F402559

General Info

Members Datasets Scaffolds Average Seq Length
314 185 628 178

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_10503382|Ga0070701_105033821
Length 199
Sequence MTTEPLSRGYFFESIANISLQQETTRMKKTVLTFGLIAGAVMAAMMFATLPFMHKIGFDRGEIVGYTTMILAFMLVFFGIRSYRENVSGGQITFGRAFAVGILIALVACVCYVVAWEIIYYKFMPDFADKYASYIIEKARTAGATQQVIDAKLAQMKSLKAMLDNPFINAAMTFVEPFPVGLIVTLISAATNGIHEIPA

Samples

Sample ID Description Type Environment
1 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 3.82
Rhizosphere 93.63
Stem 0
Stem Tuber 0
Unclassified 25.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070701_10503382 3300005438 Unclassified 787
2 MRS1b_contig_8956953 2162886011 Unclassified 1009
3 Ga0065704_10491720 3300005289 Unclassified 674
4 Ga0065712_10067947 3300005290 Bacteria 19700
5 Ga0065707_10084202 3300005295 Bacteria 7492
6 Ga0065707_10087641 3300005295 Bacteria 4940
7 Ga0065707_10277889 3300005295 Bacteria 1055
8 Ga0070683_100000009 3300005329 Bacteria 319830
9 Ga0070690_100087530 3300005330 Bacteria 2046
10 Ga0070690_100503076 3300005330 Unclassified 907
11 Ga0070670_101133392 3300005331 Unclassified 714
12 Ga0068869_100021287 3300005334 Unclassified 4459
13 Ga0068869_100124300 3300005334 Bacteria 1977
14 Ga0068869_100485701 3300005334 Bacteria 1029
15 Ga0070666_10092144 3300005335 Bacteria 2083
16 Ga0070682_100160906 3300005337 Bacteria 1550
17 Ga0070689_100320730 3300005340 Bacteria 1294
18 Ga0070687_100007544 3300005343 Unclassified 4542
19 Ga0070687_100121025 3300005343 Bacteria 1497
20 Ga0070687_100125529 3300005343 Bacteria 1474
21 Ga0070661_100815257 3300005344 Bacteria 766
22 Ga0070668_100137490 3300005347 Bacteria 1966
23 Ga0070669_100001295 3300005353 Bacteria 18071
24 Ga0070675_100229848 3300005354 Bacteria 1618
25 Ga0070675_100702471 3300005354 Bacteria 921
26 Ga0070671_100571707 3300005355 Unclassified 975
27 Ga0070674_100940565 3300005356 Bacteria 755
28 Ga0070673_100096179 3300005364 Bacteria 2430
29 Ga0070673_100305004 3300005364 Bacteria 1403
30 Ga0070688_100307032 3300005365 Unclassified 1148
31 Ga0070688_100896744 3300005365 Unclassified 699
32 Ga0070688_101017999 3300005365 Bacteria 659
33 Ga0070714_100151047 3300005435 Bacteria 2093
34 Ga0070713_100002303 3300005436 Bacteria 12421
35 Ga0070711_100014030 3300005439 Bacteria 5042
36 Ga0070711_100245104 3300005439 Bacteria 1403
37 Ga0070705_100204632 3300005440 Unclassified 1356
38 Ga0070700_100035628 3300005441 Unclassified 3013
39 Ga0070694_100312842 3300005444 Bacteria 1206
40 Ga0070662_100402541 3300005457 Bacteria 1130
41 Ga0070707_100283459 3300005468 Bacteria 1610
42 Ga0070698_100000176 3300005471 Bacteria 59867
43 Ga0070698_100788720 3300005471 Unclassified 894
44 Ga0070698_100862744 3300005471 Bacteria 850
45 Ga0070697_100298777 3300005536 Unclassified 1384
46 Ga0068853_100062976 3300005539 Unclassified 3211
47 Ga0068853_100422165 3300005539 Unclassified 1251
48 Ga0070686_100085190 3300005544 Unclassified 2102
49 Ga0070686_100086475 3300005544 Bacteria 2087
50 Ga0070695_100688233 3300005545 Unclassified 810
51 Ga0070696_100310521 3300005546 Unclassified 1210
