F402634

General Info

Members Datasets Scaffolds Average Seq Length
314 183 314 125

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_101284693|Ga0075430_1012846931
Length 140
Sequence MVSPSDTVMPRAMVGAMIRQIAPQFFTTDLPATLAYYRDTLGFECLGTWDDPPVYAIVARDNHRIHFRCADPPTPNPDKYADELLDAYLLIESADALYAEYAARGVEFTRALGDTPWHSREFVVKDCDGRLLAFGATRSS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
134 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
135 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
136 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
137 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
138 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
141 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
142 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
154 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
155 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
165 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
166 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
169 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.64
Rhizosphere 98.73
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001552 3300003203 Bacteria 10854
2 JGI25406J46586_10084203 3300003203 Bacteria 970
3 Ga0065715_10103785 3300005293 Bacteria 3009
4 Ga0070676_10028256 3300005328 Bacteria 3185
5 Ga0070670_100086028 3300005331 Unclassified 2701
6 Ga0070670_100300513 3300005331 Bacteria 1404
7 Ga0068869_100821628 3300005334 Bacteria 800
8 Ga0070680_100982536 3300005336 Unclassified 729
9 Ga0068868_100145272 3300005338 Bacteria 1950
10 Ga0068868_100312171 3300005338 Unclassified 1338
11 Ga0070689_100436171 3300005340 Unclassified 1112
12 Ga0070689_101996084 3300005340 Bacteria 530
13 Ga0070691_10092379 3300005341 Bacteria 1493
14 Ga0070687_100579421 3300005343 Unclassified 768
15 Ga0070687_101403514 3300005343 Unclassified 522
16 Ga0070661_100090813 3300005344 Bacteria 2262
17 Ga0070692_10406356 3300005345 Unclassified 861
18 Ga0070692_10550503 3300005345 Bacteria 756
19 Ga0070669_100175613 3300005353 Bacteria 1673
20 Ga0070675_100017494 3300005354 Bacteria 5696
21 Ga0070675_100068773 3300005354 Bacteria 2933
22 Ga0070675_100076834 3300005354 Bacteria 2778
23 Ga0070675_100864535 3300005354 Unclassified 828
24 Ga0070671_100087466 3300005355 Bacteria 2608
25 Ga0070673_100080279 3300005364 Bacteria 2643
26 Ga0070673_101228295 3300005364 Bacteria 703
27 Ga0070688_100068523 3300005365 Bacteria 2262
28 Ga0070713_100263420 3300005436 Bacteria 1576
29 Ga0070701_10116492 3300005438 Bacteria 1500
30 Ga0070700_100011227 3300005441 Bacteria 4959
31 Ga0070694_100249164 3300005444 Bacteria 1343
32 Ga0070694_100465375 3300005444 Unclassified 1001
33 Ga0070694_100720585 3300005444 Bacteria 812
34 Ga0070694_101066091 3300005444 Unclassified 673
35 Ga0070678_100849995 3300005456 Unclassified 831
36 Ga0070678_101783443 3300005456 Unclassified 580
37 Ga0068867_100374209 3300005459 Unclassified 1195
38 Ga0068867_100924176 3300005459 Bacteria 786
39 Ga0070685_10157594 3300005466 Unclassified 1444
40 Ga0070706_101611832 3300005467 Unclassified 592
41 Ga0070699_101013213 3300005518 Unclassified 761
42 Ga0070699_101137734 3300005518 Unclassified 716
43 Ga0070699_101137985 3300005518 Unclassified 716
44 Ga0070695_100070307 3300005545 Archaea 2289
45 Ga0070695_100181814 3300005545 Unclassified 1490
46 Ga0070696_100024257 3300005546 Bacteria 4121
47 Ga0070665_100022135 3300005548 Bacteria 6393
48 Ga0070665_100234347 3300005548 Bacteria 1836
49 Ga0070704_100072293 3300005549 Bacteria 2509
50 Ga0070704_100119653 3300005549 Bacteria 2020
51 Ga0070664_100041802 3300005564 Bacteria 3869
52 Ga0068857_100095229 3300005577 Bacteria 2667
53 Ga0068854_100102137 3300005578 Archaea 2151
54 Ga0070702_100059499 3300005615 Bacteria 2217
55 Ga0068861_100694813 3300005719 Unclassified 944
56 Ga0068870_10640731 3300005840 Bacteria 727
57 Ga0068858_100181267 3300005842 Bacteria 1989
58 Ga0068860_100584866 3300005843 Unclassified 1121
59 Ga0068862_101182107 3300005844 Bacteria 763
60 Ga0081539_10000993 3300005985 Bacteria 52701
61 Ga0081539_10004888 3300005985 Bacteria 14303
62 Ga0070717_10541238 3300006028 Bacteria 1054
63 Ga0097621_100066839 3300006237 Bacteria 2962
64 Ga0068871_101296702 3300006358 Unclassified 685
65 Ga0075428_100001406 3300006844 Bacteria 25623
66 Ga0075428_100065691 3300006844 Bacteria 3973
67 Ga0075428_100171030 3300006844 Unclassified 2355
68 Ga0075428_100608349 3300006844 Unclassified 1167
69 Ga0075430_100006398 3300006846 Bacteria 9930
70 Ga0075430_100069754 3300006846 Unclassified 2948
71 Ga0075430_100130731 3300006846 Bacteria 2092
72 Ga0075430_101284693 3300006846 Unclassified 602
