 123 |
| 110 | 3300005985 | Ga0081539_10004888 | Ga0081539_100048884 | 123 |
| 111 | 3300006358 | Ga0068871_101296702 | Ga0068871_1012967021 | 123 |
| 112 | 3300006844 | Ga0075428_100001406 | Ga0075428_1000014065 | 123 |
| 113 | 3300006844 | Ga0075428_100065691 | Ga0075428_1000656912 | 123 |
| 114 | 3300006844 | Ga0075428_100171030 | Ga0075428_1001710302 | 123 |
| 115 | 3300006844 | Ga0075428_100608349 | Ga0075428_1006083492 | 123 |
| 116 | 3300006846 | Ga0075430_100006398 | Ga0075430_1000063983 | 123 |
| 117 | 3300006846 | Ga0075430_100069754 | Ga0075430_1000697542 | 123 |
| 118 | 3300006846 | Ga0075430_100130731 | Ga0075430_1001307312 | 123 |
| 119 | 3300006846 | Ga0075430_101284693 | Ga0075430_1012846931 | 123 |
| 120 | 3300006847 | Ga0075431_100007546 | Ga0075431_1000075462 | 123 |
| 121 | 3300006847 | Ga0075431_100068632 | Ga0075431_1000686322 | 123 |
| 122 | 3300006847 | Ga0075431_100112652 | Ga0075431_1001126522 | 123 |
| 123 | 3300006847 | Ga0075431_101388832 | Ga0075431_1013888321 | 123 |
| 124 | 3300006852 | Ga0075433_10017327 | Ga0075433_100173276 | 123 |
| 125 | 3300006871 | Ga0075434_100009269 | Ga0075434_1000092696 | 123 |
| 126 | 3300006871 | Ga0075434_100020643 | Ga0075434_1000206433 | 123 |
| 127 | 3300006871 | Ga0075434_100355126 | Ga0075434_1003551262 | 123 |
| 128 | 3300006880 | Ga0075429_100003580 | Ga0075429_1000035806 | 123 |
| 129 | 3300006880 | Ga0075429_100319179 | Ga0075429_1003191793 | 123 |
| 130 | 3300006880 | Ga0075429_100357369 | Ga0075429_1003573692 | 123 |
| 131 | 3300006880 | Ga0075429_101602938 | Ga0075429_1016029381 | 123 |
| 132 | 3300006914 | Ga0075436_100039400 | Ga0075436_1000394004 | 123 |
| 133 | 3300006914 | Ga0075436_100078259 | Ga0075436_1000782591 | 123 |
| 134 | 3300007076 | Ga0075435_100000304 | Ga0075435_10000030420 | 123 |
| 135 | 3300007076 | Ga0075435_100415285 | Ga0075435_1004152852 | 123 |
| 136 | 3300009093 | Ga0105240_10027385 | Ga0105240_100273855 | 123 |
| 137 | 3300009093 | Ga0105240_11670129 | Ga0105240_116701291 | 123 |
| 138 | 3300009094 | Ga0111539_10000322 | Ga0111539_1000032233 | 123 |
| 139 | 3300009094 | Ga0111539_10034744 | Ga0111539_100347442 | 123 |
| 140 | 3300009094 | Ga0111539_10121648 | Ga0111539_101216484 | 123 |
| 141 | 3300009094 | Ga0111539_12164599 | Ga0111539_121645992 | 123 |
| 142 | 3300009098 | Ga0105245_10051685 | Ga0105245_100516853 | 123 |
| 143 | 3300009098 | Ga0105245_11121475 | Ga0105245_111214752 | 123 |
| 144 | 3300009147 | Ga0114129_10000592 | Ga0114129_1000059216 | 123 |
| 145 | 3300009147 | Ga0114129_10003765 | Ga0114129_100037659 | 123 |
| 146 | 3300009147 | Ga0114129_10082032 | Ga0114129_100820324 | 123 |
| 147 | 3300009147 | Ga0114129_10286572 | Ga0114129_102865722 | 123 |
| 148 | 3300009147 | Ga0114129_10344055 | Ga0114129_103440554 | 123 |