52 Ga0070696_100415894 3300005546 Unclassified 1055
53 Ga0070693_100421810 3300005547 Bacteria 930
54 Ga0070704_100158422 3300005549 Unclassified 1788
55 Ga0070704_100609479 3300005549 Unclassified 960
56 Ga0068857_100080211 3300005577 Bacteria 2914
57 Ga0068857_100442216 3300005577 Bacteria 1215
58 Ga0068857_100504993 3300005577 Unclassified 1135
59 Ga0068856_100043038 3300005614 Bacteria 4443
60 Ga0070702_100210695 3300005615 Bacteria 1293
61 Ga0070702_100489412 3300005615 Unclassified 901
62 Ga0068859_100009729 3300005617 Bacteria 9708
63 Ga0068859_100032105 3300005617 Bacteria 5274
64 Ga0068859_100098251 3300005617 Unclassified 2982
65 Ga0068859_100795191 3300005617 Bacteria 1034
66 Ga0068859_101491355 3300005617 Unclassified 746
67 Ga0068864_100073659 3300005618 Unclassified 2977
68 Ga0068864_100084543 3300005618 Unclassified 2788
69 Ga0068864_100524785 3300005618 Bacteria 1142
70 Ga0068866_10125561 3300005718 Unclassified 1452
71 Ga0068866_10274184 3300005718 Bacteria 1042
72 Ga0068861_100643038 3300005719 Bacteria 979
73 Ga0068863_100011515 3300005841 Bacteria 8555
74 Ga0068858_100153856 3300005842 Bacteria 2163
75 Ga0068858_100370208 3300005842 Unclassified 1374
76 Ga0068860_100451240 3300005843 Bacteria 1278
77 Ga0068860_100968201 3300005843 Unclassified 868
78 Ga0068862_100018573 3300005844 Bacteria 5791
79 Ga0068862_100244582 3300005844 Bacteria 1633
80 Ga0075363_100297494 3300006048 Bacteria 936
81 Ga0075364_10111624 3300006051 Bacteria 1825
82 Ga0070715_10046766 3300006163 Bacteria 1841
83 Ga0070716_100007863 3300006173 Bacteria 5275
84 Ga0070712_100002054 3300006175 Bacteria 12325
85 Ga0070712_100065233 3300006175 Bacteria 2584
86 Ga0075367_10015036 3300006178 Bacteria 4196
87 Ga0097621_100007988 3300006237 Bacteria 7593
88 Ga0075370_10352502 3300006353 Unclassified 879
89 Ga0068871_100003905 3300006358 Bacteria 10274
90 Ga0068871_100066333 3300006358 Unclassified 2958
91 Ga0075428_100024202 3300006844 Bacteria 6717
92 Ga0075428_100271825 3300006844 Bacteria 1823
93 Ga0075433_10238260 3300006852 Bacteria 1615
94 Ga0075433_10305416 3300006852 Bacteria 1409
95 Ga0075433_10317676 3300006852 Unclassified 1378
96 Ga0075433_10444057 3300006852 Bacteria 1144
97 Ga0075433_10537601 3300006852 Bacteria 1028
98 Ga0075434_100157525 3300006871 Bacteria 2290
99 Ga0075434_100182756 3300006871 Unclassified 2118
100 Ga0075434_100487685 3300006871 Bacteria 1253
101 Ga0075434_101044653 3300006871 Unclassified 831
102 Ga0075429_100028735 3300006880 Bacteria 4829
103 Ga0068865_100017401 3300006881 Bacteria 4623
104 Ga0068865_100166469 3300006881 Bacteria 1686
105 Ga0068865_100636358 3300006881 Unclassified 905
106 Ga0075436_100042803 3300006914 Unclassified 3123
107 Ga0075436_100196770 3300006914 Bacteria 1427
108 Ga0097620_100009729 3300006931 Bacteria 9708
109 Ga0097620_100032101 3300006931 Bacteria 5274
110 Ga0097620_100098251 3300006931 Unclassified 2982
111 Ga0097620_100795262 3300006931 Bacteria 1034
112 Ga0097620_101491089 3300006931 Unclassified 746
113 Ga0075435_100307079 3300007076 Bacteria 1357
114 Ga0105240_10527854 3300009093 Bacteria 1309
115 Ga0105240_10600982 3300009093 Bacteria 1211
116 Ga0105240_11392690 3300009093 Bacteria 737
117 Ga0111539_10375189 3300009094 Bacteria 1656
118 Ga0105245_11232133 3300009098 Unclassified 796
119 Ga0105247_10328786 3300009101 Bacteria 1069
120 Ga0114129_10029400 3300009147 Bacteria 7785
121 Ga0114129_10056129 3300009147 Bacteria 5518
122 Ga0114129_10213764 3300009147 Bacteria 2605
123 Ga0114129_10314177 3300009147 Bacteria 2085
124 Ga0114129_10328644 3300009147 Bacteria 2031
125 Ga0114129_10773496 3300009147 Bacteria 1227
126 Ga0114129_10962324 3300009147 Bacteria 1078
127 Ga0105243_10000039 3300009148 Bacteria 166207
128 Ga0105243_10437622 3300009148 Unclassified 1224
129 Ga0105243_10679938 3300009148 Unclassified 1001
130 Ga0105243_12123422 3300009148 Unclassified 598
131 Ga0105241_10081675 3300009174 Unclassified 2532
132 Ga0105241_10426764 3300009174 Bacteria 1168
133 Ga0105242_10000140 3300009176 Bacteria 52361
134 Ga0105242_10405395 3300009176 Bacteria 1274
135 Ga0105242_10411753 3300009176 Bacteria 1264
136 Ga0105242_11397437 3300009176 Unclassified 727
137 Ga0105248_10204180 3300009177 Bacteria 2227
138 Ga0105248_10396251 3300009177 Bacteria 1554
139 Ga0105248_10555010 3300009177 Unclassified 1296
140 Ga0105248_11708804 3300009177 Bacteria 713
141 Ga0105237_10107481 3300009545 Bacteria 2782
142 Ga0105249_10000029 3300009553 Bacteria 227479
143 Ga0105249_10013344 3300009553 Bacteria 7254
144 Ga0105249_10188921 3300009553 Bacteria 2009
145 Ga0105249_10199719 3300009553 Bacteria 1956
146 Ga0105239_10382905 3300010375 Unclassified 1590
147 Ga0105239_10537884 3300010375 Bacteria 1330
148 Ga0105239_10739140 3300010375 Bacteria 1126
149 Ga0105239_11492005 3300010375 Bacteria 781
150 Ga0157370_10829343 3300013104 Bacteria 841
151 Ga0157374_10056797 3300013296 Bacteria 3655
152 Ga0157374_10141865 3300013296 Bacteria 2332
153 Ga0157378_10028548 3300013297 Bacteria 4924
154 Ga0157378_10228242 3300013297 Bacteria 1773
155 Ga0157378_10497276 3300013297 Unclassified 1217
156 Ga0157378_10816033 3300013297 Bacteria 959
157 Ga0157378_11164817 3300013297 Unclassified 809
158 Ga0163162_10000009 3300013306 Bacteria 316099
159 Ga0163162_10580247 3300013306 Bacteria 1248
160 Ga0163162_10960628 3300013306 Bacteria 965
161 Ga0157375_10385998 3300013308 Unclassified 1567
162 Ga0163163_10099220 3300014325 Unclassified 2934
163 Ga0157380_10001935 3300014326 Bacteria 13767
164 Ga0157380_10004128 3300014326 Bacteria 10035
165 Ga0157380_10227413 3300014326 Unclassified 1673
166 Ga0157380_10331549 3300014326 Bacteria 1415
167 Ga0157380_10573971 3300014326 Bacteria 1111
168 Ga0157380_10579029 3300014326 Bacteria 1106
169 Ga0157379_10143381 3300014968 Bacteria 2154
170 Ga0157379_10661884 3300014968 Bacteria 978
171 Ga0157376_10000010 3300014969 Bacteria 311693
172 Ga0157376_11026116 3300014969 Unclassified 848
173 Ga0163161_10310875 3300017792 Bacteria 1243
174 Ga0213872_10035079 3300021361 Bacteria 2294
175 Ga0213876_10067173 3300021384 Bacteria 1893
176 Ga0207653_10000286 3300025885 Bacteria 29567
177 Ga0207642_10111203 3300025899 Unclassified 1395
178 Ga0207680_10403293 3300025903 Unclassified 966
179 Ga0207699_10001126 3300025906 Bacteria 12642