73 Ga0075431_100007546 3300006847 Bacteria 10829
74 Ga0075431_100068632 3300006847 Bacteria 3658
75 Ga0075431_100112652 3300006847 Archaea 2807
76 Ga0075431_101388832 3300006847 Unclassified 662
77 Ga0075433_10017327 3300006852 Bacteria 5965
78 Ga0075434_100009269 3300006871 Bacteria 9174
79 Ga0075434_100020643 3300006871 Bacteria 6394
80 Ga0075434_100355126 3300006871 Unclassified 1487
81 Ga0075429_100003580 3300006880 Bacteria 13238
82 Ga0075429_100319179 3300006880 Unclassified 1360
83 Ga0075429_100357369 3300006880 Unclassified 1279
84 Ga0075429_101602938 3300006880 Archaea 566
85 Ga0075436_100039400 3300006914 Bacteria 3261
86 Ga0075436_100078259 3300006914 Bacteria 2291
87 Ga0075435_100000304 3300007076 Bacteria 30337
88 Ga0075435_100415285 3300007076 Bacteria 1158
89 Ga0105240_10000545 3300009093 Bacteria 69562
90 Ga0105240_10024540 3300009093 Bacteria 7946
91 Ga0105240_10027385 3300009093 Bacteria 7461
92 Ga0105240_11670129 3300009093 Unclassified 665
93 Ga0111539_10000322 3300009094 Bacteria 58508
94 Ga0111539_10034744 3300009094 Bacteria 6107
95 Ga0111539_10121648 3300009094 Bacteria 3058
96 Ga0111539_12164599 3300009094 Unclassified 645
97 Ga0105245_10051685 3300009098 Bacteria 3684
98 Ga0105245_10139930 3300009098 Unclassified 2278
99 Ga0105245_11121475 3300009098 Unclassified 833
100 Ga0114129_10000592 3300009147 Bacteria 44838
101 Ga0114129_10003765 3300009147 Bacteria 21379
102 Ga0114129_10082032 3300009147 Bacteria 4481
103 Ga0114129_10286572 3300009147 Unclassified 2199
104 Ga0114129_10344055 3300009147 Bacteria 1977
105 Ga0114129_10629582 3300009147 Bacteria 1387
106 Ga0114129_10732332 3300009147 Bacteria 1268
107 Ga0114129_12496561 3300009147 Unclassified 618
108 Ga0105243_12591402 3300009148 Unclassified 547
109 Ga0105241_10003311 3300009174 Bacteria 11985
110 Ga0105248_10000726 3300009177 Bacteria 37162
111 Ga0105248_10746979 3300009177 Bacteria 1104
112 Ga0105237_10542294 3300009545 Unclassified 1170
113 Ga0105238_10005856 3300009551 Bacteria 12176
114 Ga0105249_10366298 3300009553 Unclassified 1464
115 Ga0105249_10472953 3300009553 Bacteria 1295
116 Ga0105249_11014426 3300009553 Bacteria 899
117 Ga0105249_11930037 3300009553 Bacteria 663
118 Ga0105239_10011817 3300010375 Bacteria 9745
119 Ga0157369_11759031 3300013105 Unclassified 630
120 Ga0157369_12419036 3300013105 Bacteria 532
121 Ga0157374_10059769 3300013296 Bacteria 3565
122 Ga0157378_10109722 3300013297 Bacteria 2528
123 Ga0157378_10198905 3300013297 Bacteria 1895
124 Ga0157378_11270798 3300013297 Unclassified 777
125 Ga0163162_10123506 3300013306 Bacteria 2694
126 Ga0163162_10131402 3300013306 Bacteria 2612
127 Ga0157372_10207038 3300013307 Unclassified 2273
128 Ga0157372_10465981 3300013307 Bacteria 1473
129 Ga0157375_11246102 3300013308 Bacteria 873
130 Ga0157375_12191318 3300013308 Unclassified 658
131 Ga0163163_10090402 3300014325 Bacteria 3075
132 Ga0157380_10097630 3300014326 Bacteria 2439
133 Ga0157380_10992252 3300014326 Unclassified 873
134 Ga0157380_10992398 3300014326 Unclassified 872
135 Ga0157377_10132681 3300014745 Unclassified 1523
136 Ga0157376_10012514 3300014969 Bacteria 6299
137 Ga0157376_11437621 3300014969 Unclassified 722
138 Ga0213875_10457575 3300021388 Unclassified 611
139 Ga0207697_10288699 3300025315 Unclassified 727
140 Ga0207682_10339388 3300025893 Bacteria 707
141 Ga0207643_10452741 3300025908 Bacteria 817
142 Ga0207684_10832035 3300025910 Unclassified 779
143 Ga0207654_10049288 3300025911 Bacteria 2415
144 Ga0207695_10000329 3300025913 Bacteria 113344
145 Ga0207695_10041626 3300025913 Bacteria 4916
146 Ga0207695_10171344 3300025913 Bacteria 2096
147 Ga0207671_10346666 3300025914 Unclassified 1177
148 Ga0207662_10352820 3300025918 Bacteria 988
149 Ga0207681_10020942 3300025923 Bacteria 4150
150 Ga0207681_10137848 3300025923 Bacteria 1813
151 Ga0207694_10001631 3300025924 Bacteria 18864
152 Ga0207650_10524521 3300025925 Bacteria 991
153 Ga0207659_10002098 3300025926 Bacteria 11802
154 Ga0207659_10004251 3300025926 Bacteria 8657
155 Ga0207659_10006483 3300025926 Bacteria 7172
156 Ga0207659_10364305 3300025926 Viruses 1202
157 Ga0207659_10745195 3300025926 Unclassified 840
158 Ga0207659_11349075 3300025926 Bacteria 612
159 Ga0207687_10024221 3300025927 Bacteria 4052
160 Ga0207687_10601528 3300025927 Bacteria 927
161 Ga0207687_10605359 3300025927 Unclassified 924
162 Ga0207700_11108974 3300025928 Unclassified 707
163 Ga0207664_10033377 3300025929 Bacteria 3953
164 Ga0207644_10061674 3300025931 Bacteria 2717
165 Ga0207644_11874608 3300025931 Unclassified 501
166 Ga0207706_10345832 3300025933 Unclassified 1293
167 Ga0207709_10089076 3300025935 Bacteria 2011
168 Ga0207670_10047043 3300025936 Bacteria 2870
