F402507

General Info

Members Datasets Scaffolds Average Seq Length
314 215 302 372

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10127745|rootH1_101277452
Length 412
Sequence MAGRKDYTNSKSCSIFFKTGVVALSRYLTMAMNTKPAYSLKDLCLYFLRLGTLGFGGPVALVGYMHRDLVENRKWISEDDYREGLALSQLAPGPLAAQLGIYLGYVHHGVVGATLAGAAFVLPSFLMVIVIGWTYVQYGGLPWMQAVFYGVGAAVIGIITISSYKLTTKSIGKDALLWGIFIVLAFMTFWFEEEMIALILAGGIVVWLVKAPPTWLRTSAHGILPGLLAQVQVVTFESKLWQIAWFFTKAGAFVFGSGLAIVPFLYGGVVKEYGWLNEQEFVDAVAVAMITPGPVVITVRFIGYLVAGFWGAVVAALATFIPCYLFTVIPAPYFKKYGKHPAIKAFVDGITAAAIGAIAGAVIVLGKRTLTDIPTILIALTTAIILFRFKKLQEPYVIIVAAMVGILLKTLL

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
3 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
4 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
5 2643221664 Massilia sp. Root418 Isolate Unclassified
6 2738541278 Niastella sp. CF465 Isolate Unclassified
7 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
8 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
9 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
10 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
11 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
12 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
138 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
184 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
189 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
197 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
200 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
208 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
209 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
210 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
214 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
215 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 0
Isolates 4.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.28
Nodule 0.96
Rhizoplane 0.32
Rhizosphere 79.62
Stem 0
Stem Tuber 0
Unclassified 10.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10013210 3300003215 Unclassified 3507
2 rootH1_10008657 3300003316 Bacteria 22351
3 rootH1_10022091 3300003316 Bacteria 2028
4 rootH1_10093218 3300003316 Bacteria 2106
5 rootH1_10127745 3300003316 Bacteria 2679
6 rootH2_10004884 3300003320 Bacteria 33742
7 rootH2_10015000 3300003320 Bacteria 6048
8 rootL2_10005465 3300003322 Bacteria 11419
9 rootL2_10011341 3300003322 Bacteria 13979
10 rootL2_10030290 3300003322 Bacteria 7640
11 rootL2_10031349 3300003322 Bacteria 5197
12 rootL2_10036338 3300003322 Bacteria 2260
13 rootL2_10086330 3300003322 Bacteria 2879
14 rootL2_10141411 3300003322 Bacteria 2369
15 rootH1_10000778 3300003323 Bacteria 106851
16 rootH1_10006023 3300003323 Bacteria 26459
17 rootH1_10023758 3300003323 Bacteria 38885
18 rootH1_10041599 3300003323 Bacteria 3912
19 rootH1_10055568 3300003316 Bacteria 3133
20 rootH1_10055568 3300003323 Bacteria 17832
21 rootH1_10084594 3300003323 Bacteria 6224
22 rootH1_10166306 3300003323 Bacteria 1565
23 Ga0055525_1000009 3300003759 Bacteria 596899
24 Ga0055530_10006610 3300003791 Bacteria 5130
25 Ga0065715_10098050 3300005293 Bacteria 3601
26 Ga0070658_10136194 3300005327 Bacteria 2049
27 Ga0070676_10002132 3300005328 Bacteria 10078
28 Ga0070683_100164710 3300005329 Bacteria 2103
29 Ga0070683_100277054 3300005329 Bacteria 1596
30 Ga0070690_100030687 3300005330 Unclassified 3343
31 Ga0070670_100100845 3300005331 Bacteria 2486
32 Ga0070670_100392180 3300005331 Bacteria 1224
33 Ga0068869_100010288 3300005334 Bacteria 6097
34 Ga0068869_100014641 3300005334 Bacteria 5244
35 Ga0068869_100020348 3300005334 Unclassified 4549
36 Ga0070666_10082293 3300005335 Bacteria 2202
37 Ga0068868_100002758 3300005338 Bacteria 12165
38 Ga0068868_100072151 3300005338 Bacteria 2754
39 Ga0070687_100148897 3300005343 Bacteria 1372
40 Ga0070668_100157693 3300005347 Bacteria 1840
41 Ga0070675_100392351 3300005354 Bacteria 1237
42 Ga0070671_100025656 3300005355 Bacteria 4838
43 Ga0070671_100183898 3300005355 Unclassified 1770
44 Ga0070674_100033110 3300005356 Bacteria 3438
45 Ga0070673_100034994 3300005364 Bacteria 3806
46 Ga0070659_100027108 3300005366 Bacteria 4411
47 Ga0070667_100012291 3300005367 Bacteria 7083
48 Ga0070667_100161659 3300005367 Bacteria 1973
49 Ga0070714_100004717 3300005435 Bacteria 10311
50 Ga0070678_100004411 3300005456 Bacteria 7976
51 Ga0070662_100005823 3300005457 Bacteria 7905
52 Ga0068867_100009802 3300005459 Bacteria 6750
53 Ga0068867_100023009 3300005459 Bacteria 4459
54 Ga0068867_100062600 3300005459 Bacteria 2765
55 Ga0070698_100001455 3300005471 Bacteria 26296
56 Ga0070679_100331556 3300005530 Bacteria 1470
57 Ga0070684_100120469 3300005535 Bacteria 2360
58 Ga0068853_100049065 3300005539 Bacteria 3627
59 Ga0068853_100146826 3300005539 Bacteria 2120
60 Ga0070672_100007653 3300005543 Bacteria 7350
61 Ga0070665_100014393 3300005548 Bacteria 7939
62 Ga0068855_100000026 3300005563 Bacteria 175140
63 Ga0068855_100005488 3300005563 Bacteria 15473
64 Ga0068857_100017073 3300005577 Bacteria 6358
65 Ga0068857_100222252 3300005577 Unclassified 1725
66 Ga0068856_100219821 3300005614 Unclassified 1915
67 Ga0070702_100055310 3300005615 Bacteria 2288
68 Ga0068852_100130210 3300005616 Bacteria 2316
69 Ga0068852_100437766 3300005616 Bacteria 1292
70 Ga0068864_100240583 3300005618 Unclassified 1677
71 Ga0068861_100054532 3300005719 Bacteria 3046
72 Ga0068858_100143494 3300005842 Unclassified 2242
73 Ga0068858_100324888 3300005842 Bacteria 1471
74 Ga0068860_100015121 3300005843 Bacteria 7542
75 Ga0068860_100019471 3300005843 Bacteria 6581
76 Ga0068860_100079657 3300005843 Bacteria 3115
77 Ga0068862_100144977 3300005844 Bacteria 2110
78 Ga0070717_10234571 3300006028 Bacteria 1616
79 Ga0075367_10070283 3300006178 Bacteria 2104
80 Ga0075366_10023277 3300006195 Bacteria 3609
81 Ga0097621_100009954 3300006237 Bacteria 6930
82 Ga0097621_100042603 3300006237 Unclassified 3657
83 Ga0068871_100012267 3300006358 Bacteria 6312
84 Ga0068871_100015521 3300006358 Bacteria 5704
85 Ga0068865_100132762 3300006881 Bacteria 1867
86 Ga0075435_100080630 3300007076 Bacteria 2672
87 Ga0105240_10005905 3300009093 Bacteria 18134
88 Ga0105240_10120565 3300009093 Plasmid 3158
89 Ga0111539_10008271 3300009094 Bacteria 13241
90 Ga0105247_10015701 3300009101 Bacteria 4534
91 Ga0114129_10000629 3300009147 Bacteria 43924
92 Ga0114129_10234396 3300009147 Bacteria 2471
93 Ga0105241_10012018 3300009174 Bacteria 6359
94 Ga0105242_10001449 3300009176 Bacteria 18668
95 Ga0105242_10060097 3300009176 Unclassified 3121
96 Ga0105238_10029622 3300009551 Bacteria 5575
97 Ga0105249_10474636 3300009553 Unclassified 1293
98 Ga0105239_10000005 3300010375 Bacteria 496066
99 Ga0105246_10007130 3300011119 Bacteria 6843
100 Ga0157371_10029310 3300013102 Bacteria 3982
101 Ga0157374_10013841 3300013296 Bacteria 7047
102 Ga0157374_10046874 3300013296 Bacteria 4005
103 Ga0157378_10025897 3300013297 Bacteria 5168
104 Ga0157378_10032947 3300013297 Bacteria 4580
105 Ga0157378_10056754 3300013297 Bacteria 3490
106 Ga0163162_10009737 3300013306 Bacteria 9353
107 Ga0163162_10121971 3300013306 Unclassified 2711
108 Ga0163162_10330069 3300013306 Bacteria 1658
109 Ga0163162_10394957 3300013306 Unclassified 1515
110 Ga0157375_10036434 3300013308 Bacteria 4706
111 Ga0157375_10061298 3300013308 Unclassified 3734
112 Ga0157375_10259340 3300013308 Bacteria 1900
113 Ga0157375_10286845 3300013308 Unclassified 1809
114 Ga0157375_10453251 3300013308 Bacteria 1448
115 Ga0157380_10003783 3300014326 Bacteria 10406
116 Ga0157380_10040194 3300014326 Bacteria 3641
117 Ga0157377_10058223 3300014745 Bacteria 2200
118 Ga0157379_10091038 3300014968 Bacteria 2736
119 Ga0157376_10030408 3300014969 Unclassified 4312
120 Ga0163161_10059424 3300017792 Unclassified 2780
121 Ga0163161_10102612 3300017792 Bacteria 2130
122 Ga0163161_10114886 3300017792 Bacteria 2017
123 Ga0209563_100015 3300025230 Bacteria 879901
124 Ga0209646_1000850 3300025246 Bacteria 10231
125 Ga0209564_1002289 3300025295 Bacteria 15606
126 Ga0209758_1001139 3300025297 Bacteria 34076
127 Ga0209758_1005538 3300025297 Bacteria 9636
128 Ga0209050_1001982 3300025298 Bacteria 19199
129 Ga0209050_1014316 3300025298 Bacteria 3428
130 Ga0207426_1040115 3300025302 Bacteria 1461
131 Ga0209257_1000005 3300025304 Bacteria 1592528
132 Ga0207710_10014438 3300025900 Unclassified 3331
133 Ga0207645_10004292 3300025907 Bacteria 10577
134 Ga0207654_10018668 3300025911 Bacteria 3643
135 Ga0207707_10099904 3300025912 Bacteria 2536
136 Ga0207695_10006727 3300025913 Bacteria 14837
137 Ga0207695_10111166 3300025913 Plasmid 2719
138 Ga0207660_10052691 3300025917 Bacteria 2897
139 Ga0207657_10005979 3300025919 Bacteria 12664
140 Ga0207694_10024162 3300025924 Bacteria 4615
141 Ga0207659_10171968 3300025926 Bacteria 1710
142 Ga0207700_10070356 3300025928 Bacteria 2689
143 Ga0207664_10035890 3300025929 Bacteria 3828
144 Ga0207690_10071474 3300025932 Bacteria 2393
145 Ga0207706_10003615 3300025933 Bacteria 14774
146 Ga0207686_10001540 3300025934 Bacteria 12993
147 Ga0207686_10089531 3300025934 Unclassified 2029
148 Ga0207669_10050581 3300025937 Unclassified 2485
149 Ga0207704_10028507 3300025938 Bacteria 3099
150 Ga0207689_10001881 3300025942 Bacteria 19847
151 Ga0207689_10006314 3300025942 Bacteria 10500
152 Ga0207661_10087566 3300025944 Bacteria 2587
153 Ga0207667_10026309 3300025949 Bacteria 6359
154 Ga0207712_10078364 3300025961 Bacteria 2398
155 Ga0207712_10352895 3300025961 Bacteria 1223
156 Ga0207658_10088173 3300025986 Bacteria 2398
157 Ga0207677_10019445 3300026023 Bacteria 4101
158 Ga0207677_10082522 3300026023 Bacteria 2310
159 Ga0207677_10130088 3300026023 Bacteria 1910
160 Ga0207639_10039453 3300026041 Bacteria 3519
161 Ga0207648_10012173 3300026089 Bacteria 8061
162 Ga0207648_10025722 3300026089 Bacteria 5239
163 Ga0207674_10219992 3300026116 Bacteria 1847
164 Ga0207674_10255613 3300026116 Unclassified 1699
165 Ga0207675_100022631 3300026118 Bacteria 5850
166 Ga0207675_100078124 3300026118 Bacteria 3101
167 Ga0207683_10001021 3300026121 Bacteria 25523
168 Ga0268264_10024179 3300028381 Bacteria 4958
169 Ga0268264_10060219 3300028381 Bacteria 3182
170 Ga0307515_10000003 3300028794 Bacteria 891317
171 Ga0307515_10155902 3300028794 Bacteria 2357
172 Ga0307513_10041139 3300031456 Bacteria 5105
173 Ga0307513_10054257 3300031456 Bacteria 4299
174 Ga0307408_100028082 3300031548 Bacteria 3885
175 Ga0307413_10014318 3300031824 Bacteria 4023
176 Ga0307410_10150747 3300031852 Bacteria 1731
177 Ga0307416_100011813 3300032002 Bacteria 5850
178 Ga0307414_10003357 3300032004 Bacteria 8547
179 Ga0307414_10034348 3300032004 Bacteria 3361
180 Ga0307411_10000007 3300032005 Bacteria 332057
181 Ga0307415_100038209 3300032126 Bacteria 3162
182 Ga0307510_10001560 3300033180 Bacteria 25328
183 Ga0373927_0015369 3300035695 Bacteria 5058
184 Ga0373933_0155071 3300035724 Bacteria 1452
185 Ga0373937_0017152 3300036401 Bacteria 6444
186 Ga0373937_0378771 3300036401 Bacteria 1342
187 Ga0395899_0000017 3300037312 Bacteria 440179
188 Ga0395899_0004379 3300037312 Bacteria 11008
189 Ga0395900_0001209 3300037418 Bacteria 31961
190 Ga0395900_0059787 3300037418 Bacteria 3923
191 Ga0395900_0114198 3300037418 Bacteria 2771
192 Ga0395898_0061766 3300037466 Bacteria 3640
193 Ga0395905_0002119 3300037471 Bacteria 22523
194 Ga0395905_0002196 3300037471 Bacteria 22050
195 Ga0395901_0110687 3300038443 Bacteria 2883
196 Ga0439447_002912 3300041407 Bacteria 6128
197 Ga0439445_0026350 3300042004 Bacteria 1488
198 Ga0439449_0054576 3300042007 Bacteria 1476
199 Ga0466969_0000399 3300044656 Bacteria 23843
200 Ga0466972_0021517 3300044658 Bacteria 3214
201 Ga0453683_0111493 3300044673 Unclassified 1720
202 Ga0453684_0004510 3300044712 Bacteria 29232
203 Ga0466970_0007553 3300044765 Bacteria 5453
204 Ga0466957_0038498 3300044842 Unclassified 2881
205 Ga0466957_0078873 3300044842 Bacteria 2048
206 Ga0466960_0094560 3300044901 Bacteria 1529
207 Ga0451576_0107073 3300045051 Bacteria 2908
208 Ga0466967_0354465 3300045976 Bacteria 1421
209 Ga0495592_0131680 3300046454 Bacteria 1749
210 Ga0495629_0000013 3300046459 Bacteria 212317
211 Ga0495638_0000005 3300046460 Bacteria 680627
212 Ga0495605_0014922 3300046474 Bacteria 4237
213 Ga0495605_0049459 3300046474 Bacteria 2054
214 Ga0495605_0058515 3300046474 Bacteria 1852
215 Ga0495639_0040486 3300046475 Bacteria 2096
216 Ga0495584_0009056 3300046491 Bacteria 5141
217 Ga0495594_0027869 3300046499 Bacteria 3046
218 Ga0495596_0000124 3300046500 Bacteria 53005
219 Ga0495607_0000898 3300046501 Bacteria 27713
220 Ga0495583_0000308 3300046506 Bacteria 77290
221 Ga0495583_0012063 3300046506 Bacteria 4921
222 Ga0495616_0011306 3300046513 Bacteria 5123
223 Ga0495618_0086296 3300046514 Bacteria 2007
224 Ga0495628_0009671 3300046516 Bacteria 8227
225 Ga0495631_0000880 3300046518 Bacteria 18795
226 Ga0495631_0009750 3300046518 Bacteria 4783
227 Ga0495631_0014580 3300046518 Bacteria 3787
228 Ga0495632_0001593 3300046519 Bacteria 18701
229 Ga0495632_0004640 3300046519 Bacteria 9290
230 Ga0495643_0003499 3300046522 Bacteria 11442
231 Ga0495643_0011945 3300046522 Bacteria 5259
232 Ga0495643_0025240 3300046522 Bacteria 3364
233 Ga0495648_0011080 3300046524 Bacteria 6826
234 Ga0495666_0001522 3300046526 Bacteria 11351
235 Ga0495642_0014944 3300046528 Bacteria 3013
236 Ga0495642_0031562 3300046528 Bacteria 2124
237 Ga0495654_0010155 3300046530 Bacteria 5133
238 Ga0495640_0049398 3300046533 Bacteria 2901
239 Ga0495586_0078389 3300046535 Bacteria 1813
240 Ga0495609_0000719 3300046538 Bacteria 25215
241 Ga0495609_0002400 3300046538 Bacteria 11528
242 Ga0495597_0001003 3300046542 Bacteria 21651
243 Ga0495597_0004121 3300046542 Bacteria 8091
244 Ga0495633_0003014 3300046558 Bacteria 11484
245 Ga0495668_0003783 3300046616 Bacteria 11088
246 Ga0495668_0016027 3300046616 Bacteria 4364
247 Ga0495668_0019205 3300046616 Bacteria 3943
248 Ga0495611_0004618 3300046648 Bacteria 5924
249 Ga0495661_0002030 3300046665 Bacteria 15940
250 Ga0495661_0004457 3300046665 Bacteria 10104
251 Ga0495661_0006159 3300046665 Bacteria 8441
252 Ga0495661_0018352 3300046665 Bacteria 4603
253 Ga0495649_0044307 3300046694 Bacteria 2429
254 Ga0495589_0005904 3300046794 Bacteria 6463
255 Ga0495660_0020392 3300046810 Bacteria 3799
256 Ga0495604_0007326 3300047317 Bacteria 8737
257 Ga0495672_0014559 3300047320 Bacteria 5379
258 Ga0495672_0041356 3300047320 Bacteria 2788
259 Ga0495676_0036132 3300047321 Bacteria 4128
260 Ga0495683_0016610 3300047323 Bacteria 3821
261 Ga0495687_032539 3300047443 Bacteria 2378
262 Ga0495675_0013020 3300047444 Bacteria 5244
263 Ga0495677_0000584 3300047445 Bacteria 14980
264 Ga0495677_0000807 3300047445 Bacteria 12654
265 Ga0495679_014984 3300047446 Bacteria 2850
266 Ga0495681_0005969 3300047470 Bacteria 8075
267 Ga0495626_0004859 3300048091 Bacteria 8086
268 Ga0495626_0013130 3300048091 Bacteria 4315
269 Ga0495626_0019691 3300048091 Bacteria 3371
270 Ga0495626_0020370 3300048091 Bacteria 3306
271 Ga0496104_0397901 3300048907 Bacteria 1290
272 Ga0496122_0020252 3300048925 Bacteria 6023
273 Ga0496124_0011548 3300048927 Bacteria 8812
274 Ga0496125_0090806 3300048928 Bacteria 2291
275 Ga0501300_002368 3300049523 Unclassified 2813
276 Ga0501300_004633 3300049523 Bacteria 2034
277 Ga0501075_0095748 3300049591 Bacteria 2253
278 Ga0501206_000632 3300049653 Bacteria 4236
279 Ga0501217_000671 3300049661 Bacteria 5820
280 Ga0501235_006045 3300049669 Bacteria 2635
281 Ga0501249_001116 3300049679 Bacteria 5665
282 Ga0501266_000010 3300049763 Bacteria 214932
283 nmdc:mga0k408_6037_c1 3300050493 Bacteria 6456
284 nmdc:mga05p37_990_c1 3300050507 Bacteria 6835
285 nmdc:mga08y16_16854_c1 3300050511 Bacteria 7691
286 nmdc:mga08y16_413507_c1 3300050511 Unclassified 1379
287 nmdc:mga0n895_49087_c1 3300050512 Bacteria 4133
288 nmdc:mga0n895_9708_c1 3300050512 Bacteria 8440
289 nmdc:mga0rr50_239768_c1 3300050513 Bacteria 1503
290 nmdc:mga0a205_49182_c1 3300050515 Bacteria 4069
291 Ga0500578_0046579 3300053086 Bacteria 2782
292 Ga0500658_0000004 3300053134 Bacteria 457801
293 Ga0500568_0003983 3300053139 Bacteria 8025
294 Ga0500604_0002027 3300053151 Bacteria 5599
295 Ga0500604_0052824 3300053151 Bacteria 1259
296 Ga0500616_0000003 3300053153 Bacteria 1220687
297 Ga0500616_0018000 3300053153 Bacteria 3999
298 Ga0500622_0000026 3300053156 Bacteria 235660
299 Ga0500622_0000209 3300053156 Bacteria 61889
300 Ga0500622_0003046 3300053156 Bacteria 11579
301 Ga0500611_000010 3300053727 Bacteria 165151
302 Ga0500645_054846 3300053730 Bacteria 1158

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025926 Ga0207659_10171968 Ga0207659_101719681 300
2 3300026118 Ga0207675_100078124 Ga0207675_1000781243 312
3 3300005844 Ga0068862_100144977 Ga0068862_1001449772 315
4 3300013308 Ga0157375_10259340 Ga0157375_102593402 322
5 3300005618 Ga0068864_100240583 Ga0068864_1002405832 324
6 3300009176 Ga0105242_10001449 Ga0105242_100014495 324
7 3300025934 Ga0207686_10001540 Ga0207686_100015404 324
8 3300005355 Ga0070671_100183898 Ga0070671_1001838981 327
9 3300017792 Ga0163161_10059424 Ga0163161_100594242 327
10 3300053156 Ga0500622_0003046 Ga0500622_0003046_2491_3654 329
11 3300036401 Ga0373937_0378771 Ga0373937_0378771_61_1224 330
12 3300037312 Ga0395899_0000017 Ga0395899_0000017_10782_11945 330
13 3300005343 Ga0070687_100148897 Ga0070687_1001488971 331
14 3300005354 Ga0070675_100392351 Ga0070675_1003923511 331
15 3300005355 Ga0070671_100025656 Ga0070671_1000256562 331
16 3300005615 Ga0070702_100055310 Ga0070702_1000553102 331
17 3300005616 Ga0068852_100437766 Ga0068852_1004377661 331
18 3300013308 Ga0157375_10453251 Ga0157375_104532511 331
19 3300025298 Ga0209050_1001982 Ga0209050_10019824 331
20 3300025302 Ga0207426_1040115 Ga0207426_10401151 331
21 3300026023 Ga0207677_10130088 Ga0207677_101300882 331
22 3300046499 Ga0495594_0027869 Ga0495594_0027869_1344_2507 331
23 3300031456 Ga0307513_10054257 Ga0307513_100542572 333
24 3300050512 nmdc:mga0n895_9708_c1 nmdc:mga0n895_9708_c1_5143_6255 335
25 3300050513 nmdc:mga0rr50_239768_c1 nmdc:mga0rr50_239768_c1_234_1346 335
26 3300050515 nmdc:mga0a205_49182_c1 nmdc:mga0a205_49182_c1_275_1387 335
27 3300044765 Ga0466970_0007553 Ga0466970_0007553_73_1203 337
28 3300007076 Ga0075435_100080630 Ga0075435_1000806302 338
29 3300053730 Ga0500645_054846 Ga0500645_054846_22_1086 340
30 3300006358 Ga0068871_100015521 Ga0068871_1000155212 341
31 3300013297 Ga0157378_10025897 Ga0157378_100258975 341
32 3300025961 Ga0207712_10078364 Ga0207712_100783642 342
33 3300032005 Ga0307411_10000007 Ga0307411_1000000775 342
34 3300041407 Ga0439447_002912 Ga0439447_002912_1044_2213 342
35 3300044842 Ga0466957_0078873 Ga0466957_0078873_477_1595 342
36 3300049763 Ga0501266_000010 Ga0501266_000010_170837_172006 342
37 3300053134 Ga0500658_0000004 Ga0500658_0000004_363356_364525 342
38 3300009101 Ga0105247_10015701 Ga0105247_100157012 343
39 3300025900 Ga0207710_10014438 Ga0207710_100144383 344
40 3300037471 Ga0395905_0002196 Ga0395905_0002196_13003_14178 344
41 3300003323 rootH1_10006023 rootH1_1000602310 345
42 3300005459 Ga0068867_100062600 Ga0068867_1000626004 345
43 3300009147 Ga0114129_10000629 Ga0114129_1000062917 345
44 3300013297 Ga0157378_10032947 Ga0157378_100329475 345
45 3300014326 Ga0157380_10040194 Ga0157380_100401942 345
46 3300050507 nmdc:mga05p37_990_c1 nmdc:mga05p37_990_c1_1997_3136 345
47 3300053151 Ga0500604_0052824 Ga0500604_0052824_24_1067 345
48 3300044656 Ga0466969_0000399 Ga0466969_0000399_1851_2987 346
49 3300049679 Ga0501249_001116 Ga0501249_001116_1502_2671 346
50 3300046524 Ga0495648_0011080 Ga0495648_0011080_4043_5224 347
51 3300046538 Ga0495609_0002400 Ga0495609_0002400_3019_4200 347
52 3300046665 Ga0495661_0004457 Ga0495661_0004457_7895_9076 347
53 3300053139 Ga0500568_0003983 Ga0500568_0003983_6715_7854 347
54 3300035695 Ga0373927_0015369 Ga0373927_0015369_1021_2199 348
55 3300046474 Ga0495605_0058515 Ga0495605_0058515_221_1399 348
56 3300005334 Ga0068869_100010288 Ga0068869_1000102885 349
57 3300005338 Ga0068868_100002758 Ga0068868_1000027587 349
58 3300005457 Ga0070662_100005823 Ga0070662_1000058233 349
59 3300005459 Ga0068867_100023009 Ga0068867_1000230091 349
60 3300005539 Ga0068853_100146826 Ga0068853_1001468261 349
61 3300013296 Ga0157374_10046874 Ga0157374_100468742 349
62 3300013306 Ga0163162_10009737 Ga0163162_100097375 349
63 3300014745 Ga0157377_10058223 Ga0157377_100582231 349
64 3300009093 Ga0105240_10005905 Ga0105240_100059058 350
65 3300017792 Ga0163161_10102612 Ga0163161_101026122 350
66 3300025933 Ga0207706_10003615 Ga0207706_100036157 350
67 3300025942 Ga0207689_10006314 Ga0207689_100063145 350
68 3300026023 Ga0207677_10019445 Ga0207677_100194453 350
69 3300026089 Ga0207648_10012173 Ga0207648_100121734 350
70 3300046475 Ga0495639_0040486 Ga0495639_0040486_698_1762 350
71 3300047317 Ga0495604_0007326 Ga0495604_0007326_2350_3495 350
72 3300047321 Ga0495676_0036132 Ga0495676_0036132_3033_4097 350
73 3300049523 Ga0501300_004633 Ga0501300_004633_367_1515 350
74 3300005331 Ga0070670_100392180 Ga0070670_1003921801 351
75 3300005842 Ga0068858_100324888 Ga0068858_1003248881 351
76 3300044658 Ga0466972_0021517 Ga0466972_0021517_482_1618 352
77 3300047445 Ga0495677_0000807 Ga0495677_0000807_832_2010 352
78 3300053086 Ga0500578_0046579 Ga0500578_0046579_115_1248 353
79 3300053153 Ga0500616_0018000 Ga0500616_0018000_761_1897 353
80 3300003322 rootL2_10036338 rootL2_100363383 354
81 3300044842 Ga0466957_0038498 Ga0466957_0038498_1418_2557 354
82 3300003316 rootH1_10008657 rootH1_100086577 355
83 3300003322 rootL2_10005465 rootL2_1000546511 355
84 3300003322 rootL2_10030290 rootL2_100302906 355
85 3300003323 rootH1_10055568 rootH1_1005556811 355
86 3300005530 Ga0070679_100331556 Ga0070679_1003315561 355
87 3300005539 Ga0068853_100049065 Ga0068853_1000490653 355
88 3300005616 Ga0068852_100130210 Ga0068852_1001302104 355
89 3300009174 Ga0105241_10012018 Ga0105241_100120183 355
90 3300009551 Ga0105238_10029622 Ga0105238_100296223 355
91 3300025911 Ga0207654_10018668 Ga0207654_100186683 355
92 3300025924 Ga0207694_10024162 Ga0207694_100241623 355
93 3300026041 Ga0207639_10039453 Ga0207639_100394533 355
94 3300028794 Ga0307515_10155902 Ga0307515_101559022 355
95 3300032004 Ga0307414_10034348 Ga0307414_100343483 355
96 3300003323 rootH1_10000778 rootH1_1000077828 356
97 3300031456 Ga0307513_10041139 Ga0307513_100411392 356
98 3300046506 Ga0495583_0000308 Ga0495583_0000308_63808_64986 357
99 3300046513 Ga0495616_0011306 Ga0495616_0011306_1694_2872 357
100 3300046518 Ga0495631_0000880 Ga0495631_0000880_7666_8844 357
101 3300046519 Ga0495632_0004640 Ga0495632_0004640_3775_4953 357
102 3300046616 Ga0495668_0019205 Ga0495668_0019205_1814_2992 357
103 3300046648 Ga0495611_0004618 Ga0495611_0004618_4649_5827 357
104 3300046665 Ga0495661_0018352 Ga0495661_0018352_3183_4361 357
105 3300046810 Ga0495660_0020392 Ga0495660_0020392_49_1227 357
106 3300047323 Ga0495683_0016610 Ga0495683_0016610_1275_2453 357
107 3300047446 Ga0495679_014984 Ga0495679_014984_1632_2810 357
108 3300047470 Ga0495681_0005969 Ga0495681_0005969_4655_5833 357
109 3300046526 Ga0495666_0001522 Ga0495666_0001522_7357_8526 358
110 3300046533 Ga0495640_0049398 Ga0495640_0049398_551_1720 358
111 3300046694 Ga0495649_0044307 Ga0495649_0044307_166_1356 358
112 3300047444 Ga0495675_0013020 Ga0495675_0013020_2868_4037 358
113 3300050511 nmdc:mga08y16_413507_c1 nmdc:mga08y16_413507_c1_113_1264 358
114 3300013297 Ga0157378_10056754 Ga0157378_100567544 359
115 3300013308 Ga0157375_10061298 Ga0157375_100612982 359
116 3300048091 Ga0495626_0004859 Ga0495626_0004859_6258_7436 359
117 3300048091 Ga0495626_0020370 Ga0495626_0020370_1802_2983 360
118 3300053727 Ga0500611_000010 Ga0500611_000010_103303_104397 360
119 3300032004 Ga0307414_10003357 Ga0307414_100033574 361
120 3300046501 Ga0495607_0000898 Ga0495607_0000898_11382_12563 361
121 3300048091 Ga0495626_0013130 Ga0495626_0013130_168_1346 361
122 3300003316 rootH1_10093218 rootH1_100932182 362
123 3300005577 Ga0068857_100017073 Ga0068857_1000170733 362
124 3300032002 Ga0307416_100011813 Ga0307416_1000118132 362
125 3300032126 Ga0307415_100038209 Ga0307415_1000382093 362
126 3300046519 Ga0495632_0001593 Ga0495632_0001593_10881_12062 362
127 3300046522 Ga0495643_0003499 Ga0495643_0003499_2822_4003 362
128 3300046665 Ga0495661_0006159 Ga0495661_0006159_6306_7487 362
129 3300047445 Ga0495677_0000584 Ga0495677_0000584_1875_3056 362
130 3300050512 nmdc:mga0n895_49087_c1 nmdc:mga0n895_49087_c1_2950_4107 362
131 3300009094 Ga0111539_10008271 Ga0111539_1000827110 364
132 3300028794 Ga0307515_10000003 Ga0307515_10000003312 364
133 3300050511 nmdc:mga08y16_16854_c1 nmdc:mga08y16_16854_c1_1194_2351 364
134 3300009147 Ga0114129_10234396 Ga0114129_102343962 365
135 3300013306 Ga0163162_10330069 Ga0163162_103300692 365
136 3300025298 Ga0209050_1014316 Ga0209050_10143163 365
137 3300005577 Ga0068857_100222252 Ga0068857_1002222522 366
138 3300005614 Ga0068856_100219821 Ga0068856_1002198212 366
139 3300026116 Ga0207674_10255613 Ga0207674_102556131 366
140 3300005435 Ga0070714_100004717 Ga0070714_1000047175 367
141 3300005535 Ga0070684_100120469 Ga0070684_1001204694 367
142 3300005563 Ga0068855_100005488 Ga0068855_1000054888 367
143 3300006028 Ga0070717_10234571 Ga0070717_102345712 367
144 3300025913 Ga0207695_10006727 Ga0207695_100067278 367
145 3300025928 Ga0207700_10070356 Ga0207700_100703562 367
146 3300025929 Ga0207664_10035890 Ga0207664_100358902 367
147 3300025949 Ga0207667_10026309 Ga0207667_100263098 367
148 3300031824 Ga0307413_10014318 Ga0307413_100143183 367
149 3300037418 Ga0395900_0059787 Ga0395900_0059787_398_1522 367
150 3300014326 Ga0157380_10003783 Ga0157380_100037835 368
151 3300045976 Ga0466967_0354465 Ga0466967_0354465_276_1394 368
152 3300048907 Ga0496104_0397901 Ga0496104_0397901_31_1149 368
153 3300048925 Ga0496122_0020252 Ga0496122_0020252_3510_4628 368
154 3300053151 Ga0500604_0002027 Ga0500604_0002027_3383_4534 369
155 3300010375 Ga0105239_10000005 Ga0105239_1000000589 370
156 3300046616 Ga0495668_0016027 Ga0495668_0016027_1287_2438 370
157 3300005329 Ga0070683_100277054 Ga0070683_1002770542 371
158 3300025912 Ga0207707_10099904 Ga0207707_100999043 371
159 3300005563 Ga0068855_100000026 Ga0068855_100000026114 372
160 3300005842 Ga0068858_100143494 Ga0068858_1001434944 372
161 iso_pu_bacteria 2738541278 2738726834 372
162 3300003322 rootL2_10031349 rootL2_100313494 373
163 3300003323 rootH1_10084594 rootH1_100845944 373
164 3300033180 Ga0307510_10001560 Ga0307510_1000156015 373
165 3300046518 Ga0495631_0014580 Ga0495631_0014580_290_1468 373
166 3300003320 rootH2_10004884 rootH2_1000488420 374
167 3300003322 rootL2_10011341 rootL2_100113416 374
168 3300003323 rootH1_10023758 rootH1_1002375816 374
169 3300025304 Ga0209257_1000005 Ga0209257_1000005662 374
170 3300046460 Ga0495638_0000005 Ga0495638_0000005_7195_8331 374
171 3300046474 Ga0495605_0049459 Ga0495605_0049459_784_1953 374
172 3300046500 Ga0495596_0000124 Ga0495596_0000124_50878_52047 374
173 3300046518 Ga0495631_0009750 Ga0495631_0009750_3506_4675 374
174 3300047320 Ga0495672_0041356 Ga0495672_0041356_1314_2483 374
175 3300053153 Ga0500616_0000003 Ga0500616_0000003_546060_547196 374
176 3300003320 rootH2_10015000 rootH2_100150005 375
177 3300003322 rootL2_10086330 rootL2_100863303 375
178 3300042004 Ga0439445_0026350 Ga0439445_0026350_21_1214 375
179 3300046474 Ga0495605_0014922 Ga0495605_0014922_236_1435 375
180 3300046491 Ga0495584_0009056 Ga0495584_0009056_3686_4885 375
181 3300046528 Ga0495642_0014944 Ga0495642_0014944_436_1635 375
182 3300046530 Ga0495654_0010155 Ga0495654_0010155_2036_3235 375
183 3300046542 Ga0495597_0004121 Ga0495597_0004121_3660_4859 375
184 3300046616 Ga0495668_0003783 Ga0495668_0003783_4521_5720 375
185 3300047320 Ga0495672_0014559 Ga0495672_0014559_3045_4244 375
186 3300053156 Ga0500622_0000026 Ga0500622_0000026_132433_133572 375
187 3300053156 Ga0500622_0000209 Ga0500622_0000209_16567_17754 375
188 3300025246 Ga0209646_1000850 Ga0209646_10008505 376
189 3300046542 Ga0495597_0001003 Ga0495597_0001003_1166_2359 376
190 3300049523 Ga0501300_002368 Ga0501300_002368_1047_2192 376
191 3300049661 Ga0501217_000671 Ga0501217_000671_647_1792 376
192 3300005329 Ga0070683_100164710 Ga0070683_1001647102 377
193 3300005334 Ga0068869_100020348 Ga0068869_1000203482 377
194 3300005347 Ga0070668_100157693 Ga0070668_1001576932 377
195 3300005471 Ga0070698_100001455 Ga0070698_10000145528 377
196 3300025913 Ga0207695_10111166 Ga0207695_101111662 377
197 3300025942 Ga0207689_10001881 Ga0207689_100018816 377
198 3300025944 Ga0207661_10087566 Ga0207661_100875662 377
199 3300025961 Ga0207712_10352895 Ga0207712_103528951 377
200 3300031548 Ga0307408_100028082 Ga0307408_1000280823 377
201 3300031852 Ga0307410_10150747 Ga0307410_101507472 377
202 3300042007 Ga0439449_0054576 Ga0439449_0054576_34_1179 377
203 3300044673 Ga0453683_0111493 Ga0453683_0111493_283_1428 377
204 3300044712 Ga0453684_0004510 Ga0453684_0004510_219_1352 377
205 3300045051 Ga0451576_0107073 Ga0451576_0107073_1512_2645 377
206 3300046506 Ga0495583_0012063 Ga0495583_0012063_2614_3783 377
207 3300046794 Ga0495589_0005904 Ga0495589_0005904_1017_2195 377
208 3300049653 Ga0501206_000632 Ga0501206_000632_1055_2206 377
209 3300049669 Ga0501235_006045 Ga0501235_006045_731_1882 377
210 3300005328 Ga0070676_10002132 Ga0070676_100021326 378
211 3300005331 Ga0070670_100100845 Ga0070670_1001008453 378
212 3300005334 Ga0068869_100014641 Ga0068869_1000146414 378
213 3300005335 Ga0070666_10082293 Ga0070666_100822932 378
214 3300005338 Ga0068868_100072151 Ga0068868_1000721513 378
215 3300005356 Ga0070674_100033110 Ga0070674_1000331103 378
216 3300005364 Ga0070673_100034994 Ga0070673_1000349944 378
217 3300005367 Ga0070667_100012291 Ga0070667_1000122918 378
218 3300005456 Ga0070678_100004411 Ga0070678_1000044116 378
219 3300005459 Ga0068867_100009802 Ga0068867_1000098025 378
220 3300005543 Ga0070672_100007653 Ga0070672_1000076533 378
221 3300005548 Ga0070665_100014393 Ga0070665_1000143938 378
222 3300005719 Ga0068861_100054532 Ga0068861_1000545321 378
223 3300005843 Ga0068860_100015121 Ga0068860_1000151213 378
224 3300005843 Ga0068860_100019471 Ga0068860_1000194712 378
225 3300006237 Ga0097621_100009954 Ga0097621_1000099548 378
226 3300009553 Ga0105249_10474636 Ga0105249_104746361 378
227 3300011119 Ga0105246_10007130 Ga0105246_100071302 378
228 3300013306 Ga0163162_10394957 Ga0163162_103949571 378
229 3300013308 Ga0157375_10286845 Ga0157375_102868452 378
230 3300025907 Ga0207645_10004292 Ga0207645_100042925 378
231 3300025934 Ga0207686_10089531 Ga0207686_100895312 378
232 3300025937 Ga0207669_10050581 Ga0207669_100505814 378
233 3300026023 Ga0207677_10082522 Ga0207677_100825222 378
234 3300026089 Ga0207648_10025722 Ga0207648_100257224 378
235 3300026118 Ga0207675_100022631 Ga0207675_1000226315 378
236 3300026121 Ga0207683_10001021 Ga0207683_100010216 378
237 3300028381 Ga0268264_10024179 Ga0268264_100241795 378
238 3300028381 Ga0268264_10060219 Ga0268264_100602193 378
239 3300048091 Ga0495626_0019691 Ga0495626_0019691_1657_2850 378
240 3300003316 rootH1_10127745 rootH1_101277452 379
241 3300005293 Ga0065715_10098050 Ga0065715_100980504 379
242 3300005330 Ga0070690_100030687 Ga0070690_1000306872 380
243 3300005367 Ga0070667_100161659 Ga0070667_1001616591 380
244 3300006195 Ga0075366_10023277 Ga0075366_100232774 380
245 3300006237 Ga0097621_100042603 Ga0097621_1000426031 380
246 3300006358 Ga0068871_100012267 Ga0068871_1000122673 380
247 3300006881 Ga0068865_100132762 Ga0068865_1001327622 380
248 3300009176 Ga0105242_10060097 Ga0105242_100600972 380
249 3300013296 Ga0157374_10013841 Ga0157374_100138414 380
250 3300013306 Ga0163162_10121971 Ga0163162_101219712 380
251 3300013308 Ga0157375_10036434 Ga0157375_100364341 380
252 3300014968 Ga0157379_10091038 Ga0157379_100910382 380
253 3300014969 Ga0157376_10030408 Ga0157376_100304084 380
254 3300017792 Ga0163161_10114886 Ga0163161_101148862 380
255 3300025938 Ga0207704_10028507 Ga0207704_100285072 380
256 3300025986 Ga0207658_10088173 Ga0207658_100881731 380
257 3300035724 Ga0373933_0155071 Ga0373933_0155071_139_1299 380
258 3300036401 Ga0373937_0017152 Ga0373937_0017152_459_1619 380
259 3300046454 Ga0495592_0131680 Ga0495592_0131680_468_1628 380
260 3300046514 Ga0495618_0086296 Ga0495618_0086296_460_1620 380
261 3300046516 Ga0495628_0009671 Ga0495628_0009671_1535_2695 380
262 3300046535 Ga0495586_0078389 Ga0495586_0078389_189_1349 380
263 3300050493 nmdc:mga0k408_6037_c1 nmdc:mga0k408_6037_c1_1155_2318 380
264 iso_pu_bacteria 2945977869 2945983817 380
265 iso_pu_bacteria 2946013367 2946016789 380
266 iso_pu_bacteria 2884791551 2884792654 381
267 iso_pu_bacteria 2929177148 2929181410 381
268 3300006178 Ga0075367_10070283 Ga0075367_100702832 382
269 3300049591 Ga0501075_0095748 Ga0501075_0095748_52_1260 382
270 3300003323 rootH1_10041599 rootH1_100415992 383
271 3300046558 Ga0495633_0003014 Ga0495633_0003014_1570_2772 383
272 iso_pu_bacteria 2513237082 2513553372 383
273 iso_pu_bacteria 2513237083 2513559701 383
274 iso_pu_bacteria 2585428059 2587744484 383
275 iso_pu_bacteria 2643221664 2644354653 383
276 iso_pu_bacteria 2929154850 2929155814 383
277 iso_pu_bacteria 8003955200 8003956454 383
278 3300003791 Ga0055530_10006610 Ga0055530_100066106 384
279 3300013102 Ga0157371_10029310 Ga0157371_100293102 384
280 3300025295 Ga0209564_1002289 Ga0209564_10022895 384
281 3300025297 Ga0209758_1005538 Ga0209758_10055385 384
282 iso_pu_bacteria 2512564039 2512733994 384
283 iso_pu_bacteria 2956897341 2956900889 384
284 3300003323 rootH1_10166306 rootH1_101663061 385
285 3300003759 Ga0055525_1000009 Ga0055525_1000009143 385
286 3300005327 Ga0070658_10136194 Ga0070658_101361943 385
287 3300005366 Ga0070659_100027108 Ga0070659_1000271083 385
288 3300005843 Ga0068860_100079657 Ga0068860_1000796573 385
289 3300009093 Ga0105240_10120565 Ga0105240_101205652 385
290 3300025230 Ga0209563_100015 Ga0209563_100015257 385
291 3300025917 Ga0207660_10052691 Ga0207660_100526914 385
292 3300025919 Ga0207657_10005979 Ga0207657_100059794 385
293 3300025932 Ga0207690_10071474 Ga0207690_100714742 385
294 3300026116 Ga0207674_10219992 Ga0207674_102199922 385
295 3300037312 Ga0395899_0004379 Ga0395899_0004379_4384_5553 385
296 3300037418 Ga0395900_0001209 Ga0395900_0001209_858_2027 385
297 3300037418 Ga0395900_0114198 Ga0395900_0114198_1513_2688 385
298 3300037466 Ga0395898_0061766 Ga0395898_0061766_1607_2782 385
299 3300037471 Ga0395905_0002119 Ga0395905_0002119_9782_10954 385
300 3300038443 Ga0395901_0110687 Ga0395901_0110687_1504_2679 385
301 3300044901 Ga0466960_0094560 Ga0466960_0094560_201_1376 385
302 3300046459 Ga0495629_0000013 Ga0495629_0000013_84799_85974 385
303 3300046522 Ga0495643_0011945 Ga0495643_0011945_1758_2951 385
304 3300046522 Ga0495643_0025240 Ga0495643_0025240_1187_2359 385
305 3300046528 Ga0495642_0031562 Ga0495642_0031562_779_1951 385
306 3300046538 Ga0495609_0000719 Ga0495609_0000719_12055_13224 385
307 3300046665 Ga0495661_0002030 Ga0495661_0002030_4641_5813 385
308 3300047443 Ga0495687_032539 Ga0495687_032539_248_1420 385
309 3300048927 Ga0496124_0011548 Ga0496124_0011548_5608_6777 385
310 3300048928 Ga0496125_0090806 Ga0496125_0090806_788_1957 385
311 3300003215 JGI25153J46596_10013210 JGI25153J46596_100132102 387
312 3300003316 rootH1_10022091 rootH1_100220912 387
313 3300003322 rootL2_10141411 rootL2_101414112 387
314 3300025297 Ga0209758_1001139 Ga0209758_100113916 387

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

241

406

0.97

PF02417

Chromate_transp

Chromate transporter

41

207

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z6m-assembly1.cif.gz_A-2 crystal structure of zn2+-transporter bbzip in a cadmium bound state 0.377 68 363
7z6m-assembly1.cif.gz_A-2 crystal structure of zn2+-transporter bbzip in a cadmium bound state 0.3684 68 363
5tsa-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ 0.3487 68 363
5xls-assembly1.cif.gz_A-2 crystal structure of uraa in occluded conformation 0.3407 1 386
5xls-assembly1.cif.gz_A-2 crystal structure of uraa in occluded conformation 0.3398 1 386
ID Description Score Start End Superfamily
af_A4IG60_54_549_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.3019 9 381 1.20.1730.10
af_A4IG60_54_549_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.294 9 381 1.20.1730.10
af_Q2FW63_9_491_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.2894 9 382 1.20.1740.10
af_F1RC11_226_494_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2884 112 382 1.20.1250.20
af_Q92367_68_515_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.2851 54 383 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A2V7W8Z1-F1-model_v4 Chromate transporter 0.9651 8 385 GO:0005886
GO:0015109
AF-A0A4P8EC36-F1-model_v4 deleted 0.9541 1 387
AF-A0A535KX82-F1-model_v4 Chromate transporter 0.9515 2 94 GO:0005886
GO:0015109
AF-A0A4P8EC36-F1-model_v4 deleted 0.9493 1 387
AF-A0A2V7T0F9-F1-model_v4 Chromate transporter 0.9409 11 387 GO:0005886
GO:0015109

Feature Viewer

pLDDT pTM Quality
75.71 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map