F402611

General Info

Members Datasets Scaffolds Average Seq Length
314 207 628 146

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10272007|Ga0081455_102720073
Length 137
Sequence MSATSTRGDEIRVGAMRVRFLVEGEHSAGSVAVFEFDVPTGAKVPVAHSHDGYEETIYGLEGVLTWTIELFIPRGAVHHFDNTSDVDAKALAIVTPGILGPDYFREVAAILDAAASGPPDLAGIAAVMRRHGISPSA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
145 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
196 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.78
Rhizosphere 87.26
Stem 0
Stem Tuber 0
Unclassified 18.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10272007 3300005937 Unclassified 1228
2 JGI24743J22301_10011216 3300001991 Bacteria 1610
3 JGI24738J21930_10018906 3300002075 Bacteria 1439
4 JGI24742J22300_10017346 3300002244 Unclassified 1217
5 Ga0070658_10366574 3300005327 Bacteria 1234
6 Ga0070658_10587531 3300005327 Bacteria 965
7 Ga0070676_10117424 3300005328 Bacteria 1665
8 Ga0070683_100027977 3300005329 Bacteria 5090
9 Ga0070683_100101236 3300005329 Bacteria 2713
10 Ga0070682_100042025 3300005337 Bacteria 2820
11 Ga0068868_100009175 3300005338 Bacteria 7105
12 Ga0070660_100300752 3300005339 Bacteria 1315
13 Ga0070691_10081682 3300005341 Bacteria 1584
14 Ga0070687_100154883 3300005343 Bacteria 1349
15 Ga0070661_100002967 3300005344 Bacteria 11696
16 Ga0070661_100908570 3300005344 Unclassified 727
17 Ga0070692_10030073 3300005345 Bacteria 2713
18 Ga0070692_10036613 3300005345 Bacteria 2491
19 Ga0070668_100268641 3300005347 Bacteria 1421
20 Ga0070675_100008476 3300005354 Bacteria 7979
21 Ga0070674_100151978 3300005356 Bacteria 1748
22 Ga0070674_100310312 3300005356 Bacteria 1261
23 Ga0070674_100436718 3300005356 Bacteria 1077
24 Ga0070673_100033227 3300005364 Bacteria 3892
25 Ga0070688_100105557 3300005365 Bacteria 1865
26 Ga0070688_100634962 3300005365 Bacteria 821
27 Ga0070659_100056824 3300005366 Bacteria 3085
28 Ga0070659_101147553 3300005366 Unclassified 686
29 Ga0070714_100108293 3300005435 Unclassified 2457
30 Ga0070714_100493427 3300005435 Bacteria 1167
31 Ga0070714_101016749 3300005435 Bacteria 807
32 Ga0070701_10004316 3300005438 Bacteria 5739
33 Ga0070711_100617105 3300005439 Bacteria 906
34 Ga0070694_100249472 3300005444 Unclassified 1342
35 Ga0070663_100023583 3300005455 Bacteria 4126
36 Ga0070678_100001394 3300005456 Bacteria 12873
37 Ga0070662_100028635 3300005457 Bacteria 3878
38 Ga0070662_100414002 3300005457 Bacteria 1114
39 Ga0070662_100919475 3300005457 Bacteria 747
40 Ga0068867_100030408 3300005459 Bacteria 3896
41 Ga0070685_10068662 3300005466 Bacteria 2094
42 Ga0070679_100170449 3300005530 Bacteria 2150
43 Ga0070679_100963501 3300005530 Bacteria 797
44 Ga0070679_101399562 3300005530 Unclassified 646
45 Ga0070684_100104954 3300005535 Bacteria 2528
46 Ga0070684_100168966 3300005535 Bacteria 1986
47 Ga0068853_100007302 3300005539 Bacteria 8845
48 Ga0070672_100005086 3300005543 Bacteria 8677
49 Ga0070695_100000615 3300005545 Bacteria 18906
50 Ga0070696_100278242 3300005546 Bacteria 1275
51 Ga0070693_100349593 3300005547 Bacteria 1011
52 Ga0070693_100730360 3300005547 Bacteria 728
53 Ga0070704_100221334 3300005549 Bacteria 1539
54 Ga0070704_100275551 3300005549 Bacteria 1392
55 Ga0070704_100708035 3300005549 Bacteria 893
56 Ga0068855_100069405 3300005563 Bacteria 4101
57 Ga0068855_100284866 3300005563 Bacteria 1834
58 Ga0070664_100055509 3300005564 Unclassified 3363
59 Ga0068854_100002294 3300005578 Bacteria 11775
60 Ga0070702_100101223 3300005615 Bacteria 1768
61 Ga0068852_100014693 3300005616 Bacteria 6038
62 Ga0068866_10018541 3300005718 Bacteria 3149
63 Ga0068861_100036085 3300005719 Bacteria 3667
64 Ga0068861_100053946 3300005719 Bacteria 3061
65 Ga0068851_10017864 3300005834 Bacteria 3413
66 Ga0068863_102029649 3300005841 Unclassified 585
67 Ga0068858_100126075 3300005842 Bacteria 2398
68 Ga0068860_102074923 3300005843 Bacteria 590
69 Ga0081455_10107529 3300005937 Bacteria 2223
70 Ga0081455_10123553 3300005937 Unclassified 2036
71 Ga0081455_10160557 3300005937 Bacteria 1723
72 Ga0081455_10537247 3300005937 Bacteria 776
73 Ga0070717_10396286 3300006028 Bacteria 1239
74 Ga0070712_100276325 3300006175 Unclassified 1351
75 Ga0097621_100058844 3300006237 Bacteria 3145
76 Ga0097621_100254910 3300006237 Unclassified 1538
77 Ga0068871_100062922 3300006358 Bacteria 3034
78 Ga0075431_100758712 3300006847 Bacteria 945
79 Ga0075433_10006803 3300006852 Bacteria 9065
80 Ga0075433_10448893 3300006852 Bacteria 1137
81 Ga0075434_100003675 3300006871 Bacteria 13705
82 Ga0075434_101086117 3300006871 Bacteria 813
83 Ga0075429_100038302 3300006880 Bacteria 4174
84 Ga0068865_100004362 3300006881 Bacteria 8534
85 Ga0068865_100196523 3300006881 Bacteria 1563
86 Ga0075435_100035038 3300007076 Bacteria 3981
87 Ga0105244_10151752 3300009036 Bacteria 1110
88 Ga0105240_10126088 3300009093 Bacteria 3076
89 Ga0111539_10437832 3300009094 Bacteria 1522
90 Ga0111539_11194132 3300009094 Bacteria 884
91 Ga0105245_10038853 3300009098 Bacteria 4235
92 Ga0105245_10163804 3300009098 Bacteria 2112
93 Ga0114129_10319528 3300009147 Bacteria 2064
94 Ga0114129_12246138 3300009147 Bacteria 656
95 Ga0114129_12641383 3300009147 Unclassified 599
96 Ga0105243_10300788 3300009148 Bacteria 1454
97 Ga0105243_11184731 3300009148 Unclassified 776
98 Ga0105241_11332918 3300009174 Bacteria 685
99 Ga0105242_10016923 3300009176 Bacteria 5674
100 Ga0105242_11908777 3300009176 Bacteria 634
101 Ga0105238_10078587 3300009551 Bacteria 3289
102 Ga0105249_10393786 3300009553 Bacteria 1414
103 Ga0105249_10599918 3300009553 Unclassified 1156
104 Ga0105239_10038227 3300010375 Bacteria 5259
105 Ga0105239_10313400 3300010375 Bacteria 1768
106 Ga0105239_11457237 3300010375 Bacteria 791
107 Ga0157371_10009977 3300013102 Bacteria 7433
108 Ga0157370_10181250 3300013104 Unclassified 1957
109 Ga0157369_10935513 3300013105 Bacteria 888
110 Ga0157369_11402127 3300013105 Unclassified 711
111 Ga0157374_10091918 3300013296 Bacteria 2894
112 Ga0157378_10386014 3300013297 Bacteria 1376
113 Ga0163162_10596170 3300013306 Bacteria 1231
114 Ga0163162_12169384 3300013306 Bacteria 638