169 Ga0207670_10447062 3300025936 Unclassified 1041
170 Ga0207691_10394731 3300025940 Bacteria 1180
171 Ga0207711_10001971 3300025941 Bacteria 18618
172 Ga0207689_10617127 3300025942 Bacteria 913
173 Ga0207712_11079925 3300025961 Unclassified 714
174 Ga0207668_10332709 3300025972 Unclassified 1264
175 Ga0207668_10886904 3300025972 Viruses 793
176 Ga0207640_10077503 3300025981 Archaea 2260
177 Ga0207677_10348230 3300026023 Bacteria 1240
178 Ga0207703_10421919 3300026035 Unclassified 1241
179 Ga0207708_10006354 3300026075 Bacteria 8758
180 Ga0207648_10043712 3300026089 Bacteria 3933
181 Ga0207674_10304137 3300026116 Unclassified 1544
182 Ga0207683_11710794 3300026121 Unclassified 578
183 Ga0207428_10001161 3300027907 Bacteria 28406
184 Ga0207428_10057371 3300027907 Bacteria 3091
185 Ga0268266_10896606 3300028379 Unclassified 857
186 Ga0268266_11009055 3300028379 Bacteria 805
187 Ga0268265_11244776 3300028380 Unclassified 743
188 Ga0265338_10011137 3300028800 Bacteria 10426
189 Ga0265324_10058897 3300029957 Bacteria 1313
190 Ga0316182_1371493 3300030745 Unclassified 635
191 Ga0265328_10008227 3300031239 Bacteria 4312
192 Ga0265339_10012081 3300031249 Bacteria 5290
193 Ga0265327_10199791 3300031251 Bacteria 906
194 Ga0265316_10006255 3300031344 Bacteria 11410
195 Ga0307408_100077177 3300031548 Bacteria 2480
196 Ga0307408_100113197 3300031548 Bacteria 2088
197 Ga0307408_100315529 3300031548 Bacteria 1315
198 Ga0307408_100807357 3300031548 Bacteria 852
199 Ga0307408_100907595 3300031548 Unclassified 807
200 Ga0265314_10010971 3300031711 Bacteria 7519
201 Ga0307405_10055254 3300031731 Bacteria 2484
202 Ga0307405_10449851 3300031731 Unclassified 1021
203 Ga0307413_10326983 3300031824 Unclassified 1174
204 Ga0307413_11442363 3300031824 Unclassified 607
205 Ga0307410_10427859 3300031852 Unclassified 1075
206 Ga0307410_11133566 3300031852 Unclassified 679
207 Ga0307406_10290582 3300031901 Bacteria 1251
208 Ga0307407_10524688 3300031903 Bacteria 872
209 Ga0307407_10635861 3300031903 Bacteria 798
210 Ga0307407_10987609 3300031903 Unclassified 650
211 Ga0307412_10324146 3300031911 Bacteria 1227
212 Ga0307412_10582336 3300031911 Unclassified 945
213 Ga0307412_10807213 3300031911 Unclassified 815
214 Ga0307409_100200529 3300031995 Bacteria 1785
215 Ga0307409_100606425 3300031995 Bacteria 1082
216 Ga0307416_100272308 3300032002 Bacteria 1663
217 Ga0307416_100626186 3300032002 Bacteria 1158
218 Ga0307416_102311897 3300032002 Unclassified 638
219 Ga0307414_10681804 3300032004 Unclassified 929
220 Ga0307411_10083288 3300032005 Bacteria 2209
221 Ga0307411_10383461 3300032005 Bacteria 1157
222 Ga0307411_11237377 3300032005 Unclassified 678
223 Ga0307411_11814357 3300032005 Unclassified 566
224 Ga0307415_100425921 3300032126 Bacteria 1140
225 Ga0373946_0687809 3300035171 Bacteria 534
226 Ga0373933_0627577 3300035724 Unclassified 706
227 Ga0395900_1783087 3300037418 Unclassified 526
228 Ga0436364_0920232 3300037853 Unclassified 607
229 Ga0436360_0177441 3300039438 Unclassified 845
230 Ga0439441_123882 3300042001 Unclassified 595
231 Ga0450920_011834 3300042122 Unclassified 1630
232 Ga0450896_003598 3300042133 Unclassified 2066
233 Ga0450898_024427 3300042134 Unclassified 1080
234 Ga0450906_087748 3300042145 Unclassified 563
235 Ga0450908_025753 3300042184 Unclassified 1027
236 Ga0439435_0001814 3300042436 Bacteria 4073
237 Ga0439435_0303928 3300042436 Unclassified 547
238 Ga0439460_0044200 3300042461 Unclassified 1318
239 Ga0439460_0243872 3300042461 Unclassified 620
240 Ga0450918_034776 3300042531 Unclassified 895
241 Ga0439440_0116958 3300042993 Bacteria 739
242 Ga0466967_1240409 3300045976 Bacteria 743
243 Ga0495629_0076615 3300046459 Bacteria 2335
244 Ga0495598_0072255 3300046537 Bacteria 1089
245 Ga0495635_0720958 3300046663 Unclassified 646
246 Ga0495613_0114334 3300046689 Bacteria 1943
247 Ga0495613_0229842 3300046689 Bacteria 1300
248 Ga0495600_0193852 3300046809 Bacteria 1306
249 Ga0495636_0123928 3300047318 Unclassified 1145
250 Ga0495675_0070175 3300047444 Bacteria 2212
251 Ga0496110_0587932 3300048913 Bacteria 1010
252 Ga0496112_0060864 3300048915 Bacteria 3721
253 Ga0501291_030156 3300049514 Bacteria 911
254 Ga0501298_084160 3300049521 Bacteria 704
255 Ga0501299_167664 3300049522 Unclassified 565
256 Ga0501299_198286 3300049522 Unclassified 532
257 Ga0501038_0937334 3300049574 Unclassified 638
258 Ga0501040_0352379 3300049576 Unclassified 1055
259 Ga0501040_1070071 3300049576 Bacteria 585
260 Ga0501041_0018754 3300049577 Bacteria 4121
261 Ga0501043_1134676 3300049579 Bacteria 551
262 Ga0501068_0380740 3300049584 Bacteria 909
263 Ga0501071_0129994 3300049587 Bacteria 1870
264 Ga0501072_0118827 3300049588 Bacteria 2106