180 Ga0207643_10043332 3300025908 Bacteria 2539
181 Ga0207684_10044706 3300025910 Unclassified 3756
182 Ga0207684_10408859 3300025910 Unclassified 1166
183 Ga0207654_10108820 3300025911 Bacteria 1720
184 Ga0207707_10424812 3300025912 Bacteria 1139
185 Ga0207695_10774406 3300025913 Bacteria 840
186 Ga0207693_10000164 3300025915 Bacteria 59739
187 Ga0207693_10523763 3300025915 Bacteria 925
188 Ga0207663_10015595 3300025916 Bacteria 4196
189 Ga0207660_10223957 3300025917 Bacteria 1477
190 Ga0207662_10000714 3300025918 Bacteria 15177
191 Ga0207662_10149324 3300025918 Bacteria 1485
192 Ga0207662_10150195 3300025918 Bacteria 1481
193 Ga0207646_11118662 3300025922 Unclassified 693
194 Ga0207681_10002515 3300025923 Bacteria 11652
195 Ga0207650_10000687 3300025925 Bacteria 26567
196 Ga0207650_10540323 3300025925 Bacteria 977
197 Ga0207659_10833910 3300025926 Bacteria 792
198 Ga0207700_10002605 3300025928 Bacteria 10380
199 Ga0207686_10000006 3300025934 Bacteria 259583
200 Ga0207709_10000037 3300025935 Bacteria 279771
201 Ga0207709_10265955 3300025935 Unclassified 1260
202 Ga0207709_10385756 3300025935 Bacteria 1067
203 Ga0207709_10624517 3300025935 Unclassified 855
204 Ga0207670_10255815 3300025936 Bacteria 1355
205 Ga0207669_10495716 3300025937 Bacteria 976
206 Ga0207704_10178978 3300025938 Bacteria 1530
207 Ga0207665_10006047 3300025939 Bacteria 8044
208 Ga0207665_10222094 3300025939 Bacteria 1385
209 Ga0207711_10097658 3300025941 Bacteria 2594
210 Ga0207711_10115622 3300025941 Bacteria 2391
211 Ga0207711_10808448 3300025941 Bacteria 873
212 Ga0207689_10012565 3300025942 Bacteria 7233
213 Ga0207651_10425997 3300025960 Bacteria 1134
214 Ga0207651_10525160 3300025960 Bacteria 1026
215 Ga0207651_11118101 3300025960 Bacteria 706
216 Ga0207712_10000097 3300025961 Bacteria 101338
217 Ga0207712_10249852 3300025961 Bacteria 1433
218 Ga0207712_10344546 3300025961 Bacteria 1237
219 Ga0207668_10012760 3300025972 Bacteria 5152
220 Ga0207658_10213383 3300025986 Unclassified 1619
221 Ga0207703_10343253 3300026035 Unclassified 1373
222 Ga0207703_11397564 3300026035 Bacteria 673
223 Ga0207708_10018685 3300026075 Bacteria 5220
224 Ga0207641_10007619 3300026088 Bacteria 9001
225 Ga0207641_10565445 3300026088 Bacteria 1110
226 Ga0207641_10666117 3300026088 Bacteria 1023
227 Ga0207648_10018946 3300026089 Bacteria 6217
228 Ga0207648_10589782 3300026089 Bacteria 1024
229 Ga0207676_10025813 3300026095 Unclassified 4362
230 Ga0207676_10680313 3300026095 Bacteria 995
231 Ga0207674_10457985 3300026116 Bacteria 1233
232 Ga0207674_11333751 3300026116 Bacteria 687
233 Ga0207675_100379573 3300026118 Bacteria 1390
234 Ga0207675_100631126 3300026118 Bacteria 1076
235 Ga0207428_10009592 3300027907 Bacteria 8671
236 Ga0268265_10057829 3300028380 Bacteria 2958
237 Ga0268265_10916188 3300028380 Bacteria 861
238 Ga0268265_11022734 3300028380 Unclassified 817
239 Ga0268264_10232934 3300028381 Bacteria 1702
240 Ga0268264_10428924 3300028381 Bacteria 1276
241 Ga0268264_10805505 3300028381 Unclassified 939
242 Ga0265338_10110976 3300028800 Bacteria 2209
243 Ga0265760_10090287 3300031090 Bacteria 958
244 Ga0265316_10000820 3300031344 Bacteria 34379
245 Ga0265314_10001920 3300031711 Bacteria 22204
246 Ga0307416_100766953 3300032002 Unclassified 1058
247 Ga0395905_0451163 3300037471 Unclassified 1184
248 Ga0242420_001087 3300038996 Bacteria 3473
249 Ga0436365_0983024 3300039437 Bacteria 13484
250 Ga0436360_1181465 3300039438 Bacteria 2795
251 Ga0436361_0286212 3300039447 Bacteria 2099
252 Ga0439435_0016395 3300042436 Unclassified 1857
253 Ga0466963_0256471 3300044694 Bacteria 1227
254 Ga0466957_0056170 3300044842 Bacteria 2407
255 Ga0495651_0072334 3300046462 Bacteria 2619
256 Ga0495580_0040899 3300046472 Bacteria 3309
257 Ga0495582_0011566 3300046473 Bacteria 4862
258 Ga0495639_0014066 3300046475 Bacteria 3461
259 Ga0495662_0121209 3300046476 Bacteria 1284
260 Ga0495594_0034655 3300046499 Bacteria 2747
261 Ga0495618_0061641 3300046514 Bacteria 2379
262 Ga0495630_0078592 3300046517 Bacteria 2488
263 Ga0495666_0072430 3300046526 Bacteria 1636
264 Ga0495640_0040344 3300046533 Bacteria 3269
265 Ga0495586_0015731 3300046535 Bacteria 4024
266 Ga0495634_0032709 3300046642 Bacteria 3575
267 Ga0495635_0053520 3300046663 Bacteria 2781
268 Ga0495635_0632985 3300046663 Bacteria 697
269 Ga0495657_0232612 3300046675 Bacteria 1114
270 Ga0495647_0048950 3300046681 Bacteria 1636
271 Ga0495613_0075211 3300046689 Bacteria 2459
272 Ga0495600_0405041 3300046809 Bacteria 848
273 Ga0495604_0030496 3300047317 Unclassified 4283
274 Ga0495674_0138543 3300047319 Bacteria 2046
275 Ga0495672_0014436 3300047320 Bacteria 5408
276 Ga0495680_0023526 3300047322 Bacteria 5121
277 Ga0495680_0278544 3300047322 Unclassified 1179
278 Ga0495684_0225082 3300047471 Bacteria 1374
279 Ga0495615_0072006 3300048090 Unclassified 933
280 Ga0496102_0015960 3300048905 Bacteria 6553
281 Ga0496104_0024308 3300048907 Bacteria 5573
282 Ga0496104_0036447 3300048907 Bacteria 4599
283 Ga0496108_0973377 3300048911 Bacteria 726
284 Ga0496111_0201320 3300048914 Unclassified 1480
285 Ga0496112_0048090 3300048915 Bacteria 4184
286 Ga0496112_0088925 3300048915 Bacteria 3056
287 Ga0496113_0004710 3300048916 Bacteria 8419
288 Ga0496114_0007688 3300048917 Bacteria 8523
289 Ga0496114_0110436 3300048917 Bacteria 2355
290 Ga0496115_0009362 3300048918 Bacteria 7276
291 Ga0496115_0404197 3300048918 Bacteria 1108
292 Ga0501080_0416913 3300049742 Unclassified 1207
293 nmdc:mga00v17_87525_c1 3300050491 Bacteria 1952
294 nmdc:mga06z11_110365_c1 3300050494 Bacteria 1522
295 nmdc:mga05p37_200266_c1 3300050507 Bacteria 2419
296 nmdc:mga05p37_31804_c1 3300050507 Bacteria 6448
297 nmdc:mga05p37_756757_c1 3300050507 Bacteria 1070
298 nmdc:mga09592_51951_c1 3300050508 Unclassified 3458
299 nmdc:mga06r32_17679_c1 3300050510 Bacteria 6513
300 nmdc:mga08y16_114960_c1 3300050511 Bacteria 2802
301 nmdc:mga08y16_55194_c1 3300050511 Bacteria 4152
302 nmdc:mga0n895_264818_c1 3300050512 Bacteria 1744
303 nmdc:mga0n895_364214_c1 3300050512 Unclassified 1464
304 nmdc:mga0n895_425427_c1 3300050512 Bacteria 1342
305 nmdc:mga0n895_641994_c1 3300050512 Bacteria 1061
306 nmdc:mga0rr50_143091_c1 3300050513 Bacteria 1925
307 nmdc:mga0rr50_294200_c1 3300050513 Bacteria 1357
308 nmdc:mga0rr50_690442_c1 3300050513 Unclassified 871
309 nmdc:mga08x19_37214_c1 3300050514 Unclassified 3087
310 nmdc:mga0a205_229388_c1 3300050515 Bacteria 1740
311 nmdc:mga0a205_235801_c1 3300050515 Bacteria 1711
312 nmdc:mga0a205_256600_c1 3300050515 Bacteria 1627
313 nmdc:mga0a205_93345_c1 3300050515 Bacteria 2908
314 Ga0530510_0200558 3300061734 Unclassified 1482
315 Ga0070701_10503382
316 MRS1b_contig_8956953
317 Ga0065704_10491720
318 Ga0065712_10067947
319 Ga0065707_10084202
320 Ga0065707_10087641
321 Ga0065707_10277889
322 Ga0070683_100000009
323 Ga0070690_100087530
324 Ga0070690_100503076
325 Ga0070670_101133392
326 Ga0068869_100021287
327 Ga0068869_100124300
328 Ga0068869_100485701
329 Ga0070666_10092144
330 Ga0070682_100160906
331 Ga0070689_100320730
332 Ga0070687_100007544
333 Ga0070687_100121025
334 Ga0070687_100125529
335 Ga0070661_100815257
336 Ga0070668_100137490
337 Ga0070669_100001295
338 Ga0070675_100229848
339 Ga0070675_100702471
340 Ga0070671_100571707
341 Ga0070674_100940565
342 Ga0070673_100096179
343 Ga0070673_100305004
344 Ga0070688_100307032
345 Ga0070688_100896744
346 Ga0070688_101017999
347 Ga0070714_100151047
348 Ga0070713_100002303
349 Ga0070711_100014030
350 Ga0070711_100245104
351 Ga0070705_100204632
352 Ga0070700_100035628
353 Ga0070694_100312842
354 Ga0070662_100402541
355 Ga0070707_100283459
356 Ga0070698_100000176
357 Ga0070698_100788720
358 Ga0070698_100862744
359 Ga0070697_100298777
360 Ga0068853_100062976
361 Ga0068853_100422165
362 Ga0070686_100085190
363 Ga0070686_100086475
364 Ga0070695_100688233
365 Ga0070696_100310521
366 Ga0070696_100415894
367 Ga0070693_100421810
368 Ga0070704_100158422
369 Ga0070704_100609479
370 Ga0068857_100080211
371 Ga0068857_100442216
372 Ga0068857_100504993
373 Ga0068856_100043038
374 Ga0070702_100210695
375 Ga0070702_100489412
376 Ga0068859_100009729
377 Ga0068859_100032105
378 Ga0068859_100098251
379 Ga0068859_100795191
380 Ga0068859_101491355
381 Ga0068864_100073659
382 Ga0068864_100084543
383 Ga0068864_100524785
384 Ga0068866_10125561
385 Ga0068866_10274184
386 Ga0068861_100643038
387 Ga0068863_100011515
388 Ga0068858_100153856
389 Ga0068858_100370208
390 Ga0068860_100451240
391 Ga0068860_100968201
392 Ga0068862_100018573
393 Ga0068862_100244582
394 Ga0075363_100297494
395 Ga0075364_10111624
396 Ga0070715_10046766
397 Ga0070716_100007863
398 Ga0070712_100002054
399 Ga0070712_100065233
400 Ga0075367_10015036
401 Ga0097621_100007988
402 Ga0075370_10352502
403 Ga0068871_100003905
404 Ga0068871_100066333
405 Ga0075428_100024202
406 Ga0075428_100271825
407 Ga0075433_10238260
408 Ga0075433_10305416
409 Ga0075433_10317676
410 Ga0075433_10444057
411 Ga0075433_10537601
412 Ga0075434_100157525
413 Ga0075434_100182756
414 Ga0075434_100487685
415 Ga0075434_101044653
416 Ga0075429_100028735
417 Ga0068865_100017401
418 Ga0068865_100166469
419 Ga0068865_100636358
420 Ga0075436_100042803
421 Ga0075436_100196770
422 Ga0097620_100009729
423 Ga0097620_100032101
424 Ga0097620_100098251
425 Ga0097620_100795262
426 Ga0097620_101491089
427 Ga0075435_100307079
428 Ga0105240_10527854
429 Ga0105240_10600982
430 Ga0105240_11392690
431 Ga0111539_10375189
432 Ga0105245_11232133
433 Ga0105247_10328786
434 Ga0114129_10029400
435 Ga0114129_10056129
436 Ga0114129_10213764
437 Ga0114129_10314177
438 Ga0114129_10328644
439 Ga0114129_10773496
440 Ga0114129_10962324
441 Ga0105243_10000039
442 Ga0105243_10437622
443 Ga0105243_10679938
444 Ga0105243_12123422
445 Ga0105241_10081675
446 Ga0105241_10426764
447 Ga0105242_10000140
448 Ga0105242_10405395
449 Ga0105242_10411753
450 Ga0105242_11397437
451 Ga0105248_10204180
452 Ga0105248_10396251
453 Ga0105248_10555010
454 Ga0105248_11708804
455 Ga0105237_10107481
456 Ga0105249_10000029
457 Ga0105249_10013344
458 Ga0105249_10188921
459 Ga0105249_10199719
460 Ga0105239_10382905
461 Ga0105239_10537884
462 Ga0105239_10739140
463 Ga0105239_11492005
464 Ga0157370_10829343
465 Ga0157374_10056797
466 Ga0157374_10141865
467 Ga0157378_10028548
468 Ga0157378_10228242
469 Ga0157378_10497276
470 Ga0157378_10816033
471 Ga0157378_11164817
472 Ga0163162_10000009
473 Ga0163162_10580247
474 Ga0163162_10960628
475 Ga0157375_10385998
476 Ga0163163_10099220
477 Ga0157380_10001935
478 Ga0157380_10004128
479 Ga0157380_10227413
480 Ga0157380_10331549
481 Ga0157380_10573971
482 Ga0157380_10579029
483 Ga0157379_10143381
484 Ga0157379_10661884
485 Ga0157376_10000010
486 Ga0157376_11026116
487 Ga0163161_10310875
488 Ga0213872_10035079
489 Ga0213876_10067173
490 Ga0207653_10000286
491 Ga0207642_10111203
492 Ga0207680_10403293
493 Ga0207699_10001126
494 Ga0207643_10043332
495 Ga0207684_10044706
496 Ga0207684_10408859
497 Ga0207654_10108820
498 Ga0207707_10424812
499 Ga0207695_10774406
500 Ga0207693_10000164
501 Ga0207693_10523763
502 Ga0207663_10015595
503 Ga0207660_10223957
504 Ga0207662_10000714
505 Ga0207662_10149324
506 Ga0207662_10150195
507 Ga0207646_11118662
508 Ga0207681_10002515
509 Ga0207650_10000687
510 Ga0207650_10540323
511 Ga0207659_10833910
512 Ga0207700_10002605
513 Ga0207686_10000006
514 Ga0207709_10000037
515 Ga0207709_10265955
516 Ga0207709_10385756
517 Ga0207709_10624517
518 Ga0207670_10255815
519 Ga0207669_10495716
520 Ga0207704_10178978
521 Ga0207665_10006047
522 Ga0207665_10222094
523 Ga0207711_10097658
524 Ga0207711_10115622
525 Ga0207711_10808448
526 Ga0207689_10012565
527 Ga0207651_10425997
528 Ga0207651_10525160
529 Ga0207651_11118101
530 Ga0207712_10000097
531 Ga0207712_10249852
532 Ga0207712_10344546
533 Ga0207668_10012760
534 Ga0207658_10213383
535 Ga0207703_10343253
536 Ga0207703_11397564
537 Ga0207708_10018685
538 Ga0207641_10007619
539 Ga0207641_10565445
540 Ga0207641_10666117
541 Ga0207648_10018946
542 Ga0207648_10589782
543 Ga0207676_10025813
544 Ga0207676_10680313
545 Ga0207674_10457985
546 Ga0207674_11333751
547 Ga0207675_100379573
548 Ga0207675_100631126
549 Ga0207428_10009592
550 Ga0268265_10057829
551 Ga0268265_10916188
552 Ga0268265_11022734
553 Ga0268264_10232934
554 Ga0268264_10428924
555 Ga0268264_10805505
556 Ga0265338_10110976
557 Ga0265760_10090287
558 Ga0265316_10000820
559 Ga0265314_10001920
560 Ga0307416_100766953
561 Ga0395905_0451163
562 Ga0242420_001087
563 Ga0436365_0983024
564 Ga0436360_1181465
565 Ga0436361_0286212
566 Ga0439435_0016395
567 Ga0466963_0256471
568 Ga0466957_0056170
569 Ga0495651_0072334
570 Ga0495580_0040899
571 Ga0495582_0011566
572 Ga0495639_0014066
573 Ga0495662_0121209
574 Ga0495594_0034655
575 Ga0495618_0061641
576 Ga0495630_0078592
577 Ga0495666_0072430
578 Ga0495640_0040344
579 Ga0495586_0015731
580 Ga0495634_0032709
581 Ga0495635_0053520
582 Ga0495635_0632985
583 Ga0495657_0232612
584 Ga0495647_0048950
585 Ga0495613_0075211
586 Ga0495600_0405041
587 Ga0495604_0030496
588 Ga0495674_0138543
589 Ga0495672_0014436
590 Ga0495680_0023526
591 Ga0495680_0278544
592 Ga0495684_0225082
593 Ga0495615_0072006
594 Ga0496102_0015960
595 Ga0496104_0024308
596 Ga0496104_0036447
597 Ga0496108_0973377
598 Ga0496111_0201320
599 Ga0496112_0048090
600 Ga0496112_0088925
601 Ga0496113_0004710
602 Ga0496114_0007688
603 Ga0496114_0110436
604 Ga0496115_0009362
605 Ga0496115_0404197
606 Ga0501080_0416913
607 nmdc:mga00v17_87525_c1
608 nmdc:mga06z11_110365_c1
609 nmdc:mga05p37_200266_c1
610 nmdc:mga05p37_31804_c1
611 nmdc:mga05p37_756757_c1
612 nmdc:mga09592_51951_c1
613 nmdc:mga06r32_17679_c1
614 nmdc:mga08y16_114960_c1
615 nmdc:mga08y16_55194_c1
616 nmdc:mga0n895_264818_c1
617 nmdc:mga0n895_364214_c1
618 nmdc:mga0n895_425427_c1
619 nmdc:mga0n895_641994_c1
620 nmdc:mga0rr50_143091_c1
621 nmdc:mga0rr50_294200_c1
622 nmdc:mga0rr50_690442_c1
623 nmdc:mga08x19_37214_c1
624 nmdc:mga0a205_229388_c1
625 nmdc:mga0a205_235801_c1
626 nmdc:mga0a205_256600_c1
627 nmdc:mga0a205_93345_c1
628 Ga0530510_0200558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13858

DUF4199

Protein of unknown function (DUF4199)

33

191

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fed-assembly1.cif.gz_K structure of mce1-lucb complex from mycobacterium smegmatis (map1) 0.6097 4 167
8fed-assembly1.cif.gz_K structure of mce1-lucb complex from mycobacterium smegmatis (map1) 0.5713 4 167
8idc-assembly1.cif.gz_C cryo-em structure of mycobacterium tuberculosis ftsex/ripc complex in peptidisc 0.5319 20 165
7mdy-assembly1.cif.gz_B lolcde nucleotide-bound 0.4984 20 166
5xu1-assembly1.cif.gz_M structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.4942 18 163
ID Description Score Start End Superfamily
af_Q58886_1_127_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5136 2 175 1.20.140.150
af_Q2FYN3_1_133_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4973 7 165 1.20.1070.10
af_Q58886_1_127_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4832 2 175 1.20.140.150
af_Q2FYN3_1_133_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4808 7 165 1.20.1070.10
af_P09470_45_628_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.4541 2 89 1.10.1370.30
ID Description Score Start End GO Terms
AF-A0A521ST63-F1-model_v4 DUF4199 domain-containing protein 0.9781 1 169 GO:0016020
AF-A0A7L9BIA2-F1-model_v4 DUF4199 domain-containing protein 0.9775 1 168 GO:0016020
AF-A0A0A2M140-F1-model_v4 DUF4199 domain-containing protein 0.9754 1 169 GO:0016020
AF-L8JHL3-F1-model_v4 DUF4199 domain-containing protein 0.9733 1 170 GO:0016020
AF-A0A521ST63-F1-model_v4 DUF4199 domain-containing protein 0.9724 1 169 GO:0016020

Map