115 Ga0157372_10067215 3300013307 Bacteria 4027
116 Ga0157372_10194535 3300013307 Bacteria 2349
117 Ga0157375_10346248 3300013308 Bacteria 1652
118 Ga0157375_10904725 3300013308 Bacteria 1026
119 Ga0163163_10071430 3300014325 Unclassified 3459
120 Ga0163163_11824844 3300014325 Bacteria 668
121 Ga0157377_10011937 3300014745 Bacteria 4353
122 Ga0157377_10086793 3300014745 Bacteria 1840
123 Ga0163161_10206824 3300017792 Bacteria 1514
124 Ga0206354_11634238 3300020081 Bacteria 600
125 Ga0207656_10142998 3300025321 Bacteria 1129
126 Ga0207692_10076516 3300025898 Bacteria 1778
127 Ga0207642_10023734 3300025899 Bacteria 2455
128 Ga0207688_10004375 3300025901 Bacteria 7693
129 Ga0207688_10047719 3300025901 Bacteria 2391
130 Ga0207645_10092107 3300025907 Bacteria 1950
131 Ga0207705_10239967 3300025909 Bacteria 1380
132 Ga0207654_10771921 3300025911 Bacteria 693
133 Ga0207695_10134850 3300025913 Bacteria 2423
134 Ga0207671_11002698 3300025914 Bacteria 658
135 Ga0207660_10102262 3300025917 Bacteria 2142
136 Ga0207662_10080014 3300025918 Bacteria 1992
137 Ga0207657_10005818 3300025919 Bacteria 12842
138 Ga0207649_10011899 3300025920 Bacteria 4814
139 Ga0207652_10193056 3300025921 Bacteria 1831
140 Ga0207652_10253792 3300025921 Unclassified 1586
141 Ga0207681_10119558 3300025923 Bacteria 1930
142 Ga0207694_10378768 3300025924 Bacteria 1174
143 Ga0207659_10191601 3300025926 Bacteria 1628
144 Ga0207687_10031136 3300025927 Bacteria 3604
145 Ga0207687_10332050 3300025927 Bacteria 1234
146 Ga0207664_10051061 3300025929 Bacteria 3264
147 Ga0207664_10924901 3300025929 Bacteria 783
148 Ga0207706_10009769 3300025933 Bacteria 8806
149 Ga0207686_10012742 3300025934 Bacteria 4631
150 Ga0207709_10041847 3300025935 Bacteria 2752
151 Ga0207669_10013729 3300025937 Bacteria 4036
152 Ga0207704_10491924 3300025938 Bacteria 987
153 Ga0207691_10008877 3300025940 Bacteria 9650
154 Ga0207711_10168250 3300025941 Bacteria 1988
155 Ga0207689_10108665 3300025942 Bacteria 2279
156 Ga0207689_10150994 3300025942 Bacteria 1915
157 Ga0207661_10289987 3300025944 Bacteria 1464
158 Ga0207661_10693728 3300025944 Bacteria 936
159 Ga0207679_10152951 3300025945 Bacteria 1880
160 Ga0207667_10429328 3300025949 Bacteria 1344
161 Ga0207651_10084033 3300025960 Bacteria 2304
162 Ga0207668_10275588 3300025972 Bacteria 1377
163 Ga0207640_10025917 3300025981 Bacteria 3555
164 Ga0207677_10259373 3300026023 Bacteria 1416
165 Ga0207703_11203236 3300026035 Bacteria 728
166 Ga0207639_10374925 3300026041 Bacteria 1276
167 Ga0207678_10043579 3300026067 Bacteria 3882
168 Ga0207648_10085316 3300026089 Bacteria 2755
169 Ga0207648_10621520 3300026089 Bacteria 997
170 Ga0207675_100014290 3300026118 Bacteria 7400
171 Ga0207675_100260631 3300026118 Bacteria 1680
172 Ga0207683_10040890 3300026121 Bacteria 4048
173 Ga0207698_10327710 3300026142 Bacteria 1437
174 Ga0207698_10380670 3300026142 Bacteria 1342
175 Ga0207428_10451239 3300027907 Bacteria 937
176 Ga0265318_10275954 3300028577 Unclassified 613
177 Ga0265320_10479670 3300031240 Bacteria 549
178 Ga0307405_10099126 3300031731 Bacteria 1950
179 Ga0307405_10466470 3300031731 Bacteria 1005
180 Ga0307413_10110761 3300031824 Bacteria 1837
181 Ga0307413_10238860 3300031824 Bacteria 1340
182 Ga0307413_10303057 3300031824 Bacteria 1213
183 Ga0307410_10004565 3300031852 Bacteria 7178
184 Ga0307410_10253178 3300031852 Bacteria 1370
185 Ga0307410_10711058 3300031852 Bacteria 848
186 Ga0307406_10144243 3300031901 Bacteria 1690
187 Ga0307407_10028268 3300031903 Bacteria 2996
188 Ga0307412_10136316 3300031911 Unclassified 1791
189 Ga0307409_100201185 3300031995 Bacteria 1782
190 Ga0307409_100841090 3300031995 Bacteria 928
191 Ga0307409_101457162 3300031995 Unclassified 711
192 Ga0307416_100630761 3300032002 Bacteria 1155
193 Ga0307414_11069117 3300032004 Unclassified 744
194 Ga0307411_10162995 3300032005 Unclassified 1673
195 Ga0307411_10345040 3300032005 Unclassified 1211
196 Ga0307415_100006229 3300032126 Bacteria 6412
197 Ga0307415_100013859 3300032126 Bacteria 4719
198 Ga0307415_100194379 3300032126 Bacteria 1604
199 Ga0395899_0009004 3300037312 Bacteria 7674
200 Ga0395900_0002545 3300037418 Bacteria 19969
201 Ga0395900_0004057 3300037418 Bacteria 15613
202 Ga0395900_0008768 3300037418 Bacteria 10390
203 Ga0395900_0110019 3300037418 Unclassified 2831
204 Ga0395900_0288281 3300037418 Unclassified 1631
205 Ga0395898_0008218 3300037466 Bacteria 11036
206 Ga0395898_0010024 3300037466 Bacteria 9923
207 Ga0395898_0383942 3300037466 Bacteria 1339
208 Ga0395898_0434284 3300037466 Unclassified 1251
209 Ga0395905_0003136 3300037471 Bacteria 17816
210 Ga0395905_0224750 3300037471 Bacteria 1756
211 Ga0395901_0001407 3300038443 Bacteria 25117
212 Ga0395901_0009351 3300038443 Bacteria 9939
213 Ga0395901_0143649 3300038443 Unclassified 2508
214 Ga0395901_0702736 3300038443 Bacteria 1008
215 Ga0395901_0882342 3300038443 Unclassified 877
216 Ga0451789_0530931 3300041443 Unclassified 2364
217 Ga0451807_2462472 3300041486 Bacteria 1278
218 Ga0451835_1135958 3300041492 Unclassified 554
219 Ga0451847_0276915 3300041503 Bacteria 842
220 Ga0451853_3804957 3300041512 Bacteria 1581
221 Ga0439454_003950 3300042011 Unclassified 1683
222 Ga0439454_089968 3300042011 Bacteria 566
223 Ga0495603_0739503 3300046455 Unclassified 562
224 Ga0495641_0308906 3300046461 Unclassified 713
225 Ga0495608_0107207 3300046511 Unclassified 1798
226 Ga0495628_0179867 3300046516 Bacteria 1600
227 Ga0495630_0079957 3300046517 Bacteria 2466
228 Ga0495630_0132422 3300046517 Unclassified 1894
229 Ga0495666_0310928 3300046526 Unclassified 712
230 Ga0495652_0143047 3300046529 Bacteria 1879
231 Ga0495634_0125329 3300046642 Unclassified 1642
232 Ga0495634_0638298 3300046642 Bacteria 616
233 Ga0495634_0703712 3300046642 Bacteria 581
234 Ga0495658_0336181 3300046683 Unclassified 959
235 Ga0495670_0535819 3300046691 Unclassified 637
236 Ga0495674_0284007 3300047319 Unclassified 1355
237 Ga0495676_0206722 3300047321 Unclassified 1361
238 Ga0495680_0164673 3300047322 Unclassified 1608
239 Ga0495684_0450752 3300047471 Bacteria 894
240 Ga0495593_0653420 3300047673 Unclassified 528
241 Ga0495602_0674332 3300048088 Bacteria 704
242 Ga0496100_0212501 3300048903 Bacteria 1415
243 Ga0496101_0326381 3300048904 Bacteria 1204
244 Ga0496101_0585507 3300048904 Unclassified 882
245 Ga0496102_0006179 3300048905 Bacteria 10211
246 Ga0496102_0841234 3300048905 Bacteria 840
247 Ga0496102_1287120 3300048905 Bacteria 650
248 Ga0496102_1584586 3300048905 Unclassified 573
249 Ga0496103_0325100 3300048906 Bacteria 989
250 Ga0496104_0073403 3300048907 Bacteria 3255
251 Ga0496104_0367269 3300048907 Unclassified 1351
252 Ga0496104_0475684 3300048907 Bacteria 1161
253 Ga0496105_0064711 3300048908 Unclassified 3017
254 Ga0496105_0155335 3300048908 Bacteria 1879
255 Ga0496106_0087867 3300048909 Bacteria 2395
256 Ga0496107_0125176 3300048910 Bacteria 1895
257 Ga0496107_0232207 3300048910 Bacteria 1373
258 Ga0496108_0001649 3300048911 Bacteria 17687
259 Ga0496108_0392654 3300048911 Bacteria 1212
260 Ga0496108_0411091 3300048911 Bacteria 1182
261 Ga0496108_0443411 3300048911 Bacteria 1134
262 Ga0496109_0388003 3300048912 Unclassified 1319
263 Ga0496109_0403205 3300048912 Bacteria 1292
264 Ga0496110_0075750 3300048913 Bacteria 2990
265 Ga0496111_0049267 3300048914 Bacteria 3037
266 Ga0496111_1151209 3300048914 Bacteria 551
267 Ga0496112_0098174 3300048915 Unclassified 2899
268 Ga0496112_0159730 3300048915 Bacteria 2220
269 Ga0496112_0706732 3300048915 Bacteria 936
270 Ga0496113_0220912 3300048916 Bacteria 1510
271 Ga0496113_1198997 3300048916 Bacteria 593
272 Ga0496114_0065940 3300048917 Bacteria 3034
273 Ga0496114_0405944 3300048917 Unclassified 1206
274 Ga0496114_0848470 3300048917 Bacteria 793
275 Ga0496115_0061195 3300048918 Bacteria 3035
276 Ga0496115_0064649 3300048918 Unclassified 2953
277 Ga0501036_0369186 3300049572 Bacteria 1198
278 Ga0501039_0060774 3300049575 Bacteria 2926
279 Ga0501040_0141684 3300049576 Bacteria 1694
280 Ga0501042_0186809 3300049578 Bacteria 1495
281 Ga0501046_0388725 3300049580 Bacteria 1009
282 Ga0501048_0257003 3300049582 Unclassified 1241
283 Ga0501067_0023752 3300049583 Bacteria 3398
284 Ga0501068_0019161 3300049584 Bacteria 3969
285 Ga0501069_0004078 3300049585 Bacteria 7537
286 Ga0501070_0140005 3300049586 Bacteria 1998
287 Ga0501072_1076139 3300049588 Bacteria 626
288 Ga0501074_0525982 3300049590 Bacteria 838
289 Ga0501075_0050615 3300049591 Bacteria 3123
290 Ga0501076_0129740 3300049592 Bacteria 2044
291 Ga0501076_0200390 3300049592 Unclassified 1630
292 Ga0501076_0351908 3300049592 Bacteria 1210
293 Ga0501077_0135865 3300049593 Bacteria 1560
294 Ga0501077_0163230 3300049593 Bacteria 1415
295 Ga0501077_0226840 3300049593 Bacteria 1187
296 Ga0501202_150092 3300049652 Unclassified 609
297 Ga0501221_223392 3300049704 Unclassified 532
298 Ga0501081_0317902 3300049743 Bacteria 1144
299 Ga0501081_0372458 3300049743 Bacteria 1054
300 Ga0501045_0097740 3300049824 Bacteria 2172
301 Ga0501045_1347594 3300049824 Bacteria 519
302 nmdc:mga09592_44223_c1 3300050508 Bacteria 3748
303 nmdc:mga06r32_929274_c1 3300050510 Bacteria 825
304 nmdc:mga0n895_1166356_c1 3300050512 Bacteria 745
305 nmdc:mga0n895_59670_c1 3300050512 Bacteria 3764
306 nmdc:mga0rr50_23536_c1 3300050513 Bacteria 4249
307 nmdc:mga0a205_190886_c1 3300050515 Bacteria 1941
308 nmdc:mga0a205_923097_c1 3300050515 Bacteria 720
309 Ga0495601_0142064 3300053077 Bacteria 1566
310 Ga0501084_0095359 3300054114 Bacteria 2499
311 Ga0501082_0059558 3300060353 Bacteria 3291
312 Ga0501082_0089101 3300060353 Bacteria 2664
313 Ga0530510_0046803 3300061734 Bacteria 3125
314 Ga0530510_0054197 3300061734 Bacteria 2898
315 Ga0081455_10272007
316 JGI24743J22301_10011216
317 JGI24738J21930_10018906
318 JGI24742J22300_10017346
319 Ga0070658_10366574
320 Ga0070658_10587531
321 Ga0070676_10117424
322 Ga0070683_100027977
323 Ga0070683_100101236
324 Ga0070682_100042025
325 Ga0068868_100009175
326 Ga0070660_100300752
327 Ga0070691_10081682
328 Ga0070687_100154883
329 Ga0070661_100002967
330 Ga0070661_100908570
331 Ga0070692_10030073
332 Ga0070692_10036613
333 Ga0070668_100268641
334 Ga0070675_100008476
335 Ga0070674_100151978
336 Ga0070674_100310312
337 Ga0070674_100436718
338 Ga0070673_100033227
339 Ga0070688_100105557
340 Ga0070688_100634962
341 Ga0070659_100056824
342 Ga0070659_101147553
343 Ga0070714_100108293
344 Ga0070714_100493427
345 Ga0070714_101016749
346 Ga0070701_10004316
347 Ga0070711_100617105
348 Ga0070694_100249472
349 Ga0070663_100023583
350 Ga0070678_100001394
351 Ga0070662_100028635
352 Ga0070662_100414002
353 Ga0070662_100919475
354 Ga0068867_100030408
355 Ga0070685_10068662
356 Ga0070679_100170449
357 Ga0070679_100963501
358 Ga0070679_101399562
359 Ga0070684_100104954
360 Ga0070684_100168966
361 Ga0068853_100007302
362 Ga0070672_100005086
363 Ga0070695_100000615
364 Ga0070696_100278242
365 Ga0070693_100349593
366 Ga0070693_100730360
367 Ga0070704_100221334
368 Ga0070704_100275551
369 Ga0070704_100708035
370 Ga0068855_100069405
371 Ga0068855_100284866
372 Ga0070664_100055509
373 Ga0068854_100002294
374 Ga0070702_100101223
375 Ga0068852_100014693
376 Ga0068866_10018541
377 Ga0068861_100036085
378 Ga0068861_100053946
379 Ga0068851_10017864
380 Ga0068863_102029649
381 Ga0068858_100126075
382 Ga0068860_102074923
383 Ga0081455_10107529
384 Ga0081455_10123553
385 Ga0081455_10160557
386 Ga0081455_10537247
387 Ga0070717_10396286
388 Ga0070712_100276325
389 Ga0097621_100058844
390 Ga0097621_100254910
391 Ga0068871_100062922
392 Ga0075431_100758712
393 Ga0075433_10006803
394 Ga0075433_10448893
395 Ga0075434_100003675
396 Ga0075434_101086117
397 Ga0075429_100038302
398 Ga0068865_100004362
399 Ga0068865_100196523
400 Ga0075435_100035038
401 Ga0105244_10151752
402 Ga0105240_10126088
403 Ga0111539_10437832
404 Ga0111539_11194132
405 Ga0105245_10038853
406 Ga0105245_10163804
407 Ga0114129_10319528
408 Ga0114129_12246138
409 Ga0114129_12641383
410 Ga0105243_10300788
411 Ga0105243_11184731
412 Ga0105241_11332918
413 Ga0105242_10016923
414 Ga0105242_11908777
415 Ga0105238_10078587
416 Ga0105249_10393786
417 Ga0105249_10599918
418 Ga0105239_10038227
419 Ga0105239_10313400
420 Ga0105239_11457237
421 Ga0157371_10009977
422 Ga0157370_10181250
423 Ga0157369_10935513
424 Ga0157369_11402127
425 Ga0157374_10091918
426 Ga0157378_10386014
427 Ga0163162_10596170
428 Ga0163162_12169384
429 Ga0157372_10067215
430 Ga0157372_10194535
431 Ga0157375_10346248
432 Ga0157375_10904725
433 Ga0163163_10071430
434 Ga0163163_11824844
435 Ga0157377_10011937
436 Ga0157377_10086793
437 Ga0163161_10206824
438 Ga0206354_11634238
439 Ga0207656_10142998
440 Ga0207692_10076516
441 Ga0207642_10023734
442 Ga0207688_10004375
443 Ga0207688_10047719
444 Ga0207645_10092107
445 Ga0207705_10239967
446 Ga0207654_10771921
447 Ga0207695_10134850
448 Ga0207671_11002698
449 Ga0207660_10102262
450 Ga0207662_10080014
451 Ga0207657_10005818
452 Ga0207649_10011899
453 Ga0207652_10193056
454 Ga0207652_10253792
455 Ga0207681_10119558
456 Ga0207694_10378768
457 Ga0207659_10191601
458 Ga0207687_10031136
459 Ga0207687_10332050
460 Ga0207664_10051061
461 Ga0207664_10924901
462 Ga0207706_10009769
463 Ga0207686_10012742
464 Ga0207709_10041847
465 Ga0207669_10013729
466 Ga0207704_10491924
467 Ga0207691_10008877
468 Ga0207711_10168250
469 Ga0207689_10108665
470 Ga0207689_10150994
471 Ga0207661_10289987
472 Ga0207661_10693728
473 Ga0207679_10152951
474 Ga0207667_10429328
475 Ga0207651_10084033
476 Ga0207668_10275588
477 Ga0207640_10025917
478 Ga0207677_10259373
479 Ga0207703_11203236
480 Ga0207639_10374925
481 Ga0207678_10043579
482 Ga0207648_10085316
483 Ga0207648_10621520
484 Ga0207675_100014290
485 Ga0207675_100260631
486 Ga0207683_10040890
487 Ga0207698_10327710
488 Ga0207698_10380670
489 Ga0207428_10451239
490 Ga0265318_10275954
491 Ga0265320_10479670
492 Ga0307405_10099126
493 Ga0307405_10466470
494 Ga0307413_10110761
495 Ga0307413_10238860
496 Ga0307413_10303057
497 Ga0307410_10004565
498 Ga0307410_10253178
499 Ga0307410_10711058
500 Ga0307406_10144243
501 Ga0307407_10028268
502 Ga0307412_10136316
503 Ga0307409_100201185
504 Ga0307409_100841090
505 Ga0307409_101457162
506 Ga0307416_100630761
507 Ga0307414_11069117
508 Ga0307411_10162995
509 Ga0307411_10345040
510 Ga0307415_100006229
511 Ga0307415_100013859
512 Ga0307415_100194379
513 Ga0395899_0009004
514 Ga0395900_0002545
515 Ga0395900_0004057
516 Ga0395900_0008768
517 Ga0395900_0110019
518 Ga0395900_0288281
519 Ga0395898_0008218
520 Ga0395898_0010024
521 Ga0395898_0383942
522 Ga0395898_0434284
523 Ga0395905_0003136
524 Ga0395905_0224750
525 Ga0395901_0001407
526 Ga0395901_0009351
527 Ga0395901_0143649
528 Ga0395901_0702736
529 Ga0395901_0882342
530 Ga0451789_0530931
531 Ga0451807_2462472
532 Ga0451835_1135958
533 Ga0451847_0276915
534 Ga0451853_3804957
535 Ga0439454_003950
536 Ga0439454_089968
537 Ga0495603_0739503
538 Ga0495641_0308906
539 Ga0495608_0107207
540 Ga0495628_0179867
541 Ga0495630_0079957
542 Ga0495630_0132422
543 Ga0495666_0310928
544 Ga0495652_0143047
545 Ga0495634_0125329
546 Ga0495634_0638298
547 Ga0495634_0703712
548 Ga0495658_0336181
549 Ga0495670_0535819
550 Ga0495674_0284007
551 Ga0495676_0206722
552 Ga0495680_0164673
553 Ga0495684_0450752
554 Ga0495593_0653420
555 Ga0495602_0674332
556 Ga0496100_0212501
557 Ga0496101_0326381
558 Ga0496101_0585507
559 Ga0496102_0006179
560 Ga0496102_0841234
561 Ga0496102_1287120
562 Ga0496102_1584586
563 Ga0496103_0325100
564 Ga0496104_0073403
565 Ga0496104_0367269
566 Ga0496104_0475684
567 Ga0496105_0064711
568 Ga0496105_0155335
569 Ga0496106_0087867
570 Ga0496107_0125176
571 Ga0496107_0232207
572 Ga0496108_0001649
573 Ga0496108_0392654
574 Ga0496108_0411091
575 Ga0496108_0443411
576 Ga0496109_0388003
577 Ga0496109_0403205
578 Ga0496110_0075750
579 Ga0496111_0049267
580 Ga0496111_1151209
581 Ga0496112_0098174
582 Ga0496112_0159730
583 Ga0496112_0706732
584 Ga0496113_0220912
585 Ga0496113_1198997
586 Ga0496114_0065940
587 Ga0496114_0405944
588 Ga0496114_0848470
589 Ga0496115_0061195
590 Ga0496115_0064649
591 Ga0501036_0369186
592 Ga0501039_0060774
593 Ga0501040_0141684
594 Ga0501042_0186809
595 Ga0501046_0388725
596 Ga0501048_0257003
597 Ga0501067_0023752
598 Ga0501068_0019161
599 Ga0501069_0004078
600 Ga0501070_0140005
601 Ga0501072_1076139
602 Ga0501074_0525982
603 Ga0501075_0050615
604 Ga0501076_0129740
605 Ga0501076_0200390
606 Ga0501076_0351908
607 Ga0501077_0135865
608 Ga0501077_0163230
609 Ga0501077_0226840
610 Ga0501202_150092
611 Ga0501221_223392
612 Ga0501081_0317902
613 Ga0501081_0372458
614 Ga0501045_0097740
615 Ga0501045_1347594
616 nmdc:mga09592_44223_c1
617 nmdc:mga06r32_929274_c1
618 nmdc:mga0n895_1166356_c1
619 nmdc:mga0n895_59670_c1
620 nmdc:mga0rr50_23536_c1
621 nmdc:mga0a205_190886_c1
622 nmdc:mga0a205_923097_c1
623 Ga0495601_0142064
624 Ga0501084_0095359
625 Ga0501082_0059558
626 Ga0501082_0089101
627 Ga0530510_0046803
628 Ga0530510_0054197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

34

94

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y3t-assembly1.cif.gz_B crystal structure of yxag, a dioxygenase from bacillus subtilis 0.925 6 114
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.9169 6 111
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9156 27 104
2h0v-assembly1.cif.gz_B crystal structure of a putative quercetin 2,3-dioxygenase (yxag, bsu39980) from bacillus subtilis at 2.60 a resolution 0.9104 6 114
2d40-assembly1.cif.gz_C crystal structure of z3393 from escherichia coli o157:h7 0.8971 27 106
ID Description Score Start End Superfamily
1gqhB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.926 8 105 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9179 14 103 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9163 13 103 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9093 13 104 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.909 16 110 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A5C7B1C5-F1-model_v4 Cupin domain-containing protein 0.9761 6 144
AF-A0A3D3CSB4-F1-model_v4 Cupin domain-containing protein 0.9717 9 100
AF-A0A7W8MSC2-F1-model_v4 Quercetin dioxygenase-like cupin family protein 0.971 6 144 GO:0051213
AF-A0A7W8JB94-F1-model_v4 Quercetin dioxygenase-like cupin family protein 0.9709 6 144 GO:0051213
AF-A0A2S7SY55-F1-model_v4 Cupin domain-containing protein 0.9651 4 144

Map