265 Ga0501077_0624111 3300049593 Bacteria 693
266 Ga0501206_067386 3300049653 Unclassified 599
267 Ga0501216_178924 3300049660 Unclassified 516
268 Ga0501227_197191 3300049665 Unclassified 569
269 Ga0501079_0557699 3300049741 Bacteria 901
270 Ga0501268_159433 3300049765 Unclassified 526
271 Ga0501282_054303 3300049778 Unclassified 501
272 Ga0501045_0032359 3300049824 Bacteria 3790
273 nmdc:mga05p37_1012_c1 3300050507 Bacteria 31983
274 nmdc:mga05p37_114155_c1 3300050507 Bacteria 3320
275 nmdc:mga05p37_1396_c1 3300050507 Bacteria 28112
276 nmdc:mga05p37_211248_c1 3300050507 Unclassified 2346
277 nmdc:mga05p37_2921_c1 3300050507 Bacteria 19832
278 nmdc:mga05p37_656737_c1 3300050507 Unclassified 1173
279 nmdc:mga05p37_90717_c1 3300050507 Bacteria 3766
280 nmdc:mga09592_181834_c1 3300050508 Bacteria 1819
281 nmdc:mga09592_3220_c1 3300050508 Bacteria 13220
282 nmdc:mga09592_330295_c1 3300050508 Unclassified 1320
283 nmdc:mga09592_993000_c1 3300050508 Bacteria 702
284 nmdc:mga0qj67_1019836_c1 3300050509 Unclassified 649
285 nmdc:mga0qj67_1022500_c1 3300050509 Unclassified 648
286 nmdc:mga0qj67_34517_c1 3300050509 Bacteria 3952
287 nmdc:mga0qj67_6870_c1 3300050509 Bacteria 8370
288 nmdc:mga0qj67_75817_c1 3300050509 Unclassified 2689
289 nmdc:mga06r32_120865_c1 3300050510 Bacteria 2584
290 nmdc:mga06r32_145693_c1 3300050510 Bacteria 2346
291 nmdc:mga06r32_62045_c1 3300050510 Bacteria 3600
292 nmdc:mga06r32_988388_c1 3300050510 Unclassified 795
293 nmdc:mga08y16_10210_c1 3300050511 Bacteria 9858
294 nmdc:mga08y16_1461798_c1 3300050511 Unclassified 645
295 nmdc:mga08y16_1661_c1 3300050511 Bacteria 22561
296 nmdc:mga08y16_1940204_c1 3300050511 Bacteria 539
297 nmdc:mga08y16_2109654_c1 3300050511 Unclassified 511
298 nmdc:mga08y16_741_c1 3300050511 Bacteria 31071
299 nmdc:mga0n895_1161465_c1 3300050512 Unclassified 747
300 nmdc:mga0n895_2219854_c1 3300050512 Unclassified 504
301 nmdc:mga0n895_65928_c1 3300050512 Bacteria 3585
302 nmdc:mga0n895_76864_c1 3300050512 Bacteria 3320
303 nmdc:mga0rr50_20389_c1 3300050513 Bacteria 4501
304 nmdc:mga0rr50_693028_c1 3300050513 Unclassified 869
305 nmdc:mga0rr50_699464_c1 3300050513 Bacteria 865
306 nmdc:mga0rr50_830620_c1 3300050513 Unclassified 788
307 nmdc:mga08x19_6293_c1 3300050514 Bacteria 7028
308 nmdc:mga08x19_69112_c1 3300050514 Bacteria 2300
309 nmdc:mga0a205_136147_c1 3300050515 Unclassified 2357
310 nmdc:mga0a205_74166_c1 3300050515 Bacteria 3288
311 Ga0501084_0244660 3300054114 Bacteria 1514
312 Ga0590071_074258 3300059421 Unclassified 840
313 Ga0590075_018685 3300059424 Unclassified 1716
314 Ga0530510_0589756 3300061734 Unclassified 845

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10629582 Ga0114129_106295822 105
2 3300050507 nmdc:mga05p37_656737_c1 nmdc:mga05p37_656737_c1_709_1056 105
3 3300049521 Ga0501298_084160 Ga0501298_084160_206_562 118
4 3300006028 Ga0070717_10541238 Ga0070717_105412382 120
5 3300005338 Ga0068868_100145272 Ga0068868_1001452721 121
6 3300005355 Ga0070671_100087466 Ga0070671_1000874662 121
7 3300006237 Ga0097621_100066839 Ga0097621_1000668394 121
8 3300009098 Ga0105245_10139930 Ga0105245_101399303 121
9 3300009174 Ga0105241_10003311 Ga0105241_1000331111 121
10 3300009177 Ga0105248_10000726 Ga0105248_1000072623 121
11 3300009545 Ga0105237_10542294 Ga0105237_105422942 121
12 3300010375 Ga0105239_10011817 Ga0105239_100118176 121
13 3300013296 Ga0157374_10059769 Ga0157374_100597694 121
14 3300013297 Ga0157378_10109722 Ga0157378_101097222 121
15 3300013307 Ga0157372_10465981 Ga0157372_104659812 121
16 3300013308 Ga0157375_12191318 Ga0157375_121913182 121
17 3300014969 Ga0157376_10012514 Ga0157376_100125143 121
18 3300025893 Ga0207682_10339388 Ga0207682_103393881 121
19 3300025911 Ga0207654_10049288 Ga0207654_100492885 121
20 3300025913 Ga0207695_10000329 Ga0207695_1000032954 121
21 3300025931 Ga0207644_10061674 Ga0207644_100616742 121
22 3300025941 Ga0207711_10001971 Ga0207711_1000197110 121
23 3300026023 Ga0207677_10348230 Ga0207677_103482302 121
24 3300028800 Ga0265338_10011137 Ga0265338_100111372 121
25 3300029957 Ga0265324_10058897 Ga0265324_100588972 121
26 3300031239 Ga0265328_10008227 Ga0265328_100082274 121
27 3300031249 Ga0265339_10012081 Ga0265339_100120812 121
28 3300031251 Ga0265327_10199791 Ga0265327_101997912 121
29 3300031344 Ga0265316_10006255 Ga0265316_100062559 121
30 3300031711 Ga0265314_10010971 Ga0265314_100109717 121
31 3300005336 Ga0070680_100982536 Ga0070680_1009825361 122
32 3300005344 Ga0070661_100090813 Ga0070661_1000908131 122
33 3300005548 Ga0070665_100022135 Ga0070665_1000221352 122
34 3300005840 Ga0068870_10640731 Ga0068870_106407312 122
35 3300009093 Ga0105240_10000545 Ga0105240_100005456 122
36 3300009093 Ga0105240_10024540 Ga0105240_100245409 122
37 3300009551 Ga0105238_10005856 Ga0105238_100058564 122
38 3300009553 Ga0105249_11014426 Ga0105249_110144262 122
39 3300013105 Ga0157369_12419036 Ga0157369_124190361 122
40 3300013297 Ga0157378_10198905 Ga0157378_101989052 122
41 3300013306 Ga0163162_10131402 Ga0163162_101314022 122
42 3300013307 Ga0157372_10207038 Ga0157372_102070384 122
43 3300025908 Ga0207643_10452741 Ga0207643_104527412 122
44 3300025913 Ga0207695_10171344 Ga0207695_101713441 122
45 3300025914 Ga0207671_10346666 Ga0207671_103466662 122
46 3300025924 Ga0207694_10001631 Ga0207694_100016311 122
47 3300025927 Ga0207687_10605359 Ga0207687_106053591 122
48 3300025929 Ga0207664_10033377 Ga0207664_100333773 122
49 3300025936 Ga0207670_10447062 Ga0207670_104470622 122
50 3300026121 Ga0207683_11710794 Ga0207683_117107941 122
51 3300028379 Ga0268266_10896606 Ga0268266_108966062 122
52 3300035724 Ga0373933_0627577 Ga0373933_0627577_198_566 122
53 3300039438 Ga0436360_0177441 Ga0436360_0177441_415_783 122
54 3300046459 Ga0495629_0076615 Ga0495629_0076615_1907_2281 122
55 3300047444 Ga0495675_0070175 Ga0495675_0070175_765_1133 122
56 3300003203 JGI25406J46586_10001552 JGI25406J46586_100015522 123
57 3300003203 JGI25406J46586_10084203 JGI25406J46586_100842032 123
58 3300005293 Ga0065715_10103785 Ga0065715_101037856 123
59 3300005328 Ga0070676_10028256 Ga0070676_100282563 123
60 3300005331 Ga0070670_100086028 Ga0070670_1000860283 123
61 3300005331 Ga0070670_100300513 Ga0070670_1003005132 123
62 3300005334 Ga0068869_100821628 Ga0068869_1008216282 123
63 3300005338 Ga0068868_100312171 Ga0068868_1003121712 123
64 3300005340 Ga0070689_100436171 Ga0070689_1004361712 123
65 3300005340 Ga0070689_101996084 Ga0070689_1019960841 123
66 3300005341 Ga0070691_10092379 Ga0070691_100923791 123
67 3300005343 Ga0070687_100579421 Ga0070687_1005794212 123
68 3300005343 Ga0070687_101403514 Ga0070687_1014035141 123
69 3300005345 Ga0070692_10406356 Ga0070692_104063561 123
70 3300005345 Ga0070692_10550503 Ga0070692_105505032 123
71 3300005353 Ga0070669_100175613 Ga0070669_1001756131 123
72 3300005354 Ga0070675_100017494 Ga0070675_1000174942 123
73 3300005354 Ga0070675_100068773 Ga0070675_1000687733 123
74 3300005354 Ga0070675_100076834 Ga0070675_1000768342 123
75 3300005354 Ga0070675_100864535 Ga0070675_1008645352 123
76 3300005364 Ga0070673_100080279 Ga0070673_1000802792 123
77 3300005364 Ga0070673_101228295 Ga0070673_1012282951 123
78 3300005365 Ga0070688_100068523 Ga0070688_1000685233 123
79 3300005436 Ga0070713_100263420 Ga0070713_1002634202 123
80 3300005438 Ga0070701_10116492 Ga0070701_101164922 123
81 3300005441 Ga0070700_100011227 Ga0070700_1000112275 123
82 3300005444 Ga0070694_100249164 Ga0070694_1002491642 123
83 3300005444 Ga0070694_100465375 Ga0070694_1004653752 123
84 3300005444 Ga0070694_100720585 Ga0070694_1007205852 123
85 3300005444 Ga0070694_101066091 Ga0070694_1010660911 123
86 3300005456 Ga0070678_100849995 Ga0070678_1008499952 123
87 3300005456 Ga0070678_101783443 Ga0070678_1017834431 123
88 3300005459 Ga0068867_100374209 Ga0068867_1003742092 123
89 3300005459 Ga0068867_100924176 Ga0068867_1009241761 123
90 3300005466 Ga0070685_10157594 Ga0070685_101575941 123
91 3300005467 Ga0070706_101611832 Ga0070706_1016118321 123
92 3300005518 Ga0070699_101013213 Ga0070699_1010132131 123
93 3300005518 Ga0070699_101137734 Ga0070699_1011377341 123
94 3300005518 Ga0070699_101137985 Ga0070699_1011379852 123
95 3300005545 Ga0070695_100070307 Ga0070695_1000703074 123
96 3300005545 Ga0070695_100181814 Ga0070695_1001818142 123
97 3300005546 Ga0070696_100024257 Ga0070696_1000242574 123
98 3300005548 Ga0070665_100234347 Ga0070665_1002343473 123
99 3300005549 Ga0070704_100072293 Ga0070704_1000722931 123
100 3300005549 Ga0070704_100119653 Ga0070704_1001196533 123
101 3300005564 Ga0070664_100041802 Ga0070664_1000418025 123
102 3300005577 Ga0068857_100095229 Ga0068857_1000952294 123
103 3300005578 Ga0068854_100102137 Ga0068854_1001021371 123
104 3300005615 Ga0070702_100059499 Ga0070702_1000594991 123
105 3300005719 Ga0068861_100694813 Ga0068861_1006948132 123
106 3300005842 Ga0068858_100181267 Ga0068858_1001812672 123
107 3300005843 Ga0068860_100584866 Ga0068860_1005848662 123
108 3300005844 Ga0068862_101182107 Ga0068862_1011821071 123
109 3300005985 Ga0081539_10000993 Ga0081539_1000099331 123
110 3300005985 Ga0081539_10004888 Ga0081539_100048884 123
111 3300006358 Ga0068871_101296702 Ga0068871_1012967021 123
112 3300006844 Ga0075428_100001406 Ga0075428_1000014065 123
113 3300006844 Ga0075428_100065691 Ga0075428_1000656912 123
114 3300006844 Ga0075428_100171030 Ga0075428_1001710302 123
115 3300006844 Ga0075428_100608349 Ga0075428_1006083492 123
116 3300006846 Ga0075430_100006398 Ga0075430_1000063983 123
117 3300006846 Ga0075430_100069754 Ga0075430_1000697542 123
118 3300006846 Ga0075430_100130731 Ga0075430_1001307312 123
119 3300006846 Ga0075430_101284693 Ga0075430_1012846931 123
120 3300006847 Ga0075431_100007546 Ga0075431_1000075462 123
121 3300006847 Ga0075431_100068632 Ga0075431_1000686322 123
122 3300006847 Ga0075431_100112652 Ga0075431_1001126522 123
123 3300006847 Ga0075431_101388832 Ga0075431_1013888321 123
124 3300006852 Ga0075433_10017327 Ga0075433_100173276 123
125 3300006871 Ga0075434_100009269 Ga0075434_1000092696 123
126 3300006871 Ga0075434_100020643 Ga0075434_1000206433 123
127 3300006871 Ga0075434_100355126 Ga0075434_1003551262 123
128 3300006880 Ga0075429_100003580 Ga0075429_1000035806 123
129 3300006880 Ga0075429_100319179 Ga0075429_1003191793 123
130 3300006880 Ga0075429_100357369 Ga0075429_1003573692 123
131 3300006880 Ga0075429_101602938 Ga0075429_1016029381 123
132 3300006914 Ga0075436_100039400 Ga0075436_1000394004 123
133 3300006914 Ga0075436_100078259 Ga0075436_1000782591 123
134 3300007076 Ga0075435_100000304 Ga0075435_10000030420 123
135 3300007076 Ga0075435_100415285 Ga0075435_1004152852 123
136 3300009093 Ga0105240_10027385 Ga0105240_100273855 123
137 3300009093 Ga0105240_11670129 Ga0105240_116701291 123
138 3300009094 Ga0111539_10000322 Ga0111539_1000032233 123
139 3300009094 Ga0111539_10034744 Ga0111539_100347442 123
140 3300009094 Ga0111539_10121648 Ga0111539_101216484 123
141 3300009094 Ga0111539_12164599 Ga0111539_121645992 123
142 3300009098 Ga0105245_10051685 Ga0105245_100516853 123
143 3300009098 Ga0105245_11121475 Ga0105245_111214752 123
144 3300009147 Ga0114129_10000592 Ga0114129_1000059216 123
145 3300009147 Ga0114129_10003765 Ga0114129_100037659 123
146 3300009147 Ga0114129_10082032 Ga0114129_100820324 123
147 3300009147 Ga0114129_10286572 Ga0114129_102865722 123
148 3300009147 Ga0114129_10344055 Ga0114129_103440554 123
149 3300009147 Ga0114129_10732332 Ga0114129_107323323 123
150 3300009147 Ga0114129_12496561 Ga0114129_124965612 123
151 3300009148 Ga0105243_12591402 Ga0105243_125914021 123
152 3300009177 Ga0105248_10746979 Ga0105248_107469791 123
153 3300009553 Ga0105249_10366298 Ga0105249_103662982 123
154 3300009553 Ga0105249_10472953 Ga0105249_104729532 123
155 3300009553 Ga0105249_11930037 Ga0105249_119300371 123
156 3300013105 Ga0157369_11759031 Ga0157369_117590311 123
157 3300013297 Ga0157378_11270798 Ga0157378_112707981 123
158 3300013306 Ga0163162_10123506 Ga0163162_101235063 123
159 3300013308 Ga0157375_11246102 Ga0157375_112461022 123
160 3300014325 Ga0163163_10090402 Ga0163163_100904021 123
161 3300014326 Ga0157380_10097630 Ga0157380_100976302 123
162 3300014326 Ga0157380_10992252 Ga0157380_109922522 123
163 3300014326 Ga0157380_10992398 Ga0157380_109923982 123
164 3300014745 Ga0157377_10132681 Ga0157377_101326812 123
165 3300014969 Ga0157376_11437621 Ga0157376_114376211 123
166 3300021388 Ga0213875_10457575 Ga0213875_104575751 123
167 3300025315 Ga0207697_10288699 Ga0207697_102886992 123
168 3300025910 Ga0207684_10832035 Ga0207684_108320351 123
169 3300025913 Ga0207695_10041626 Ga0207695_100416263 123
170 3300025918 Ga0207662_10352820 Ga0207662_103528201 123
171 3300025923 Ga0207681_10020942 Ga0207681_100209423 123
172 3300025923 Ga0207681_10137848 Ga0207681_101378481 123
173 3300025925 Ga0207650_10524521 Ga0207650_105245212 123
174 3300025926 Ga0207659_10002098 Ga0207659_100020982 123
175 3300025926 Ga0207659_10004251 Ga0207659_100042512 123
176 3300025926 Ga0207659_10006483 Ga0207659_100064835 123
177 3300025926 Ga0207659_10364305 Ga0207659_103643052 123
178 3300025926 Ga0207659_10745195 Ga0207659_107451952 123
179 3300025926 Ga0207659_11349075 Ga0207659_113490751 123
180 3300025927 Ga0207687_10024221 Ga0207687_100242216 123
181 3300025927 Ga0207687_10601528 Ga0207687_106015281 123
182 3300025928 Ga0207700_11108974 Ga0207700_111089742 123
183 3300025931 Ga0207644_11874608 Ga0207644_118746081 123
184 3300025933 Ga0207706_10345832 Ga0207706_103458322 123
185 3300025935 Ga0207709_10089076 Ga0207709_100890761 123
186 3300025936 Ga0207670_10047043 Ga0207670_100470431 123
187 3300025940 Ga0207691_10394731 Ga0207691_103947312 123
188 3300025942 Ga0207689_10617127 Ga0207689_106171272 123
189 3300025961 Ga0207712_11079925 Ga0207712_110799252 123
190 3300025972 Ga0207668_10332709 Ga0207668_103327092 123
191 3300025972 Ga0207668_10886904 Ga0207668_108869042 123
192 3300025981 Ga0207640_10077503 Ga0207640_100775034 123
193 3300026035 Ga0207703_10421919 Ga0207703_104219192 123
194 3300026075 Ga0207708_10006354 Ga0207708_100063544 123
195 3300026089 Ga0207648_10043712 Ga0207648_100437125 123
196 3300026116 Ga0207674_10304137 Ga0207674_103041372 123
197 3300027907 Ga0207428_10001161 Ga0207428_100011615 123
198 3300027907 Ga0207428_10057371 Ga0207428_100573712 123
199 3300028379 Ga0268266_11009055 Ga0268266_110090552 123
200 3300028380 Ga0268265_11244776 Ga0268265_112447761 123
201 3300030745 Ga0316182_1371493 Ga0316182_13714932 123
202 3300031548 Ga0307408_100077177 Ga0307408_1000771772 123
203 3300031548 Ga0307408_100113197 Ga0307408_1001131972 123
204 3300031548 Ga0307408_100315529 Ga0307408_1003155291 123
205 3300031548 Ga0307408_100807357 Ga0307408_1008073571 123
206 3300031548 Ga0307408_100907595 Ga0307408_1009075952 123
207 3300031731 Ga0307405_10055254 Ga0307405_100552543 123
208 3300031731 Ga0307405_10449851 Ga0307405_104498512 123
209 3300031824 Ga0307413_10326983 Ga0307413_103269832 123
210 3300031824 Ga0307413_11442363 Ga0307413_114423631 123
211 3300031852 Ga0307410_10427859 Ga0307410_104278592 123
212 3300031852 Ga0307410_11133566 Ga0307410_111335661 123
213 3300031901 Ga0307406_10290582 Ga0307406_102905822 123
214 3300031903 Ga0307407_10524688 Ga0307407_105246882 123
215 3300031903 Ga0307407_10635861 Ga0307407_106358611 123
216 3300031903 Ga0307407_10987609 Ga0307407_109876091 123
217 3300031911 Ga0307412_10324146 Ga0307412_103241463 123
218 3300031911 Ga0307412_10582336 Ga0307412_105823362 123
219 3300031911 Ga0307412_10807213 Ga0307412_108072132 123
220 3300031995 Ga0307409_100200529 Ga0307409_1002005291 123
221 3300031995 Ga0307409_100606425 Ga0307409_1006064252 123
222 3300032002 Ga0307416_100272308 Ga0307416_1002723083 123
223 3300032002 Ga0307416_100626186 Ga0307416_1006261861 123
224 3300032002 Ga0307416_102311897 Ga0307416_1023118971 123
225 3300032004 Ga0307414_10681804 Ga0307414_106818042 123
226 3300032005 Ga0307411_10083288 Ga0307411_100832882 123
227 3300032005 Ga0307411_10383461 Ga0307411_103834611 123
228 3300032005 Ga0307411_11237377 Ga0307411_112373771 123
229 3300032005 Ga0307411_11814357 Ga0307411_118143571 123
230 3300032126 Ga0307415_100425921 Ga0307415_1004259212 123
231 3300035171 Ga0373946_0687809 Ga0373946_0687809_94_477 123
232 3300037418 Ga0395900_1783087 Ga0395900_1783087_23_394 123
233 3300037853 Ga0436364_0920232 Ga0436364_0920232_27_398 123
234 3300042001 Ga0439441_123882 Ga0439441_123882_81_464 123
235 3300042122 Ga0450920_011834 Ga0450920_011834_536_907 123
236 3300042133 Ga0450896_003598 Ga0450896_003598_1044_1415 123
237 3300042134 Ga0450898_024427 Ga0450898_024427_645_1016 123
238 3300042145 Ga0450906_087748 Ga0450906_087748_148_519 123
239 3300042184 Ga0450908_025753 Ga0450908_025753_491_862 123
240 3300042436 Ga0439435_0001814 Ga0439435_0001814_2451_2822 123
241 3300042436 Ga0439435_0303928 Ga0439435_0303928_52_435 123
242 3300042461 Ga0439460_0044200 Ga0439460_0044200_145_540 123
243 3300042461 Ga0439460_0243872 Ga0439460_0243872_35_406 123
244 3300042531 Ga0450918_034776 Ga0450918_034776_491_862 123
245 3300042993 Ga0439440_0116958 Ga0439440_0116958_252_623 123
246 3300045976 Ga0466967_1240409 Ga0466967_1240409_302_673 123
247 3300046537 Ga0495598_0072255 Ga0495598_0072255_655_1026 123
248 3300046663 Ga0495635_0720958 Ga0495635_0720958_145_516 123
249 3300046689 Ga0495613_0114334 Ga0495613_0114334_1298_1669 123
250 3300046689 Ga0495613_0229842 Ga0495613_0229842_500_883 123
251 3300046809 Ga0495600_0193852 Ga0495600_0193852_311_682 123
252 3300047318 Ga0495636_0123928 Ga0495636_0123928_177_557 123
253 3300048913 Ga0496110_0587932 Ga0496110_0587932_449_820 123
254 3300048915 Ga0496112_0060864 Ga0496112_0060864_2509_2880 123
255 3300049514 Ga0501291_030156 Ga0501291_030156_400_771 123
256 3300049522 Ga0501299_167664 Ga0501299_167664_180_551 123
257 3300049522 Ga0501299_198286 Ga0501299_198286_51_422 123
258 3300049574 Ga0501038_0937334 Ga0501038_0937334_202_606 123
259 3300049576 Ga0501040_0352379 Ga0501040_0352379_413_787 123
260 3300049576 Ga0501040_1070071 Ga0501040_1070071_13_384 123
261 3300049577 Ga0501041_0018754 Ga0501041_0018754_2400_2822 123
262 3300049579 Ga0501043_1134676 Ga0501043_1134676_119_526 123
263 3300049584 Ga0501068_0380740 Ga0501068_0380740_328_711 123
264 3300049587 Ga0501071_0129994 Ga0501071_0129994_85_507 123
265 3300049588 Ga0501072_0118827 Ga0501072_0118827_1199_1621 123
266 3300049593 Ga0501077_0624111 Ga0501077_0624111_124_546 123
267 3300049653 Ga0501206_067386 Ga0501206_067386_199_570 123
268 3300049660 Ga0501216_178924 Ga0501216_178924_56_427 123
269 3300049665 Ga0501227_197191 Ga0501227_197191_37_408 123
270 3300049741 Ga0501079_0557699 Ga0501079_0557699_353_724 123
271 3300049765 Ga0501268_159433 Ga0501268_159433_70_441 123
272 3300049778 Ga0501282_054303 Ga0501282_054303_61_432 123
273 3300049824 Ga0501045_0032359 Ga0501045_0032359_1192_1614 123
274 3300050507 nmdc:mga05p37_1012_c1 nmdc:mga05p37_1012_c1_2833_3204 123
275 3300050507 nmdc:mga05p37_114155_c1 nmdc:mga05p37_114155_c1_1585_1956 123
276 3300050507 nmdc:mga05p37_1396_c1 nmdc:mga05p37_1396_c1_23750_24121 123
277 3300050507 nmdc:mga05p37_211248_c1 nmdc:mga05p37_211248_c1_1082_1477 123
278 3300050507 nmdc:mga05p37_2921_c1 nmdc:mga05p37_2921_c1_6611_6982 123
279 3300050507 nmdc:mga05p37_90717_c1 nmdc:mga05p37_90717_c1_209_580 123
280 3300050508 nmdc:mga09592_181834_c1 nmdc:mga09592_181834_c1_928_1299 123
281 3300050508 nmdc:mga09592_3220_c1 nmdc:mga09592_3220_c1_6736_7107 123
282 3300050508 nmdc:mga09592_330295_c1 nmdc:mga09592_330295_c1_222_611 123
283 3300050508 nmdc:mga09592_993000_c1 nmdc:mga09592_993000_c1_134_511 123
284 3300050509 nmdc:mga0qj67_1019836_c1 nmdc:mga0qj67_1019836_c1_34_426 123
285 3300050509 nmdc:mga0qj67_1022500_c1 nmdc:mga0qj67_1022500_c1_49_471 123
286 3300050509 nmdc:mga0qj67_34517_c1 nmdc:mga0qj67_34517_c1_3238_3609 123
287 3300050509 nmdc:mga0qj67_6870_c1 nmdc:mga0qj67_6870_c1_5517_5888 123
288 3300050509 nmdc:mga0qj67_75817_c1 nmdc:mga0qj67_75817_c1_1329_1700 123
289 3300050510 nmdc:mga06r32_120865_c1 nmdc:mga06r32_120865_c1_1686_2057 123
290 3300050510 nmdc:mga06r32_145693_c1 nmdc:mga06r32_145693_c1_556_927 123
291 3300050510 nmdc:mga06r32_62045_c1 nmdc:mga06r32_62045_c1_2790_3212 123
292 3300050510 nmdc:mga06r32_988388_c1 nmdc:mga06r32_988388_c1_218_589 123
293 3300050511 nmdc:mga08y16_10210_c1 nmdc:mga08y16_10210_c1_3973_4368 123
294 3300050511 nmdc:mga08y16_1461798_c1 nmdc:mga08y16_1461798_c1_253_624 123
295 3300050511 nmdc:mga08y16_1661_c1 nmdc:mga08y16_1661_c1_3011_3427 123
296 3300050511 nmdc:mga08y16_1940204_c1 nmdc:mga08y16_1940204_c1_129_512 123
297 3300050511 nmdc:mga08y16_2109654_c1 nmdc:mga08y16_2109654_c1_82_453 123
298 3300050511 nmdc:mga08y16_741_c1 nmdc:mga08y16_741_c1_4373_4744 123
299 3300050512 nmdc:mga0n895_1161465_c1 nmdc:mga0n895_1161465_c1_321_692 123
300 3300050512 nmdc:mga0n895_2219854_c1 nmdc:mga0n895_2219854_c1_83_466 123
301 3300050512 nmdc:mga0n895_65928_c1 nmdc:mga0n895_65928_c1_2692_3063 123
302 3300050512 nmdc:mga0n895_76864_c1 nmdc:mga0n895_76864_c1_1709_2080 123
303 3300050513 nmdc:mga0rr50_20389_c1 nmdc:mga0rr50_20389_c1_1215_1586 123
304 3300050513 nmdc:mga0rr50_693028_c1 nmdc:mga0rr50_693028_c1_305_676 123
305 3300050513 nmdc:mga0rr50_699464_c1 nmdc:mga0rr50_699464_c1_282_653 123
306 3300050513 nmdc:mga0rr50_830620_c1 nmdc:mga0rr50_830620_c1_149_541 123
307 3300050514 nmdc:mga08x19_6293_c1 nmdc:mga08x19_6293_c1_4817_5212 123
308 3300050514 nmdc:mga08x19_69112_c1 nmdc:mga08x19_69112_c1_351_722 123
309 3300050515 nmdc:mga0a205_136147_c1 nmdc:mga0a205_136147_c1_929_1300 123
310 3300050515 nmdc:mga0a205_74166_c1 nmdc:mga0a205_74166_c1_1803_2174 123
311 3300054114 Ga0501084_0244660 Ga0501084_0244660_919_1290 123
312 3300059421 Ga0590071_074258 Ga0590071_074258_189_572 123
313 3300059424 Ga0590075_018685 Ga0590075_018685_414_797 123
314 3300061734 Ga0530510_0589756 Ga0530510_0589756_262_633 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

134

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bt3-assembly1.cif.gz_B crystal structure of a glyoxalase-related enzyme from clostridium phytofermentans 0.8128 1 121
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.8105 1 120
1ecs-assembly1.cif.gz_B the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5 0.8095 4 121
5cj3-assembly1.cif.gz_B crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin 0.8045 1 120
1xrk-assembly1.cif.gz_A crystal structure of a mutant bleomycin binding protein from streptoalloteichus hindustanus displaying increased thermostability 0.803 1 120
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9517 71 120 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9278 71 119 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9104 69 121 3.30.720.110
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8764 71 120 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8544 71 123 3.30.720.110
ID Description Score Start End GO Terms
AF-Q020R5-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9887 1 121 GO:0051213
AF-Q020R5-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9728 1 121 GO:0051213
AF-A0A1M6HF91-F1-model_v4 Glyoxalase-like domain-containing protein 0.9593 1 120
AF-A0A6I4Z2R0-F1-model_v4 Bleomycin resistance protein 0.9533 1 123 GO:0046677
AF-A0A537G6H6-F1-model_v4 VOC domain-containing protein 0.9492 71 123

Feature Viewer

pLDDT pTM Quality
91.33 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map