| 149 | 3300009147 | Ga0114129_10732332 | Ga0114129_107323323 | 123 |
| 150 | 3300009147 | Ga0114129_12496561 | Ga0114129_124965612 | 123 |
| 151 | 3300009148 | Ga0105243_12591402 | Ga0105243_125914021 | 123 |
| 152 | 3300009177 | Ga0105248_10746979 | Ga0105248_107469791 | 123 |
| 153 | 3300009553 | Ga0105249_10366298 | Ga0105249_103662982 | 123 |
| 154 | 3300009553 | Ga0105249_10472953 | Ga0105249_104729532 | 123 |
| 155 | 3300009553 | Ga0105249_11930037 | Ga0105249_119300371 | 123 |
| 156 | 3300013105 | Ga0157369_11759031 | Ga0157369_117590311 | 123 |
| 157 | 3300013297 | Ga0157378_11270798 | Ga0157378_112707981 | 123 |
| 158 | 3300013306 | Ga0163162_10123506 | Ga0163162_101235063 | 123 |
| 159 | 3300013308 | Ga0157375_11246102 | Ga0157375_112461022 | 123 |
| 160 | 3300014325 | Ga0163163_10090402 | Ga0163163_100904021 | 123 |
| 161 | 3300014326 | Ga0157380_10097630 | Ga0157380_100976302 | 123 |
| 162 | 3300014326 | Ga0157380_10992252 | Ga0157380_109922522 | 123 |
| 163 | 3300014326 | Ga0157380_10992398 | Ga0157380_109923982 | 123 |
| 164 | 3300014745 | Ga0157377_10132681 | Ga0157377_101326812 | 123 |
| 165 | 3300014969 | Ga0157376_11437621 | Ga0157376_114376211 | 123 |
| 166 | 3300021388 | Ga0213875_10457575 | Ga0213875_104575751 | 123 |
| 167 | 3300025315 | Ga0207697_10288699 | Ga0207697_102886992 | 123 |
| 168 | 3300025910 | Ga0207684_10832035 | Ga0207684_108320351 | 123 |
| 169 | 3300025913 | Ga0207695_10041626 | Ga0207695_100416263 | 123 |
| 170 | 3300025918 | Ga0207662_10352820 | Ga0207662_103528201 | 123 |
| 171 | 3300025923 | Ga0207681_10020942 | Ga0207681_100209423 | 123 |
| 172 | 3300025923 | Ga0207681_10137848 | Ga0207681_101378481 | 123 |
| 173 | 3300025925 | Ga0207650_10524521 | Ga0207650_105245212 | 123 |
| 174 | 3300025926 | Ga0207659_10002098 | Ga0207659_100020982 | 123 |
| 175 | 3300025926 | Ga0207659_10004251 | Ga0207659_100042512 | 123 |
| 176 | 3300025926 | Ga0207659_10006483 | Ga0207659_100064835 | 123 |
| 177 | 3300025926 | Ga0207659_10364305 | Ga0207659_103643052 | 123 |
| 178 | 3300025926 | Ga0207659_10745195 | Ga0207659_107451952 | 123 |
| 179 | 3300025926 | Ga0207659_11349075 | Ga0207659_113490751 | 123 |
| 180 | 3300025927 | Ga0207687_10024221 | Ga0207687_100242216 | 123 |
| 181 | 3300025927 | Ga0207687_10601528 | Ga0207687_106015281 | 123 |
| 182 | 3300025928 | Ga0207700_11108974 | Ga0207700_111089742 | 123 |
| 183 | 3300025931 | Ga0207644_11874608 | Ga0207644_118746081 | 123 |
| 184 | 3300025933 | Ga0207706_10345832 | Ga0207706_103458322 | 123 |
| 185 | 3300025935 | Ga0207709_10089076 | Ga0207709_100890761 | 123 |
| 186 | 3300025936 | Ga0207670_10047043 | Ga0207670_100470431 | 123 |
| 187 | 3300025940 | Ga0207691_10394731 | Ga0207691_103947312 | 123 |
| 188 | 3300025942 | Ga0207689_10617127 | Ga0207689_106171272 | 123 |
| 189 | 3300025961 | Ga0207712_11079925 | Ga0207712_110799252 | 123 |
| 190 | 3300025972 | Ga0207668_10332709 | Ga0207668_103327092 | 123 |
| 191 | 3300025972 | Ga0207668_10886904 | Ga0207668_108869042 | 123 |
| 192 | 3300025981 | Ga0207640_10077503 | Ga0207640_100775034 | 123 |
| 193 | 3300026035 | Ga0207703_10421919 | Ga0207703_104219192 | 123 |
| 194 | 3300026075 | Ga0207708_10006354 | Ga0207708_100063544 | 123 |
| 195 | 3300026089 | Ga0207648_10043712 | Ga0207648_100437125 | 123 |
| 196 | 3300026116 | Ga0207674_10304137 | Ga0207674_103041372 | 123 |
| 197 | 3300027907 | Ga0207428_10001161 | Ga0207428_100011615 | 123 |
| 198 | 3300027907 | Ga0207428_10057371 | Ga0207428_100573712 | 123 |
| 199 | 3300028379 | Ga0268266_11009055 | Ga0268266_110090552 | 123 |
| 200 | 3300028380 | Ga0268265_11244776 | Ga0268265_112447761 | 123 |
| 201 | 3300030745 | Ga0316182_1371493 | Ga0316182_13714932 | 123 |
| 202 | 3300031548 | Ga0307408_100077177 | Ga0307408_1000771772 | 123 |
| 203 | 3300031548 | Ga0307408_100113197 | Ga0307408_1001131972 | 123 |
| 204 | 3300031548 | Ga0307408_100315529 | Ga0307408_1003155291 | 123 |
| 205 | 3300031548 | Ga0307408_100807357 | Ga0307408_1008073571 | 123 |
| 206 | 3300031548 | Ga0307408_100907595 | Ga0307408_1009075952 | 123 |
| 207 | 3300031731 | Ga0307405_10055254 | Ga0307405_100552543 | 123 |
| 208 | 3300031731 | Ga0307405_10449851 | Ga0307405_104498512 | 123 |
| 209 | 3300031824 | Ga0307413_10326983 | Ga0307413_103269832 | 123 |
| 210 | 3300031824 | Ga0307413_11442363 | Ga0307413_114423631 | 123 |
| 211 | 3300031852 | Ga0307410_10427859 | Ga0307410_104278592 | 123 |
| 212 | 3300031852 | Ga0307410_11133566 | Ga0307410_111335661 | 123 |
| 213 | 3300031901 | Ga0307406_10290582 | Ga0307406_102905822 | 123 |
| 214 | 3300031903 | Ga0307407_10524688 | Ga0307407_105246882 | 123 |
| 215 | 3300031903 | Ga0307407_10635861 | Ga0307407_106358611 | 123 |
| 216 | 3300031903 | Ga0307407_10987609 | Ga0307407_109876091 | 123 |
| 217 | 3300031911 | Ga0307412_10324146 | Ga0307412_103241463 | 123 |
| 218 | 3300031911 | Ga0307412_10582336 | Ga0307412_105823362 | 123 |
| 219 | 3300031911 | Ga0307412_10807213 | Ga0307412_108072132 | 123 |
| 220 | 3300031995 | Ga0307409_100200529 | Ga0307409_1002005291 | 123 |
| 221 | 3300031995 | Ga0307409_100606425 | Ga0307409_1006064252 | 123 |
| 222 | 3300032002 | Ga0307416_100272308 | Ga0307416_1002723083 | 123 |
| 223 | 3300032002 | Ga0307416_100626186 | Ga0307416_1006261861 | 123 |
| 224 | 3300032002 | Ga0307416_102311897 | Ga0307416_1023118971 | 123 |
| 225 | 3300032004 | Ga0307414_10681804 | Ga0307414_106818042 | 123 |
| 226 | 3300032005 | Ga0307411_10083288 | Ga0307411_100832882 | 123 |
| 227 | 3300032005 | Ga0307411_10383461 | Ga0307411_103834611 | 123 |
| 228 | 3300032005 | Ga0307411_11237377 | Ga0307411_112373771 | 123 |
| 229 | 3300032005 | Ga0307411_11814357 | Ga0307411_118143571 | 123 |
| 230 | 3300032126 | Ga0307415_100425921 | Ga0307415_1004259212 | 123 |
| 231 | 3300035171 | Ga0373946_0687809 | Ga0373946_0687809_94_477 | 123 |
| 232 | 3300037418 | Ga0395900_1783087 | Ga0395900_1783087_23_394 | 123 |
| 233 | 3300037853 | Ga0436364_0920232 | Ga0436364_0920232_27_398 | 123 |
| 234 | 3300042001 | Ga0439441_123882 | Ga0439441_123882_81_464 | 123 |
| 235 | 3300042122 | Ga0450920_011834 | Ga0450920_011834_536_907 | 123 |
| 236 | 3300042133 | Ga0450896_003598 | Ga0450896_003598_1044_1415 | 123 |
| 237 | 3300042134 | Ga0450898_024427 | Ga0450898_024427_645_1016 | 123 |
| 238 | 3300042145 | Ga0450906_087748 | Ga0450906_087748_148_519 | 123 |
| 239 | 3300042184 | Ga0450908_025753 | Ga0450908_025753_491_862 | 123 |
| 240 | 3300042436 | Ga0439435_0001814 | Ga0439435_0001814_2451_2822 | 123 |
| 241 | 3300042436 | Ga0439435_0303928 | Ga0439435_0303928_52_435 | 123 |
| 242 | 3300042461 | Ga0439460_0044200 | Ga0439460_0044200_145_540 | 123 |
| 243 | 3300042461 | Ga0439460_0243872 | Ga0439460_0243872_35_406 | 123 |
| 244 | 3300042531 | Ga0450918_034776 | Ga0450918_034776_491_862 | 123 |
| 245 | 3300042993 | Ga0439440_0116958 | Ga0439440_0116958_252_623 | 123 |
| 246 | 3300045976 | Ga0466967_1240409 | Ga0466967_1240409_302_673 | 123 |
| 247 | 3300046537 | Ga0495598_0072255 | Ga0495598_0072255_655_1026 | 123 |
| 248 | 3300046663 | Ga0495635_0720958 | Ga0495635_0720958_145_516 | 123 |
| 249 | 3300046689 | Ga0495613_0114334 | Ga0495613_0114334_1298_1669 | 123 |
| 250 | 3300046689 | Ga0495613_0229842 | Ga0495613_0229842_500_883 | 123 |
| 251 | 3300046809 | Ga0495600_0193852 | Ga0495600_0193852_311_682 | 123 |
| 252 | 3300047318 | Ga0495636_0123928 | Ga0495636_0123928_177_557 | 123 |
| 253 | 3300048913 | Ga0496110_0587932 | Ga0496110_0587932_449_820 | 123 |
| 254 | 3300048915 | Ga0496112_0060864 | Ga0496112_0060864_2509_2880 | 123 |
| 255 | 3300049514 | Ga0501291_030156 | Ga0501291_030156_400_771 | 123 |
| 256 | 3300049522 | Ga0501299_167664 | Ga0501299_167664_180_551 | 123 |
| 257 | 3300049522 | Ga0501299_198286 | Ga0501299_198286_51_422 | 123 |
| 258 | 3300049574 | Ga0501038_0937334 | Ga0501038_0937334_202_606 | 123 |
| 259 | 3300049576 | Ga0501040_0352379 | Ga0501040_0352379_413_787 | 123 |
| 260 | 3300049576 | Ga0501040_1070071 | Ga0501040_1070071_13_384 | 123 |
| 261 | 3300049577 | Ga0501041_0018754 | Ga0501041_0018754_2400_2822 | 123 |
| 262 | 3300049579 | Ga0501043_1134676 | Ga0501043_1134676_119_526 | 123 |
| 263 | 3300049584 | Ga0501068_0380740 | Ga0501068_0380740_328_711 | 123 |
| 264 | 3300049587 | Ga0501071_0129994 | Ga0501071_0129994_85_507 | 123 |
| 265 | 3300049588 | Ga0501072_0118827 | Ga0501072_0118827_1199_1621 | 123 |
| 266 | 3300049593 | Ga0501077_0624111 | Ga0501077_0624111_124_546 | 123 |
| 267 | 3300049653 | Ga0501206_067386 | Ga0501206_067386_199_570 | 123 |
| 268 | 3300049660 | Ga0501216_178924 | Ga0501216_178924_56_427 | 123 |
| 269 | 3300049665 | Ga0501227_197191 | Ga0501227_197191_37_408 | 123 |
| 270 | 3300049741 | Ga0501079_0557699 | Ga0501079_0557699_353_724 | 123 |
| 271 | 3300049765 | Ga0501268_159433 | Ga0501268_159433_70_441 | 123 |
| 272 | 3300049778 | Ga0501282_054303 | Ga0501282_054303_61_432 | 123 |
| 273 | 3300049824 | Ga0501045_0032359 | Ga0501045_0032359_1192_1614 | 123 |
| 274 | 3300050507 | nmdc:mga05p37_1012_c1 | nmdc:mga05p37_1012_c1_2833_3204 | 123 |
| 275 | 3300050507 | nmdc:mga05p37_114155_c1 | nmdc:mga05p37_114155_c1_1585_1956 | 123 |
| 276 | 3300050507 | nmdc:mga05p37_1396_c1 | nmdc:mga05p37_1396_c1_23750_24121 | 123 |
| 277 | 3300050507 | nmdc:mga05p37_211248_c1 | nmdc:mga05p37_211248_c1_1082_1477 | 123 |
| 278 | 3300050507 | nmdc:mga05p37_2921_c1 | nmdc:mga05p37_2921_c1_6611_6982 | 123 |
| 279 | 3300050507 | nmdc:mga05p37_90717_c1 | nmdc:mga05p37_90717_c1_209_580 | 123 |
| 280 | 3300050508 | nmdc:mga09592_181834_c1 | nmdc:mga09592_181834_c1_928_1299 | 123 |
| 281 | 3300050508 | nmdc:mga09592_3220_c1 | nmdc:mga09592_3220_c1_6736_7107 | 123 |
| 282 | 3300050508 | nmdc:mga09592_330295_c1 | nmdc:mga09592_330295_c1_222_611 | 123 |
| 283 | 3300050508 | nmdc:mga09592_993000_c1 | nmdc:mga09592_993000_c1_134_511 | 123 |
| 284 | 3300050509 | nmdc:mga0qj67_1019836_c1 | nmdc:mga0qj67_1019836_c1_34_426 | 123 |
| 285 | 3300050509 | nmdc:mga0qj67_1022500_c1 | nmdc:mga0qj67_1022500_c1_49_471 | 123 |
| 286 | 3300050509 | nmdc:mga0qj67_34517_c1 | nmdc:mga0qj67_34517_c1_3238_3609 | 123 |
| 287 | 3300050509 | nmdc:mga0qj67_6870_c1 | nmdc:mga0qj67_6870_c1_5517_5888 | 123 |
| 288 | 3300050509 | nmdc:mga0qj67_75817_c1 | nmdc:mga0qj67_75817_c1_1329_1700 | 123 |
| 289 | 3300050510 | nmdc:mga06r32_120865_c1 | nmdc:mga06r32_120865_c1_1686_2057 | 123 |
| 290 | 3300050510 | nmdc:mga06r32_145693_c1 | nmdc:mga06r32_145693_c1_556_927 | 123 |
| 291 | 3300050510 | nmdc:mga06r32_62045_c1 | nmdc:mga06r32_62045_c1_2790_3212 | 123 |
| 292 | 3300050510 | nmdc:mga06r32_988388_c1 | nmdc:mga06r32_988388_c1_218_589 | 123 |
| 293 | 3300050511 | nmdc:mga08y16_10210_c1 | nmdc:mga08y16_10210_c1_3973_4368 | 123 |
| 294 | 3300050511 | nmdc:mga08y16_1461798_c1 | nmdc:mga08y16_1461798_c1_253_624 | 123 |
| 295 | 3300050511 | nmdc:mga08y16_1661_c1 | nmdc:mga08y16_1661_c1_3011_3427 | 123 |
| 296 | 3300050511 | nmdc:mga08y16_1940204_c1 | nmdc:mga08y16_1940204_c1_129_512 | 123 |
| 297 | 3300050511 | nmdc:mga08y16_2109654_c1 | nmdc:mga08y16_2109654_c1_82_453 | 123 |
| 298 | 3300050511 | nmdc:mga08y16_741_c1 | nmdc:mga08y16_741_c1_4373_4744 | 123 |
| 299 | 3300050512 | nmdc:mga0n895_1161465_c1 | nmdc:mga0n895_1161465_c1_321_692 | 123 |
| 300 | 3300050512 | nmdc:mga0n895_2219854_c1 | nmdc:mga0n895_2219854_c1_83_466 | 123 |
| 301 | 3300050512 | nmdc:mga0n895_65928_c1 | nmdc:mga0n895_65928_c1_2692_3063 | 123 |
| 302 | 3300050512 | nmdc:mga0n895_76864_c1 | nmdc:mga0n895_76864_c1_1709_2080 | 123 |
| 303 | 3300050513 | nmdc:mga0rr50_20389_c1 | nmdc:mga0rr50_20389_c1_1215_1586 | 123 |
| 304 | 3300050513 | nmdc:mga0rr50_693028_c1 | nmdc:mga0rr50_693028_c1_305_676 | 123 |
| 305 | 3300050513 | nmdc:mga0rr50_699464_c1 | nmdc:mga0rr50_699464_c1_282_653 | 123 |
| 306 | 3300050513 | nmdc:mga0rr50_830620_c1 | nmdc:mga0rr50_830620_c1_149_541 | 123 |
| 307 | 3300050514 | nmdc:mga08x19_6293_c1 | nmdc:mga08x19_6293_c1_4817_5212 | 123 |
| 308 | 3300050514 | nmdc:mga08x19_69112_c1 | nmdc:mga08x19_69112_c1_351_722 | 123 |
| 309 | 3300050515 | nmdc:mga0a205_136147_c1 | nmdc:mga0a205_136147_c1_929_1300 | 123 |
| 310 | 3300050515 | nmdc:mga0a205_74166_c1 | nmdc:mga0a205_74166_c1_1803_2174 | 123 |
| 311 | 3300054114 | Ga0501084_0244660 | Ga0501084_0244660_919_1290 | 123 |
| 312 | 3300059421 | Ga0590071_074258 | Ga0590071_074258_189_572 | 123 |
| 313 | 3300059424 | Ga0590075_018685 | Ga0590075_018685_414_797 | 123 |
| 314 | 3300061734 | Ga0530510_0589756 | Ga0530510_0589756_262_633 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bt3-assembly1.cif.gz_B | crystal structure of a glyoxalase-related enzyme from clostridium phytofermentans | 0.8128 | 1 | 121 |
| 4g6x-assembly1.cif.gz_A-2 | crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. | 0.8105 | 1 | 120 |
| 1ecs-assembly1.cif.gz_B | the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5 | 0.8095 | 4 | 121 |
| 5cj3-assembly1.cif.gz_B | crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin | 0.8045 | 1 | 120 |
| 1xrk-assembly1.cif.gz_A | crystal structure of a mutant bleomycin binding protein from streptoalloteichus hindustanus displaying increased thermostability | 0.803 | 1 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9517 | 71 | 120 | 3.30.720.110 |
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9278 | 71 | 119 | 3.30.720.110 |
| 3bt3B02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9104 | 69 | 121 | 3.30.720.110 |
| 3sk1A02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8764 | 71 | 120 | 3.30.720.110 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8544 | 71 | 123 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q020R5-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 0.9887 | 1 | 121 |
GO:0051213
|
| AF-Q020R5-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 0.9728 | 1 | 121 |
GO:0051213
|
| AF-A0A1M6HF91-F1-model_v4 | Glyoxalase-like domain-containing protein | 0.9593 | 1 | 120 |
|
| AF-A0A6I4Z2R0-F1-model_v4 | Bleomycin resistance protein | 0.9533 | 1 | 123 |
GO:0046677
|
| AF-A0A537G6H6-F1-model_v4 | VOC domain-containing protein | 0.9492 | 71 | 123 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar