F402507
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 314 | 215 | 302 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10127745|rootH1_101277452 |
| Length | 412 |
| Sequence | MAGRKDYTNSKSCSIFFKTGVVALSRYLTMAMNTKPAYSLKDLCLYFLRLGTLGFGGPVALVGYMHRDLVENRKWISEDDYREGLALSQLAPGPLAAQLGIYLGYVHHGVVGATLAGAAFVLPSFLMVIVIGWTYVQYGGLPWMQAVFYGVGAAVIGIITISSYKLTTKSIGKDALLWGIFIVLAFMTFWFEEEMIALILAGGIVVWLVKAPPTWLRTSAHGILPGLLAQVQVVTFESKLWQIAWFFTKAGAFVFGSGLAIVPFLYGGVVKEYGWLNEQEFVDAVAVAMITPGPVVITVRFIGYLVAGFWGAVVAALATFIPCYLFTVIPAPYFKKYGKHPAIKAFVDGITAAAIGAIAGAVIVLGKRTLTDIPTILIALTTAIILFRFKKLQEPYVIIVAAMVGILLKTLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 2 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 3 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 4 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 5 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 6 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 7 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 8 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 9 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 10 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 11 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 12 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 120 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 121 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 122 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 123 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 127 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 128 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 129 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 130 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 138 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 139 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 140 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 141 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 142 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 143 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 144 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 145 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 146 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 149 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 192 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 193 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 194 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 195 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 197 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 198 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 199 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 200 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 201 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 202 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 208 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 209 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 210 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 211 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 212 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 213 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 214 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 215 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.86 |
| Metatranscriptomes | 0 |
| Isolates | 4.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.28 |
| Nodule | 0.96 |
| Rhizoplane | 0.32 |
| Rhizosphere | 79.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10013210 | 3300003215 | Unclassified | 3507 |
| 2 | rootH1_10008657 | 3300003316 | Bacteria | 22351 |
| 3 | rootH1_10022091 | 3300003316 | Bacteria | 2028 |
| 4 | rootH1_10093218 | 3300003316 | Bacteria | 2106 |
| 5 | rootH1_10127745 | 3300003316 | Bacteria | 2679 |
| 6 | rootH2_10004884 | 3300003320 | Bacteria | 33742 |
| 7 | rootH2_10015000 | 3300003320 | Bacteria | 6048 |
| 8 | rootL2_10005465 | 3300003322 | Bacteria | 11419 |
| 9 | rootL2_10011341 | 3300003322 | Bacteria | 13979 |
| 10 | rootL2_10030290 | 3300003322 | Bacteria | 7640 |
| 11 | rootL2_10031349 | 3300003322 | Bacteria | 5197 |
| 12 | rootL2_10036338 | 3300003322 | Bacteria | 2260 |
| 13 | rootL2_10086330 | 3300003322 | Bacteria | 2879 |
| 14 | rootL2_10141411 | 3300003322 | Bacteria | 2369 |
| 15 | rootH1_10000778 | 3300003323 | Bacteria | 106851 |
| 16 | rootH1_10006023 | 3300003323 | Bacteria | 26459 |
| 17 | rootH1_10023758 | 3300003323 | Bacteria | 38885 |
| 18 | rootH1_10041599 | 3300003323 | Bacteria | 3912 |
| 19 | rootH1_10055568 | 3300003316 | Bacteria | 3133 |
| 20 | rootH1_10055568 | 3300003323 | Bacteria | 17832 |
| 21 | rootH1_10084594 | 3300003323 | Bacteria | 6224 |
| 22 | rootH1_10166306 | 3300003323 | Bacteria | 1565 |
| 23 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 24 | Ga0055530_10006610 | 3300003791 | Bacteria | 5130 |
| 25 | Ga0065715_10098050 | 3300005293 | Bacteria | 3601 |
| 26 | Ga0070658_10136194 | 3300005327 | Bacteria | 2049 |
| 27 | Ga0070676_10002132 | 3300005328 | Bacteria | 10078 |
| 28 | Ga0070683_100164710 | 3300005329 | Bacteria | 2103 |
| 29 | Ga0070683_100277054 | 3300005329 | Bacteria | 1596 |
| 30 | Ga0070690_100030687 | 3300005330 | Unclassified | 3343 |
| 31 | Ga0070670_100100845 | 3300005331 | Bacteria | 2486 |
| 32 | Ga0070670_100392180 | 3300005331 | Bacteria | 1224 |
| 33 | Ga0068869_100010288 | 3300005334 | Bacteria | 6097 |
| 34 | Ga0068869_100014641 | 3300005334 | Bacteria | 5244 |
| 35 | Ga0068869_100020348 | 3300005334 | Unclassified | 4549 |
| 36 | Ga0070666_10082293 | 3300005335 | Bacteria | 2202 |
| 37 | Ga0068868_100002758 | 3300005338 | Bacteria | 12165 |
| 38 | Ga0068868_100072151 | 3300005338 | Bacteria | 2754 |
| 39 | Ga0070687_100148897 | 3300005343 | Bacteria | 1372 |
| 40 | Ga0070668_100157693 | 3300005347 | Bacteria | 1840 |
| 41 | Ga0070675_100392351 | 3300005354 | Bacteria | 1237 |
| 42 | Ga0070671_100025656 | 3300005355 | Bacteria | 4838 |
| 43 | Ga0070671_100183898 | 3300005355 | Unclassified | 1770 |
| 44 | Ga0070674_100033110 | 3300005356 | Bacteria | 3438 |
| 45 | Ga0070673_100034994 | 3300005364 | Bacteria | 3806 |
| 46 | Ga0070659_100027108 | 3300005366 | Bacteria | 4411 |
| 47 | Ga0070667_100012291 | 3300005367 | Bacteria | 7083 |
| 48 | Ga0070667_100161659 | 3300005367 | Bacteria | 1973 |
| 49 | Ga0070714_100004717 | 3300005435 | Bacteria | 10311 |
| 50 | Ga0070678_100004411 | 3300005456 | Bacteria | 7976 |
| 51 | Ga0070662_100005823 | 3300005457 | Bacteria | 7905 |
| 52 | Ga0068867_100009802 | 3300005459 | Bacteria | 6750 |
| 53 | Ga0068867_100023009 | 3300005459 | Bacteria | 4459 |
| 54 | Ga0068867_100062600 | 3300005459 | Bacteria | 2765 |
| 55 | Ga0070698_100001455 | 3300005471 | Bacteria | 26296 |
| 56 | Ga0070679_100331556 | 3300005530 | Bacteria | 1470 |
| 57 | Ga0070684_100120469 | 3300005535 | Bacteria | 2360 |
| 58 | Ga0068853_100049065 | 3300005539 | Bacteria | 3627 |
| 59 | Ga0068853_100146826 | 3300005539 | Bacteria | 2120 |
| 60 | Ga0070672_100007653 | 3300005543 | Bacteria | 7350 |
| 61 | Ga0070665_100014393 | 3300005548 | Bacteria | 7939 |
| 62 | Ga0068855_100000026 | 3300005563 | Bacteria | 175140 |
| 63 | Ga0068855_100005488 | 3300005563 | Bacteria | 15473 |
| 64 | Ga0068857_100017073 | 3300005577 | Bacteria | 6358 |
| 65 | Ga0068857_100222252 | 3300005577 | Unclassified | 1725 |
| 66 | Ga0068856_100219821 | 3300005614 | Unclassified | 1915 |
| 67 | Ga0070702_100055310 | 3300005615 | Bacteria | 2288 |
| 68 | Ga0068852_100130210 | 3300005616 | Bacteria | 2316 |
| 69 | Ga0068852_100437766 | 3300005616 | Bacteria | 1292 |
| 70 | Ga0068864_100240583 | 3300005618 | Unclassified | 1677 |
| 71 | Ga0068861_100054532 | 3300005719 | Bacteria | 3046 |
| 72 | Ga0068858_100143494 | 3300005842 | Unclassified | 2242 |
| 73 | Ga0068858_100324888 | 3300005842 | Bacteria | 1471 |
| 74 | Ga0068860_100015121 | 3300005843 | Bacteria | 7542 |
| 75 | Ga0068860_100019471 | 3300005843 | Bacteria | 6581 |
| 76 | Ga0068860_100079657 | 3300005843 | Bacteria | 3115 |
| 77 | Ga0068862_100144977 | 3300005844 | Bacteria | 2110 |
| 78 | Ga0070717_10234571 | 3300006028 | Bacteria | 1616 |
| 79 | Ga0075367_10070283 | 3300006178 | Bacteria | 2104 |
| 80 | Ga0075366_10023277 | 3300006195 | Bacteria | 3609 |
| 81 | Ga0097621_100009954 | 3300006237 | Bacteria | 6930 |
| 82 | Ga0097621_100042603 | 3300006237 | Unclassified | 3657 |
| 83 | Ga0068871_100012267 | 3300006358 | Bacteria | 6312 |
| 84 | Ga0068871_100015521 | 3300006358 | Bacteria | 5704 |
| 85 | Ga0068865_100132762 | 3300006881 | Bacteria | 1867 |
| 86 | Ga0075435_100080630 | 3300007076 | Bacteria | 2672 |
| 87 | Ga0105240_10005905 | 3300009093 | Bacteria | 18134 |
| 88 | Ga0105240_10120565 | 3300009093 | Plasmid | 3158 |
| 89 | Ga0111539_10008271 | 3300009094 | Bacteria | 13241 |
| 90 | Ga0105247_10015701 | 3300009101 | Bacteria | 4534 |
| 91 | Ga0114129_10000629 | 3300009147 | Bacteria | 43924 |
| 92 | Ga0114129_10234396 | 3300009147 | Bacteria | 2471 |
| 93 | Ga0105241_10012018 | 3300009174 | Bacteria | 6359 |
| 94 | Ga0105242_10001449 | 3300009176 | Bacteria | 18668 |
| 95 | Ga0105242_10060097 | 3300009176 | Unclassified | 3121 |
| 96 | Ga0105238_10029622 | 3300009551 | Bacteria | 5575 |
| 97 | Ga0105249_10474636 | 3300009553 | Unclassified | 1293 |
| 98 | Ga0105239_10000005 | 3300010375 | Bacteria | 496066 |
| 99 | Ga0105246_10007130 | 3300011119 | Bacteria | 6843 |
| 100 | Ga0157371_10029310 | 3300013102 | Bacteria | 3982 |
| 101 | Ga0157374_10013841 | 3300013296 | Bacteria | 7047 |
| 102 | Ga0157374_10046874 | 3300013296 | Bacteria | 4005 |
| 103 | Ga0157378_10025897 | 3300013297 | Bacteria | 5168 |
| 104 | Ga0157378_10032947 | 3300013297 | Bacteria | 4580 |
| 105 | Ga0157378_10056754 | 3300013297 | Bacteria | 3490 |
| 106 | Ga0163162_10009737 | 3300013306 | Bacteria | 9353 |
| 107 | Ga0163162_10121971 | 3300013306 | Unclassified | 2711 |
| 108 | Ga0163162_10330069 | 3300013306 | Bacteria | 1658 |
| 109 | Ga0163162_10394957 | 3300013306 | Unclassified | 1515 |
| 110 | Ga0157375_10036434 | 3300013308 | Bacteria | 4706 |
| 111 | Ga0157375_10061298 | 3300013308 | Unclassified | 3734 |
| 112 | Ga0157375_10259340 | 3300013308 | Bacteria | 1900 |
| 113 | Ga0157375_10286845 | 3300013308 | Unclassified | 1809 |
| 114 | Ga0157375_10453251 | 3300013308 | Bacteria | 1448 |
| 115 | Ga0157380_10003783 | 3300014326 | Bacteria | 10406 |
| 116 | Ga0157380_10040194 | 3300014326 | Bacteria | 3641 |
| 117 | Ga0157377_10058223 | 3300014745 | Bacteria | 2200 |
| 118 | Ga0157379_10091038 | 3300014968 | Bacteria | 2736 |
| 119 | Ga0157376_10030408 | 3300014969 | Unclassified | 4312 |
| 120 | Ga0163161_10059424 | 3300017792 | Unclassified | 2780 |
| 121 | Ga0163161_10102612 | 3300017792 | Bacteria | 2130 |
| 122 | Ga0163161_10114886 | 3300017792 | Bacteria | 2017 |
| 123 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 124 | Ga0209646_1000850 | 3300025246 | Bacteria | 10231 |
| 125 | Ga0209564_1002289 | 3300025295 | Bacteria | 15606 |
| 126 | Ga0209758_1001139 | 3300025297 | Bacteria | 34076 |
| 127 | Ga0209758_1005538 | 3300025297 | Bacteria | 9636 |
| 128 | Ga0209050_1001982 | 3300025298 | Bacteria | 19199 |
| 129 | Ga0209050_1014316 | 3300025298 | Bacteria | 3428 |
| 130 | Ga0207426_1040115 | 3300025302 | Bacteria | 1461 |
| 131 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 132 | Ga0207710_10014438 | 3300025900 | Unclassified | 3331 |
| 133 | Ga0207645_10004292 | 3300025907 | Bacteria | 10577 |
| 134 | Ga0207654_10018668 | 3300025911 | Bacteria | 3643 |
| 135 | Ga0207707_10099904 | 3300025912 | Bacteria | 2536 |
| 136 | Ga0207695_10006727 | 3300025913 | Bacteria | 14837 |
| 137 | Ga0207695_10111166 | 3300025913 | Plasmid | 2719 |
| 138 | Ga0207660_10052691 | 3300025917 | Bacteria | 2897 |
| 139 | Ga0207657_10005979 | 3300025919 | Bacteria | 12664 |
| 140 | Ga0207694_10024162 | 3300025924 | Bacteria | 4615 |
| 141 | Ga0207659_10171968 | 3300025926 | Bacteria | 1710 |
| 142 | Ga0207700_10070356 | 3300025928 | Bacteria | 2689 |
| 143 | Ga0207664_10035890 | 3300025929 | Bacteria | 3828 |
| 144 | Ga0207690_10071474 | 3300025932 | Bacteria | 2393 |
| 145 | Ga0207706_10003615 | 3300025933 | Bacteria | 14774 |
| 146 | Ga0207686_10001540 | 3300025934 | Bacteria | 12993 |
| 147 | Ga0207686_10089531 | 3300025934 | Unclassified | 2029 |
| 148 | Ga0207669_10050581 | 3300025937 | Unclassified | 2485 |
| 149 | Ga0207704_10028507 | 3300025938 | Bacteria | 3099 |
| 150 | Ga0207689_10001881 | 3300025942 | Bacteria | 19847 |
| 151 | Ga0207689_10006314 | 3300025942 | Bacteria | 10500 |
| 152 | Ga0207661_10087566 | 3300025944 | Bacteria | 2587 |
| 153 | Ga0207667_10026309 | 3300025949 | Bacteria | 6359 |
| 154 | Ga0207712_10078364 | 3300025961 | Bacteria | 2398 |
| 155 | Ga0207712_10352895 | 3300025961 | Bacteria | 1223 |
| 156 | Ga0207658_10088173 | 3300025986 | Bacteria | 2398 |
| 157 | Ga0207677_10019445 | 3300026023 | Bacteria | 4101 |
| 158 | Ga0207677_10082522 | 3300026023 | Bacteria | 2310 |
| 159 | Ga0207677_10130088 | 3300026023 | Bacteria | 1910 |
| 160 | Ga0207639_10039453 | 3300026041 | Bacteria | 3519 |
| 161 | Ga0207648_10012173 | 3300026089 | Bacteria | 8061 |
| 162 | Ga0207648_10025722 | 3300026089 | Bacteria | 5239 |
| 163 | Ga0207674_10219992 | 3300026116 | Bacteria | 1847 |
| 164 | Ga0207674_10255613 | 3300026116 | Unclassified | 1699 |
| 165 | Ga0207675_100022631 | 3300026118 | Bacteria | 5850 |
| 166 | Ga0207675_100078124 | 3300026118 | Bacteria | 3101 |
| 167 | Ga0207683_10001021 | 3300026121 | Bacteria | 25523 |
| 168 | Ga0268264_10024179 | 3300028381 | Bacteria | 4958 |
| 169 | Ga0268264_10060219 | 3300028381 | Bacteria | 3182 |
| 170 | Ga0307515_10000003 | 3300028794 | Bacteria | 891317 |
| 171 | Ga0307515_10155902 | 3300028794 | Bacteria | 2357 |
| 172 | Ga0307513_10041139 | 3300031456 | Bacteria | 5105 |
| 173 | Ga0307513_10054257 | 3300031456 | Bacteria | 4299 |
| 174 | Ga0307408_100028082 | 3300031548 | Bacteria | 3885 |
| 175 | Ga0307413_10014318 | 3300031824 | Bacteria | 4023 |
| 176 | Ga0307410_10150747 | 3300031852 | Bacteria | 1731 |
| 177 | Ga0307416_100011813 | 3300032002 | Bacteria | 5850 |
| 178 | Ga0307414_10003357 | 3300032004 | Bacteria | 8547 |
| 179 | Ga0307414_10034348 | 3300032004 | Bacteria | 3361 |
| 180 | Ga0307411_10000007 | 3300032005 | Bacteria | 332057 |
| 181 | Ga0307415_100038209 | 3300032126 | Bacteria | 3162 |
| 182 | Ga0307510_10001560 | 3300033180 | Bacteria | 25328 |
| 183 | Ga0373927_0015369 | 3300035695 | Bacteria | 5058 |
| 184 | Ga0373933_0155071 | 3300035724 | Bacteria | 1452 |
| 185 | Ga0373937_0017152 | 3300036401 | Bacteria | 6444 |
| 186 | Ga0373937_0378771 | 3300036401 | Bacteria | 1342 |
| 187 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 188 | Ga0395899_0004379 | 3300037312 | Bacteria | 11008 |
| 189 | Ga0395900_0001209 | 3300037418 | Bacteria | 31961 |
| 190 | Ga0395900_0059787 | 3300037418 | Bacteria | 3923 |
| 191 | Ga0395900_0114198 | 3300037418 | Bacteria | 2771 |
| 192 | Ga0395898_0061766 | 3300037466 | Bacteria | 3640 |
| 193 | Ga0395905_0002119 | 3300037471 | Bacteria | 22523 |
| 194 | Ga0395905_0002196 | 3300037471 | Bacteria | 22050 |
| 195 | Ga0395901_0110687 | 3300038443 | Bacteria | 2883 |
| 196 | Ga0439447_002912 | 3300041407 | Bacteria | 6128 |
| 197 | Ga0439445_0026350 | 3300042004 | Bacteria | 1488 |
| 198 | Ga0439449_0054576 | 3300042007 | Bacteria | 1476 |
| 199 | Ga0466969_0000399 | 3300044656 | Bacteria | 23843 |
| 200 | Ga0466972_0021517 | 3300044658 | Bacteria | 3214 |
| 201 | Ga0453683_0111493 | 3300044673 | Unclassified | 1720 |
| 202 | Ga0453684_0004510 | 3300044712 | Bacteria | 29232 |
| 203 | Ga0466970_0007553 | 3300044765 | Bacteria | 5453 |
| 204 | Ga0466957_0038498 | 3300044842 | Unclassified | 2881 |
| 205 | Ga0466957_0078873 | 3300044842 | Bacteria | 2048 |
| 206 | Ga0466960_0094560 | 3300044901 | Bacteria | 1529 |
| 207 | Ga0451576_0107073 | 3300045051 | Bacteria | 2908 |
| 208 | Ga0466967_0354465 | 3300045976 | Bacteria | 1421 |
| 209 | Ga0495592_0131680 | 3300046454 | Bacteria | 1749 |
| 210 | Ga0495629_0000013 | 3300046459 | Bacteria | 212317 |
| 211 | Ga0495638_0000005 | 3300046460 | Bacteria | 680627 |
| 212 | Ga0495605_0014922 | 3300046474 | Bacteria | 4237 |
| 213 | Ga0495605_0049459 | 3300046474 | Bacteria | 2054 |
| 214 | Ga0495605_0058515 | 3300046474 | Bacteria | 1852 |
| 215 | Ga0495639_0040486 | 3300046475 | Bacteria | 2096 |
| 216 | Ga0495584_0009056 | 3300046491 | Bacteria | 5141 |
| 217 | Ga0495594_0027869 | 3300046499 | Bacteria | 3046 |
| 218 | Ga0495596_0000124 | 3300046500 | Bacteria | 53005 |
| 219 | Ga0495607_0000898 | 3300046501 | Bacteria | 27713 |
| 220 | Ga0495583_0000308 | 3300046506 | Bacteria | 77290 |
| 221 | Ga0495583_0012063 | 3300046506 | Bacteria | 4921 |
| 222 | Ga0495616_0011306 | 3300046513 | Bacteria | 5123 |
| 223 | Ga0495618_0086296 | 3300046514 | Bacteria | 2007 |
| 224 | Ga0495628_0009671 | 3300046516 | Bacteria | 8227 |
| 225 | Ga0495631_0000880 | 3300046518 | Bacteria | 18795 |
| 226 | Ga0495631_0009750 | 3300046518 | Bacteria | 4783 |
| 227 | Ga0495631_0014580 | 3300046518 | Bacteria | 3787 |
| 228 | Ga0495632_0001593 | 3300046519 | Bacteria | 18701 |
| 229 | Ga0495632_0004640 | 3300046519 | Bacteria | 9290 |
| 230 | Ga0495643_0003499 | 3300046522 | Bacteria | 11442 |
| 231 | Ga0495643_0011945 | 3300046522 | Bacteria | 5259 |
| 232 | Ga0495643_0025240 | 3300046522 | Bacteria | 3364 |
| 233 | Ga0495648_0011080 | 3300046524 | Bacteria | 6826 |
| 234 | Ga0495666_0001522 | 3300046526 | Bacteria | 11351 |
| 235 | Ga0495642_0014944 | 3300046528 | Bacteria | 3013 |
| 236 | Ga0495642_0031562 | 3300046528 | Bacteria | 2124 |
| 237 | Ga0495654_0010155 | 3300046530 | Bacteria | 5133 |
| 238 | Ga0495640_0049398 | 3300046533 | Bacteria | 2901 |
| 239 | Ga0495586_0078389 | 3300046535 | Bacteria | 1813 |
| 240 | Ga0495609_0000719 | 3300046538 | Bacteria | 25215 |
| 241 | Ga0495609_0002400 | 3300046538 | Bacteria | 11528 |
| 242 | Ga0495597_0001003 | 3300046542 | Bacteria | 21651 |
| 243 | Ga0495597_0004121 | 3300046542 | Bacteria | 8091 |
| 244 | Ga0495633_0003014 | 3300046558 | Bacteria | 11484 |
| 245 | Ga0495668_0003783 | 3300046616 | Bacteria | 11088 |
| 246 | Ga0495668_0016027 | 3300046616 | Bacteria | 4364 |
| 247 | Ga0495668_0019205 | 3300046616 | Bacteria | 3943 |
| 248 | Ga0495611_0004618 | 3300046648 | Bacteria | 5924 |
| 249 | Ga0495661_0002030 | 3300046665 | Bacteria | 15940 |
| 250 | Ga0495661_0004457 | 3300046665 | Bacteria | 10104 |
| 251 | Ga0495661_0006159 | 3300046665 | Bacteria | 8441 |
| 252 | Ga0495661_0018352 | 3300046665 | Bacteria | 4603 |
| 253 | Ga0495649_0044307 | 3300046694 | Bacteria | 2429 |
| 254 | Ga0495589_0005904 | 3300046794 | Bacteria | 6463 |
| 255 | Ga0495660_0020392 | 3300046810 | Bacteria | 3799 |
| 256 | Ga0495604_0007326 | 3300047317 | Bacteria | 8737 |
| 257 | Ga0495672_0014559 | 3300047320 | Bacteria | 5379 |
| 258 | Ga0495672_0041356 | 3300047320 | Bacteria | 2788 |
| 259 | Ga0495676_0036132 | 3300047321 | Bacteria | 4128 |
| 260 | Ga0495683_0016610 | 3300047323 | Bacteria | 3821 |
| 261 | Ga0495687_032539 | 3300047443 | Bacteria | 2378 |
| 262 | Ga0495675_0013020 | 3300047444 | Bacteria | 5244 |
| 263 | Ga0495677_0000584 | 3300047445 | Bacteria | 14980 |
| 264 | Ga0495677_0000807 | 3300047445 | Bacteria | 12654 |
| 265 | Ga0495679_014984 | 3300047446 | Bacteria | 2850 |
| 266 | Ga0495681_0005969 | 3300047470 | Bacteria | 8075 |
| 267 | Ga0495626_0004859 | 3300048091 | Bacteria | 8086 |
| 268 | Ga0495626_0013130 | 3300048091 | Bacteria | 4315 |
| 269 | Ga0495626_0019691 | 3300048091 | Bacteria | 3371 |
| 270 | Ga0495626_0020370 | 3300048091 | Bacteria | 3306 |
| 271 | Ga0496104_0397901 | 3300048907 | Bacteria | 1290 |
| 272 | Ga0496122_0020252 | 3300048925 | Bacteria | 6023 |
| 273 | Ga0496124_0011548 | 3300048927 | Bacteria | 8812 |
| 274 | Ga0496125_0090806 | 3300048928 | Bacteria | 2291 |
| 275 | Ga0501300_002368 | 3300049523 | Unclassified | 2813 |
| 276 | Ga0501300_004633 | 3300049523 | Bacteria | 2034 |
| 277 | Ga0501075_0095748 | 3300049591 | Bacteria | 2253 |
| 278 | Ga0501206_000632 | 3300049653 | Bacteria | 4236 |
| 279 | Ga0501217_000671 | 3300049661 | Bacteria | 5820 |
| 280 | Ga0501235_006045 | 3300049669 | Bacteria | 2635 |
| 281 | Ga0501249_001116 | 3300049679 | Bacteria | 5665 |
| 282 | Ga0501266_000010 | 3300049763 | Bacteria | 214932 |
| 283 | nmdc:mga0k408_6037_c1 | 3300050493 | Bacteria | 6456 |
| 284 | nmdc:mga05p37_990_c1 | 3300050507 | Bacteria | 6835 |
| 285 | nmdc:mga08y16_16854_c1 | 3300050511 | Bacteria | 7691 |
| 286 | nmdc:mga08y16_413507_c1 | 3300050511 | Unclassified | 1379 |
| 287 | nmdc:mga0n895_49087_c1 | 3300050512 | Bacteria | 4133 |
| 288 | nmdc:mga0n895_9708_c1 | 3300050512 | Bacteria | 8440 |
| 289 | nmdc:mga0rr50_239768_c1 | 3300050513 | Bacteria | 1503 |
| 290 | nmdc:mga0a205_49182_c1 | 3300050515 | Bacteria | 4069 |
| 291 | Ga0500578_0046579 | 3300053086 | Bacteria | 2782 |
| 292 | Ga0500658_0000004 | 3300053134 | Bacteria | 457801 |
| 293 | Ga0500568_0003983 | 3300053139 | Bacteria | 8025 |
| 294 | Ga0500604_0002027 | 3300053151 | Bacteria | 5599 |
| 295 | Ga0500604_0052824 | 3300053151 | Bacteria | 1259 |
| 296 | Ga0500616_0000003 | 3300053153 | Bacteria | 1220687 |
| 297 | Ga0500616_0018000 | 3300053153 | Bacteria | 3999 |
| 298 | Ga0500622_0000026 | 3300053156 | Bacteria | 235660 |
| 299 | Ga0500622_0000209 | 3300053156 | Bacteria | 61889 |
| 300 | Ga0500622_0003046 | 3300053156 | Bacteria | 11579 |
| 301 | Ga0500611_000010 | 3300053727 | Bacteria | 165151 |
| 302 | Ga0500645_054846 | 3300053730 | Bacteria | 1158 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025926 | Ga0207659_10171968 | Ga0207659_101719681 | 300 |
| 2 | 3300026118 | Ga0207675_100078124 | Ga0207675_1000781243 | 312 |
| 3 | 3300005844 | Ga0068862_100144977 | Ga0068862_1001449772 | 315 |
| 4 | 3300013308 | Ga0157375_10259340 | Ga0157375_102593402 | 322 |
| 5 | 3300005618 | Ga0068864_100240583 | Ga0068864_1002405832 | 324 |
| 6 | 3300009176 | Ga0105242_10001449 | Ga0105242_100014495 | 324 |
| 7 | 3300025934 | Ga0207686_10001540 | Ga0207686_100015404 | 324 |
| 8 | 3300005355 | Ga0070671_100183898 | Ga0070671_1001838981 | 327 |
| 9 | 3300017792 | Ga0163161_10059424 | Ga0163161_100594242 | 327 |
| 10 | 3300053156 | Ga0500622_0003046 | Ga0500622_0003046_2491_3654 | 329 |
| 11 | 3300036401 | Ga0373937_0378771 | Ga0373937_0378771_61_1224 | 330 |
| 12 | 3300037312 | Ga0395899_0000017 | Ga0395899_0000017_10782_11945 | 330 |
| 13 | 3300005343 | Ga0070687_100148897 | Ga0070687_1001488971 | 331 |
| 14 | 3300005354 | Ga0070675_100392351 | Ga0070675_1003923511 | 331 |
| 15 | 3300005355 | Ga0070671_100025656 | Ga0070671_1000256562 | 331 |
| 16 | 3300005615 | Ga0070702_100055310 | Ga0070702_1000553102 | 331 |
| 17 | 3300005616 | Ga0068852_100437766 | Ga0068852_1004377661 | 331 |
| 18 | 3300013308 | Ga0157375_10453251 | Ga0157375_104532511 | 331 |
| 19 | 3300025298 | Ga0209050_1001982 | Ga0209050_10019824 | 331 |
| 20 | 3300025302 | Ga0207426_1040115 | Ga0207426_10401151 | 331 |
| 21 | 3300026023 | Ga0207677_10130088 | Ga0207677_101300882 | 331 |
| 22 | 3300046499 | Ga0495594_0027869 | Ga0495594_0027869_1344_2507 | 331 |
| 23 | 3300031456 | Ga0307513_10054257 | Ga0307513_100542572 | 333 |
| 24 | 3300050512 | nmdc:mga0n895_9708_c1 | nmdc:mga0n895_9708_c1_5143_6255 | 335 |
| 25 | 3300050513 | nmdc:mga0rr50_239768_c1 | nmdc:mga0rr50_239768_c1_234_1346 | 335 |
| 26 | 3300050515 | nmdc:mga0a205_49182_c1 | nmdc:mga0a205_49182_c1_275_1387 | 335 |
| 27 | 3300044765 | Ga0466970_0007553 | Ga0466970_0007553_73_1203 | 337 |
| 28 | 3300007076 | Ga0075435_100080630 | Ga0075435_1000806302 | 338 |
| 29 | 3300053730 | Ga0500645_054846 | Ga0500645_054846_22_1086 | 340 |
| 30 | 3300006358 | Ga0068871_100015521 | Ga0068871_1000155212 | 341 |
| 31 | 3300013297 | Ga0157378_10025897 | Ga0157378_100258975 | 341 |
| 32 | 3300025961 | Ga0207712_10078364 | Ga0207712_100783642 | 342 |
| 33 | 3300032005 | Ga0307411_10000007 | Ga0307411_1000000775 | 342 |
| 34 | 3300041407 | Ga0439447_002912 | Ga0439447_002912_1044_2213 | 342 |
| 35 | 3300044842 | Ga0466957_0078873 | Ga0466957_0078873_477_1595 | 342 |
| 36 | 3300049763 | Ga0501266_000010 | Ga0501266_000010_170837_172006 | 342 |
| 37 | 3300053134 | Ga0500658_0000004 | Ga0500658_0000004_363356_364525 | 342 |
| 38 | 3300009101 | Ga0105247_10015701 | Ga0105247_100157012 | 343 |
| 39 | 3300025900 | Ga0207710_10014438 | Ga0207710_100144383 | 344 |
| 40 | 3300037471 | Ga0395905_0002196 | Ga0395905_0002196_13003_14178 | 344 |
| 41 | 3300003323 | rootH1_10006023 | rootH1_1000602310 | 345 |
| 42 | 3300005459 | Ga0068867_100062600 | Ga0068867_1000626004 | 345 |
| 43 | 3300009147 | Ga0114129_10000629 | Ga0114129_1000062917 | 345 |
| 44 | 3300013297 | Ga0157378_10032947 | Ga0157378_100329475 | 345 |
| 45 | 3300014326 | Ga0157380_10040194 | Ga0157380_100401942 | 345 |
| 46 | 3300050507 | nmdc:mga05p37_990_c1 | nmdc:mga05p37_990_c1_1997_3136 | 345 |
| 47 | 3300053151 | Ga0500604_0052824 | Ga0500604_0052824_24_1067 | 345 |
| 48 | 3300044656 | Ga0466969_0000399 | Ga0466969_0000399_1851_2987 | 346 |
| 49 | 3300049679 | Ga0501249_001116 | Ga0501249_001116_1502_2671 | 346 |
| 50 | 3300046524 | Ga0495648_0011080 | Ga0495648_0011080_4043_5224 | 347 |
| 51 | 3300046538 | Ga0495609_0002400 | Ga0495609_0002400_3019_4200 | 347 |
| 52 | 3300046665 | Ga0495661_0004457 | Ga0495661_0004457_7895_9076 | 347 |
| 53 | 3300053139 | Ga0500568_0003983 | Ga0500568_0003983_6715_7854 | 347 |
| 54 | 3300035695 | Ga0373927_0015369 | Ga0373927_0015369_1021_2199 | 348 |
| 55 | 3300046474 | Ga0495605_0058515 | Ga0495605_0058515_221_1399 | 348 |
| 56 | 3300005334 | Ga0068869_100010288 | Ga0068869_1000102885 | 349 |
| 57 | 3300005338 | Ga0068868_100002758 | Ga0068868_1000027587 | 349 |
| 58 | 3300005457 | Ga0070662_100005823 | Ga0070662_1000058233 | 349 |
| 59 | 3300005459 | Ga0068867_100023009 | Ga0068867_1000230091 | 349 |
| 60 | 3300005539 | Ga0068853_100146826 | Ga0068853_1001468261 | 349 |
| 61 | 3300013296 | Ga0157374_10046874 | Ga0157374_100468742 | 349 |
| 62 | 3300013306 | Ga0163162_10009737 | Ga0163162_100097375 | 349 |
| 63 | 3300014745 | Ga0157377_10058223 | Ga0157377_100582231 | 349 |
| 64 | 3300009093 | Ga0105240_10005905 | Ga0105240_100059058 | 350 |
| 65 | 3300017792 | Ga0163161_10102612 | Ga0163161_101026122 | 350 |
| 66 | 3300025933 | Ga0207706_10003615 | Ga0207706_100036157 | 350 |
| 67 | 3300025942 | Ga0207689_10006314 | Ga0207689_100063145 | 350 |
| 68 | 3300026023 | Ga0207677_10019445 | Ga0207677_100194453 | 350 |
| 69 | 3300026089 | Ga0207648_10012173 | Ga0207648_100121734 | 350 |
| 70 | 3300046475 | Ga0495639_0040486 | Ga0495639_0040486_698_1762 | 350 |
| 71 | 3300047317 | Ga0495604_0007326 | Ga0495604_0007326_2350_3495 | 350 |
| 72 | 3300047321 | Ga0495676_0036132 | Ga0495676_0036132_3033_4097 | 350 |
| 73 | 3300049523 | Ga0501300_004633 | Ga0501300_004633_367_1515 | 350 |
| 74 | 3300005331 | Ga0070670_100392180 | Ga0070670_1003921801 | 351 |
| 75 | 3300005842 | Ga0068858_100324888 | Ga0068858_1003248881 | 351 |
| 76 | 3300044658 | Ga0466972_0021517 | Ga0466972_0021517_482_1618 | 352 |
| 77 | 3300047445 | Ga0495677_0000807 | Ga0495677_0000807_832_2010 | 352 |
| 78 | 3300053086 | Ga0500578_0046579 | Ga0500578_0046579_115_1248 | 353 |
| 79 | 3300053153 | Ga0500616_0018000 | Ga0500616_0018000_761_1897 | 353 |
| 80 | 3300003322 | rootL2_10036338 | rootL2_100363383 | 354 |
| 81 | 3300044842 | Ga0466957_0038498 | Ga0466957_0038498_1418_2557 | 354 |
| 82 | 3300003316 | rootH1_10008657 | rootH1_100086577 | 355 |
| 83 | 3300003322 | rootL2_10005465 | rootL2_1000546511 | 355 |
| 84 | 3300003322 | rootL2_10030290 | rootL2_100302906 | 355 |
| 85 | 3300003323 | rootH1_10055568 | rootH1_1005556811 | 355 |
| 86 | 3300005530 | Ga0070679_100331556 | Ga0070679_1003315561 | 355 |
| 87 | 3300005539 | Ga0068853_100049065 | Ga0068853_1000490653 | 355 |
| 88 | 3300005616 | Ga0068852_100130210 | Ga0068852_1001302104 | 355 |
| 89 | 3300009174 | Ga0105241_10012018 | Ga0105241_100120183 | 355 |
| 90 | 3300009551 | Ga0105238_10029622 | Ga0105238_100296223 | 355 |
| 91 | 3300025911 | Ga0207654_10018668 | Ga0207654_100186683 | 355 |
| 92 | 3300025924 | Ga0207694_10024162 | Ga0207694_100241623 | 355 |
| 93 | 3300026041 | Ga0207639_10039453 | Ga0207639_100394533 | 355 |
| 94 | 3300028794 | Ga0307515_10155902 | Ga0307515_101559022 | 355 |
| 95 | 3300032004 | Ga0307414_10034348 | Ga0307414_100343483 | 355 |
| 96 | 3300003323 | rootH1_10000778 | rootH1_1000077828 | 356 |
| 97 | 3300031456 | Ga0307513_10041139 | Ga0307513_100411392 | 356 |
| 98 | 3300046506 | Ga0495583_0000308 | Ga0495583_0000308_63808_64986 | 357 |
| 99 | 3300046513 | Ga0495616_0011306 | Ga0495616_0011306_1694_2872 | 357 |
| 100 | 3300046518 | Ga0495631_0000880 | Ga0495631_0000880_7666_8844 | 357 |
| 101 | 3300046519 | Ga0495632_0004640 | Ga0495632_0004640_3775_4953 | 357 |
| 102 | 3300046616 | Ga0495668_0019205 | Ga0495668_0019205_1814_2992 | 357 |
| 103 | 3300046648 | Ga0495611_0004618 | Ga0495611_0004618_4649_5827 | 357 |
| 104 | 3300046665 | Ga0495661_0018352 | Ga0495661_0018352_3183_4361 | 357 |
| 105 | 3300046810 | Ga0495660_0020392 | Ga0495660_0020392_49_1227 | 357 |
| 106 | 3300047323 | Ga0495683_0016610 | Ga0495683_0016610_1275_2453 | 357 |
| 107 | 3300047446 | Ga0495679_014984 | Ga0495679_014984_1632_2810 | 357 |
| 108 | 3300047470 | Ga0495681_0005969 | Ga0495681_0005969_4655_5833 | 357 |
| 109 | 3300046526 | Ga0495666_0001522 | Ga0495666_0001522_7357_8526 | 358 |
| 110 | 3300046533 | Ga0495640_0049398 | Ga0495640_0049398_551_1720 | 358 |
| 111 | 3300046694 | Ga0495649_0044307 | Ga0495649_0044307_166_1356 | 358 |
| 112 | 3300047444 | Ga0495675_0013020 | Ga0495675_0013020_2868_4037 | 358 |
| 113 | 3300050511 | nmdc:mga08y16_413507_c1 | nmdc:mga08y16_413507_c1_113_1264 | 358 |
| 114 | 3300013297 | Ga0157378_10056754 | Ga0157378_100567544 | 359 |
| 115 | 3300013308 | Ga0157375_10061298 | Ga0157375_100612982 | 359 |
| 116 | 3300048091 | Ga0495626_0004859 | Ga0495626_0004859_6258_7436 | 359 |
| 117 | 3300048091 | Ga0495626_0020370 | Ga0495626_0020370_1802_2983 | 360 |
| 118 | 3300053727 | Ga0500611_000010 | Ga0500611_000010_103303_104397 | 360 |
| 119 | 3300032004 | Ga0307414_10003357 | Ga0307414_100033574 | 361 |
| 120 | 3300046501 | Ga0495607_0000898 | Ga0495607_0000898_11382_12563 | 361 |
| 121 | 3300048091 | Ga0495626_0013130 | Ga0495626_0013130_168_1346 | 361 |
| 122 | 3300003316 | rootH1_10093218 | rootH1_100932182 | 362 |
| 123 | 3300005577 | Ga0068857_100017073 | Ga0068857_1000170733 | 362 |
| 124 | 3300032002 | Ga0307416_100011813 | Ga0307416_1000118132 | 362 |
| 125 | 3300032126 | Ga0307415_100038209 | Ga0307415_1000382093 | 362 |
| 126 | 3300046519 | Ga0495632_0001593 | Ga0495632_0001593_10881_12062 | 362 |
| 127 | 3300046522 | Ga0495643_0003499 | Ga0495643_0003499_2822_4003 | 362 |
| 128 | 3300046665 | Ga0495661_0006159 | Ga0495661_0006159_6306_7487 | 362 |
| 129 | 3300047445 | Ga0495677_0000584 | Ga0495677_0000584_1875_3056 | 362 |
| 130 | 3300050512 | nmdc:mga0n895_49087_c1 | nmdc:mga0n895_49087_c1_2950_4107 | 362 |
| 131 | 3300009094 | Ga0111539_10008271 | Ga0111539_1000827110 | 364 |
| 132 | 3300028794 | Ga0307515_10000003 | Ga0307515_10000003312 | 364 |
| 133 | 3300050511 | nmdc:mga08y16_16854_c1 | nmdc:mga08y16_16854_c1_1194_2351 | 364 |
| 134 | 3300009147 | Ga0114129_10234396 | Ga0114129_102343962 | 365 |
| 135 | 3300013306 | Ga0163162_10330069 | Ga0163162_103300692 | 365 |
| 136 | 3300025298 | Ga0209050_1014316 | Ga0209050_10143163 | 365 |
| 137 | 3300005577 | Ga0068857_100222252 | Ga0068857_1002222522 | 366 |
| 138 | 3300005614 | Ga0068856_100219821 | Ga0068856_1002198212 | 366 |
| 139 | 3300026116 | Ga0207674_10255613 | Ga0207674_102556131 | 366 |
| 140 | 3300005435 | Ga0070714_100004717 | Ga0070714_1000047175 | 367 |
| 141 | 3300005535 | Ga0070684_100120469 | Ga0070684_1001204694 | 367 |
| 142 | 3300005563 | Ga0068855_100005488 | Ga0068855_1000054888 | 367 |
| 143 | 3300006028 | Ga0070717_10234571 | Ga0070717_102345712 | 367 |
| 144 | 3300025913 | Ga0207695_10006727 | Ga0207695_100067278 | 367 |
| 145 | 3300025928 | Ga0207700_10070356 | Ga0207700_100703562 | 367 |
| 146 | 3300025929 | Ga0207664_10035890 | Ga0207664_100358902 | 367 |
| 147 | 3300025949 | Ga0207667_10026309 | Ga0207667_100263098 | 367 |
| 148 | 3300031824 | Ga0307413_10014318 | Ga0307413_100143183 | 367 |
| 149 | 3300037418 | Ga0395900_0059787 | Ga0395900_0059787_398_1522 | 367 |
| 150 | 3300014326 | Ga0157380_10003783 | Ga0157380_100037835 | 368 |
| 151 | 3300045976 | Ga0466967_0354465 | Ga0466967_0354465_276_1394 | 368 |
| 152 | 3300048907 | Ga0496104_0397901 | Ga0496104_0397901_31_1149 | 368 |
| 153 | 3300048925 | Ga0496122_0020252 | Ga0496122_0020252_3510_4628 | 368 |
| 154 | 3300053151 | Ga0500604_0002027 | Ga0500604_0002027_3383_4534 | 369 |
| 155 | 3300010375 | Ga0105239_10000005 | Ga0105239_1000000589 | 370 |
| 156 | 3300046616 | Ga0495668_0016027 | Ga0495668_0016027_1287_2438 | 370 |
| 157 | 3300005329 | Ga0070683_100277054 | Ga0070683_1002770542 | 371 |
| 158 | 3300025912 | Ga0207707_10099904 | Ga0207707_100999043 | 371 |
| 159 | 3300005563 | Ga0068855_100000026 | Ga0068855_100000026114 | 372 |
| 160 | 3300005842 | Ga0068858_100143494 | Ga0068858_1001434944 | 372 |
| 161 | iso_pu_bacteria | 2738541278 | 2738726834 | 372 |
| 162 | 3300003322 | rootL2_10031349 | rootL2_100313494 | 373 |
| 163 | 3300003323 | rootH1_10084594 | rootH1_100845944 | 373 |
| 164 | 3300033180 | Ga0307510_10001560 | Ga0307510_1000156015 | 373 |
| 165 | 3300046518 | Ga0495631_0014580 | Ga0495631_0014580_290_1468 | 373 |
| 166 | 3300003320 | rootH2_10004884 | rootH2_1000488420 | 374 |
| 167 | 3300003322 | rootL2_10011341 | rootL2_100113416 | 374 |
| 168 | 3300003323 | rootH1_10023758 | rootH1_1002375816 | 374 |
| 169 | 3300025304 | Ga0209257_1000005 | Ga0209257_1000005662 | 374 |
| 170 | 3300046460 | Ga0495638_0000005 | Ga0495638_0000005_7195_8331 | 374 |
| 171 | 3300046474 | Ga0495605_0049459 | Ga0495605_0049459_784_1953 | 374 |
| 172 | 3300046500 | Ga0495596_0000124 | Ga0495596_0000124_50878_52047 | 374 |
| 173 | 3300046518 | Ga0495631_0009750 | Ga0495631_0009750_3506_4675 | 374 |
| 174 | 3300047320 | Ga0495672_0041356 | Ga0495672_0041356_1314_2483 | 374 |
| 175 | 3300053153 | Ga0500616_0000003 | Ga0500616_0000003_546060_547196 | 374 |
| 176 | 3300003320 | rootH2_10015000 | rootH2_100150005 | 375 |
| 177 | 3300003322 | rootL2_10086330 | rootL2_100863303 | 375 |
| 178 | 3300042004 | Ga0439445_0026350 | Ga0439445_0026350_21_1214 | 375 |
| 179 | 3300046474 | Ga0495605_0014922 | Ga0495605_0014922_236_1435 | 375 |
| 180 | 3300046491 | Ga0495584_0009056 | Ga0495584_0009056_3686_4885 | 375 |
| 181 | 3300046528 | Ga0495642_0014944 | Ga0495642_0014944_436_1635 | 375 |
| 182 | 3300046530 | Ga0495654_0010155 | Ga0495654_0010155_2036_3235 | 375 |
| 183 | 3300046542 | Ga0495597_0004121 | Ga0495597_0004121_3660_4859 | 375 |
| 184 | 3300046616 | Ga0495668_0003783 | Ga0495668_0003783_4521_5720 | 375 |
| 185 | 3300047320 | Ga0495672_0014559 | Ga0495672_0014559_3045_4244 | 375 |
| 186 | 3300053156 | Ga0500622_0000026 | Ga0500622_0000026_132433_133572 | 375 |
| 187 | 3300053156 | Ga0500622_0000209 | Ga0500622_0000209_16567_17754 | 375 |
| 188 | 3300025246 | Ga0209646_1000850 | Ga0209646_10008505 | 376 |
| 189 | 3300046542 | Ga0495597_0001003 | Ga0495597_0001003_1166_2359 | 376 |
| 190 | 3300049523 | Ga0501300_002368 | Ga0501300_002368_1047_2192 | 376 |
| 191 | 3300049661 | Ga0501217_000671 | Ga0501217_000671_647_1792 | 376 |
| 192 | 3300005329 | Ga0070683_100164710 | Ga0070683_1001647102 | 377 |
| 193 | 3300005334 | Ga0068869_100020348 | Ga0068869_1000203482 | 377 |
| 194 | 3300005347 | Ga0070668_100157693 | Ga0070668_1001576932 | 377 |
| 195 | 3300005471 | Ga0070698_100001455 | Ga0070698_10000145528 | 377 |
| 196 | 3300025913 | Ga0207695_10111166 | Ga0207695_101111662 | 377 |
| 197 | 3300025942 | Ga0207689_10001881 | Ga0207689_100018816 | 377 |
| 198 | 3300025944 | Ga0207661_10087566 | Ga0207661_100875662 | 377 |
| 199 | 3300025961 | Ga0207712_10352895 | Ga0207712_103528951 | 377 |
| 200 | 3300031548 | Ga0307408_100028082 | Ga0307408_1000280823 | 377 |
| 201 | 3300031852 | Ga0307410_10150747 | Ga0307410_101507472 | 377 |
| 202 | 3300042007 | Ga0439449_0054576 | Ga0439449_0054576_34_1179 | 377 |
| 203 | 3300044673 | Ga0453683_0111493 | Ga0453683_0111493_283_1428 | 377 |
| 204 | 3300044712 | Ga0453684_0004510 | Ga0453684_0004510_219_1352 | 377 |
| 205 | 3300045051 | Ga0451576_0107073 | Ga0451576_0107073_1512_2645 | 377 |
| 206 | 3300046506 | Ga0495583_0012063 | Ga0495583_0012063_2614_3783 | 377 |
| 207 | 3300046794 | Ga0495589_0005904 | Ga0495589_0005904_1017_2195 | 377 |
| 208 | 3300049653 | Ga0501206_000632 | Ga0501206_000632_1055_2206 | 377 |
| 209 | 3300049669 | Ga0501235_006045 | Ga0501235_006045_731_1882 | 377 |
| 210 | 3300005328 | Ga0070676_10002132 | Ga0070676_100021326 | 378 |
| 211 | 3300005331 | Ga0070670_100100845 | Ga0070670_1001008453 | 378 |
| 212 | 3300005334 | Ga0068869_100014641 | Ga0068869_1000146414 | 378 |
| 213 | 3300005335 | Ga0070666_10082293 | Ga0070666_100822932 | 378 |
| 214 | 3300005338 | Ga0068868_100072151 | Ga0068868_1000721513 | 378 |
| 215 | 3300005356 | Ga0070674_100033110 | Ga0070674_1000331103 | 378 |
| 216 | 3300005364 | Ga0070673_100034994 | Ga0070673_1000349944 | 378 |
| 217 | 3300005367 | Ga0070667_100012291 | Ga0070667_1000122918 | 378 |
| 218 | 3300005456 | Ga0070678_100004411 | Ga0070678_1000044116 | 378 |
| 219 | 3300005459 | Ga0068867_100009802 | Ga0068867_1000098025 | 378 |
| 220 | 3300005543 | Ga0070672_100007653 | Ga0070672_1000076533 | 378 |
| 221 | 3300005548 | Ga0070665_100014393 | Ga0070665_1000143938 | 378 |
| 222 | 3300005719 | Ga0068861_100054532 | Ga0068861_1000545321 | 378 |
| 223 | 3300005843 | Ga0068860_100015121 | Ga0068860_1000151213 | 378 |
| 224 | 3300005843 | Ga0068860_100019471 | Ga0068860_1000194712 | 378 |
| 225 | 3300006237 | Ga0097621_100009954 | Ga0097621_1000099548 | 378 |
| 226 | 3300009553 | Ga0105249_10474636 | Ga0105249_104746361 | 378 |
| 227 | 3300011119 | Ga0105246_10007130 | Ga0105246_100071302 | 378 |
| 228 | 3300013306 | Ga0163162_10394957 | Ga0163162_103949571 | 378 |
| 229 | 3300013308 | Ga0157375_10286845 | Ga0157375_102868452 | 378 |
| 230 | 3300025907 | Ga0207645_10004292 | Ga0207645_100042925 | 378 |
| 231 | 3300025934 | Ga0207686_10089531 | Ga0207686_100895312 | 378 |
| 232 | 3300025937 | Ga0207669_10050581 | Ga0207669_100505814 | 378 |
| 233 | 3300026023 | Ga0207677_10082522 | Ga0207677_100825222 | 378 |
| 234 | 3300026089 | Ga0207648_10025722 | Ga0207648_100257224 | 378 |
| 235 | 3300026118 | Ga0207675_100022631 | Ga0207675_1000226315 | 378 |
| 236 | 3300026121 | Ga0207683_10001021 | Ga0207683_100010216 | 378 |
| 237 | 3300028381 | Ga0268264_10024179 | Ga0268264_100241795 | 378 |
| 238 | 3300028381 | Ga0268264_10060219 | Ga0268264_100602193 | 378 |
| 239 | 3300048091 | Ga0495626_0019691 | Ga0495626_0019691_1657_2850 | 378 |
| 240 | 3300003316 | rootH1_10127745 | rootH1_101277452 | 379 |
| 241 | 3300005293 | Ga0065715_10098050 | Ga0065715_100980504 | 379 |
| 242 | 3300005330 | Ga0070690_100030687 | Ga0070690_1000306872 | 380 |
| 243 | 3300005367 | Ga0070667_100161659 | Ga0070667_1001616591 | 380 |
| 244 | 3300006195 | Ga0075366_10023277 | Ga0075366_100232774 | 380 |
| 245 | 3300006237 | Ga0097621_100042603 | Ga0097621_1000426031 | 380 |
| 246 | 3300006358 | Ga0068871_100012267 | Ga0068871_1000122673 | 380 |
| 247 | 3300006881 | Ga0068865_100132762 | Ga0068865_1001327622 | 380 |
| 248 | 3300009176 | Ga0105242_10060097 | Ga0105242_100600972 | 380 |
| 249 | 3300013296 | Ga0157374_10013841 | Ga0157374_100138414 | 380 |
| 250 | 3300013306 | Ga0163162_10121971 | Ga0163162_101219712 | 380 |
| 251 | 3300013308 | Ga0157375_10036434 | Ga0157375_100364341 | 380 |
| 252 | 3300014968 | Ga0157379_10091038 | Ga0157379_100910382 | 380 |
| 253 | 3300014969 | Ga0157376_10030408 | Ga0157376_100304084 | 380 |
| 254 | 3300017792 | Ga0163161_10114886 | Ga0163161_101148862 | 380 |
| 255 | 3300025938 | Ga0207704_10028507 | Ga0207704_100285072 | 380 |
| 256 | 3300025986 | Ga0207658_10088173 | Ga0207658_100881731 | 380 |
| 257 | 3300035724 | Ga0373933_0155071 | Ga0373933_0155071_139_1299 | 380 |
| 258 | 3300036401 | Ga0373937_0017152 | Ga0373937_0017152_459_1619 | 380 |
| 259 | 3300046454 | Ga0495592_0131680 | Ga0495592_0131680_468_1628 | 380 |
| 260 | 3300046514 | Ga0495618_0086296 | Ga0495618_0086296_460_1620 | 380 |
| 261 | 3300046516 | Ga0495628_0009671 | Ga0495628_0009671_1535_2695 | 380 |
| 262 | 3300046535 | Ga0495586_0078389 | Ga0495586_0078389_189_1349 | 380 |
| 263 | 3300050493 | nmdc:mga0k408_6037_c1 | nmdc:mga0k408_6037_c1_1155_2318 | 380 |
| 264 | iso_pu_bacteria | 2945977869 | 2945983817 | 380 |
| 265 | iso_pu_bacteria | 2946013367 | 2946016789 | 380 |
| 266 | iso_pu_bacteria | 2884791551 | 2884792654 | 381 |
| 267 | iso_pu_bacteria | 2929177148 | 2929181410 | 381 |
| 268 | 3300006178 | Ga0075367_10070283 | Ga0075367_100702832 | 382 |
| 269 | 3300049591 | Ga0501075_0095748 | Ga0501075_0095748_52_1260 | 382 |
| 270 | 3300003323 | rootH1_10041599 | rootH1_100415992 | 383 |
| 271 | 3300046558 | Ga0495633_0003014 | Ga0495633_0003014_1570_2772 | 383 |
| 272 | iso_pu_bacteria | 2513237082 | 2513553372 | 383 |
| 273 | iso_pu_bacteria | 2513237083 | 2513559701 | 383 |
| 274 | iso_pu_bacteria | 2585428059 | 2587744484 | 383 |
| 275 | iso_pu_bacteria | 2643221664 | 2644354653 | 383 |
| 276 | iso_pu_bacteria | 2929154850 | 2929155814 | 383 |
| 277 | iso_pu_bacteria | 8003955200 | 8003956454 | 383 |
| 278 | 3300003791 | Ga0055530_10006610 | Ga0055530_100066106 | 384 |
| 279 | 3300013102 | Ga0157371_10029310 | Ga0157371_100293102 | 384 |
| 280 | 3300025295 | Ga0209564_1002289 | Ga0209564_10022895 | 384 |
| 281 | 3300025297 | Ga0209758_1005538 | Ga0209758_10055385 | 384 |
| 282 | iso_pu_bacteria | 2512564039 | 2512733994 | 384 |
| 283 | iso_pu_bacteria | 2956897341 | 2956900889 | 384 |
| 284 | 3300003323 | rootH1_10166306 | rootH1_101663061 | 385 |
| 285 | 3300003759 | Ga0055525_1000009 | Ga0055525_1000009143 | 385 |
| 286 | 3300005327 | Ga0070658_10136194 | Ga0070658_101361943 | 385 |
| 287 | 3300005366 | Ga0070659_100027108 | Ga0070659_1000271083 | 385 |
| 288 | 3300005843 | Ga0068860_100079657 | Ga0068860_1000796573 | 385 |
| 289 | 3300009093 | Ga0105240_10120565 | Ga0105240_101205652 | 385 |
| 290 | 3300025230 | Ga0209563_100015 | Ga0209563_100015257 | 385 |
| 291 | 3300025917 | Ga0207660_10052691 | Ga0207660_100526914 | 385 |
| 292 | 3300025919 | Ga0207657_10005979 | Ga0207657_100059794 | 385 |
| 293 | 3300025932 | Ga0207690_10071474 | Ga0207690_100714742 | 385 |
| 294 | 3300026116 | Ga0207674_10219992 | Ga0207674_102199922 | 385 |
| 295 | 3300037312 | Ga0395899_0004379 | Ga0395899_0004379_4384_5553 | 385 |
| 296 | 3300037418 | Ga0395900_0001209 | Ga0395900_0001209_858_2027 | 385 |
| 297 | 3300037418 | Ga0395900_0114198 | Ga0395900_0114198_1513_2688 | 385 |
| 298 | 3300037466 | Ga0395898_0061766 | Ga0395898_0061766_1607_2782 | 385 |
| 299 | 3300037471 | Ga0395905_0002119 | Ga0395905_0002119_9782_10954 | 385 |
| 300 | 3300038443 | Ga0395901_0110687 | Ga0395901_0110687_1504_2679 | 385 |
| 301 | 3300044901 | Ga0466960_0094560 | Ga0466960_0094560_201_1376 | 385 |
| 302 | 3300046459 | Ga0495629_0000013 | Ga0495629_0000013_84799_85974 | 385 |
| 303 | 3300046522 | Ga0495643_0011945 | Ga0495643_0011945_1758_2951 | 385 |
| 304 | 3300046522 | Ga0495643_0025240 | Ga0495643_0025240_1187_2359 | 385 |
| 305 | 3300046528 | Ga0495642_0031562 | Ga0495642_0031562_779_1951 | 385 |
| 306 | 3300046538 | Ga0495609_0000719 | Ga0495609_0000719_12055_13224 | 385 |
| 307 | 3300046665 | Ga0495661_0002030 | Ga0495661_0002030_4641_5813 | 385 |
| 308 | 3300047443 | Ga0495687_032539 | Ga0495687_032539_248_1420 | 385 |
| 309 | 3300048927 | Ga0496124_0011548 | Ga0496124_0011548_5608_6777 | 385 |
| 310 | 3300048928 | Ga0496125_0090806 | Ga0496125_0090806_788_1957 | 385 |
| 311 | 3300003215 | JGI25153J46596_10013210 | JGI25153J46596_100132102 | 387 |
| 312 | 3300003316 | rootH1_10022091 | rootH1_100220912 | 387 |
| 313 | 3300003322 | rootL2_10141411 | rootL2_101414112 | 387 |
| 314 | 3300025297 | Ga0209758_1001139 | Ga0209758_100113916 | 387 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7z6m-assembly1.cif.gz_A-2 | crystal structure of zn2+-transporter bbzip in a cadmium bound state | 0.377 | 68 | 363 |
| 7z6m-assembly1.cif.gz_A-2 | crystal structure of zn2+-transporter bbzip in a cadmium bound state | 0.3684 | 68 | 363 |
| 5tsa-assembly1.cif.gz_A | crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ | 0.3487 | 68 | 363 |
| 5xls-assembly1.cif.gz_A-2 | crystal structure of uraa in occluded conformation | 0.3407 | 1 | 386 |
| 5xls-assembly1.cif.gz_A-2 | crystal structure of uraa in occluded conformation | 0.3398 | 1 | 386 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4IG60_54_549_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.3019 | 9 | 381 | 1.20.1730.10 |
| af_A4IG60_54_549_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.294 | 9 | 381 | 1.20.1730.10 |
| af_Q2FW63_9_491_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.2894 | 9 | 382 | 1.20.1740.10 |
| af_F1RC11_226_494_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2884 | 112 | 382 | 1.20.1250.20 |
| af_Q92367_68_515_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.2851 | 54 | 383 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7W8Z1-F1-model_v4 | Chromate transporter | 0.9651 | 8 | 385 |
GO:0005886
GO:0015109 |
| AF-A0A4P8EC36-F1-model_v4 | deleted | 0.9541 | 1 | 387 |
|
| AF-A0A535KX82-F1-model_v4 | Chromate transporter | 0.9515 | 2 | 94 |
GO:0005886
GO:0015109 |
| AF-A0A4P8EC36-F1-model_v4 | deleted | 0.9493 | 1 | 387 |
|
| AF-A0A2V7T0F9-F1-model_v4 | Chromate transporter | 0.9409 | 11 | 387 |
GO:0005886
GO:0015109 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar