F402425

General Info

Members Datasets Scaffolds Average Seq Length
313 228 284 317

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_32639_c1|nmdc:mga06z11_32639_c1_740_1777
Length 345
Sequence MKKSTCFITYSSCSLHAAWKIWKSRMSDIDRVVRSNLKLKHLQLIVALDEFRHLGRSAEFLSLTQPAVSKSLAEIERMFGLDLFVRSTRGTEPTAYGEKVARFARSVLADFDRTRDDIAMVASGGAGRIRVGAMVVATTSLLAGAVEQLKKQSPHTTVSVEEGDLTRLLPRLRVGELDFIVGRLEPGYAAPDLETEALYTEPMCVVVAPDHALARLRKPAWADLAVHPWVVPPAWASSRVKLNQVFYKHGLQPPPDIIETASFLVTLTFLRQRRCVGFVARDVARFLASERLARALPLEVPIELPPVGLIMLRGGLRTPAGARLVDAIRSVARRVSSAQPRPRAA

Samples

Sample ID Description Type Environment
1 2511231015 Pseudomonas sp. GM49 Isolate Nodule
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
7 2643221609 Acidovorax sp. Root217 Isolate Unclassified
8 2643221611 Acidovorax sp. Root219 Isolate Unclassified
9 2643221621 Achromobacter sp. Root83 Isolate Unclassified
10 2643221658 Variovorax sp. Root411 Isolate Unclassified
11 2643221672 Variovorax sp. Root434 Isolate Unclassified
12 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
13 2831864461 Roseateles noduli HZ7 Isolate Nodule
14 2842677519 Variovorax sp. R-72495 Isolate Unclassified
15 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
16 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
17 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
18 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
19 2904456579 Variovorax sp. 2002 Isolate Unclassified
20 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
21 2928070936 Variovorax gossypii 1167 Isolate Unclassified
22 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
23 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
24 2929520902 Variovorax beijingensis 502 Isolate Unclassified
25 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
26 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
27 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
28 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
37 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
111 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
116 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
117 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
118 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
119 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
120 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
121 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
122 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
142 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
147 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
148 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
151 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
157 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
158 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
203 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
217 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
218 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
219 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
220 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
221 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
222 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
223 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
226 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
227 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
228 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.42
Metatranscriptomes 0.32
Isolates 9.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.07
Nodule 1.6
Rhizoplane 1.92
Rhizosphere 53.35
Stem 0
Stem Tuber 0
Unclassified 14.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10003335 3300003187 Bacteria 8899
2 rootH1_10039828 3300003316 Bacteria 3338
3 rootH2_10017886 3300003320 Bacteria 6964
4 rootL2_10000180 3300003322 Bacteria 87226
5 rootH1_10019495 3300003323 Bacteria 26145
6 Ga0006562J51391_1139586 3300003578 Bacteria 3680
7 Ga0055525_1000036 3300003759 Bacteria 298878
8 Ga0055529_1000806 3300003763 Bacteria 19128
9 Ga0055526_1011324 3300003771 Bacteria 4033
10 Ga0055524_1000123 3300003775 Bacteria 90603
11 Ga0055540_1001224 3300003792 Bacteria 15781
12 Ga0055531_10001112 3300003794 Bacteria 20889
13 Ga0055531_10006039 3300003794 Bacteria 6945
14 Ga0055543_1002841 3300004625 Bacteria 5460
15 Ga0065165_1000476 3300005262 Bacteria 62550
16 Ga0065714_10106115 3300005288 Bacteria 1555
17 Ga0070676_10059572 3300005328 Bacteria 2265
18 Ga0070675_100091157 3300005354 Bacteria 2553
19 Ga0070674_100064424 3300005356 Bacteria 2568
20 Ga0070678_100046111 3300005456 Bacteria 3123
21 Ga0070662_100022761 3300005457 Bacteria 4295
22 Ga0070706_100002762 3300005467 Bacteria 17556
23 Ga0070699_100089246 3300005518 Bacteria 2693
24 Ga0070672_100057426 3300005543 Bacteria 3055
25 Ga0070672_100075397 3300005543 Bacteria 2693
26 Ga0070665_100018477 3300005548 Bacteria 6988
27 Ga0068857_100155474 3300005577 Bacteria 2073
28 Ga0068854_100024099 3300005578 Bacteria 4163
29 Ga0068862_100051232 3300005844 Bacteria 3530
30 Ga0081455_10097318 3300005937 Bacteria 2371
31 Ga0075365_10185220 3300006038 Bacteria 1456
32 Ga0075363_100078200 3300006048 Bacteria 1806
33 Ga0075364_10006140 3300006051 Bacteria 7030
34 Ga0075364_10032181 3300006051 Bacteria 3370
35 Ga0075364_10045109 3300006051 Bacteria 2869
36 Ga0075432_10000502 3300006058 Bacteria 11734
37 Ga0075362_10001104 3300006177 Bacteria 8380
38 Ga0075362_10024948 3300006177 Bacteria 2540
39 Ga0075367_10003811 3300006178 Bacteria 7268
40 Ga0075367_10012736 3300006178 Bacteria 4499
41 Ga0075369_10016716 3300006186 Bacteria 2964
42 Ga0075369_10022029 3300006186 Bacteria 2625
43 Ga0075369_10047027 3300006186 Bacteria 1860
44 Ga0075366_10016512 3300006195 Bacteria 4246
45 Ga0075366_10018002 3300006195 Bacteria 4076
46 Ga0075366_10039455 3300006195 Bacteria 2792
47 Ga0075366_10053983 3300006195 Bacteria 2387
48 Ga0075370_10007482 3300006353 Bacteria 5565
49 Ga0075370_10009595 3300006353 Bacteria 5033
50 Ga0075370_10015938 3300006353 Bacteria 4035
51 Ga0075370_10037926 3300006353 Bacteria 2711
52 Ga0075370_10048945 3300006353 Bacteria 2395
53 Ga0075370_10060946 3300006353 Bacteria 2150
54 Ga0075370_10109825 3300006353 Bacteria 1601
55 Ga0075429_100002378 3300006880 Bacteria 15843
56 Ga0099823_1000061 3300006944 Bacteria 52139
57 Ga0099826_10063652 3300006948 Bacteria 2382
58 Ga0105251_10004346 3300009011 Bacteria 9693
59 Ga0105244_10011395 3300009036 Bacteria 5335
60 Ga0105244_10023673 3300009036 Bacteria 3364
61 Ga0105245_10185815 3300009098 Bacteria 1988
62 Ga0114129_10080603 3300009147 Bacteria 4524
63 Ga0105243_10003512 3300009148 Bacteria 12663
64 Ga0105243_10069711 3300009148 Bacteria 2837
65 Ga0105237_10043943 3300009545 Bacteria 4499
66 Ga0105239_10022095 3300010375 Bacteria 7013
67 Ga0105246_10041734 3300011119 Bacteria 3103
68 Ga0105246_10335364 3300011119 Bacteria 1234
69 Ga0157319_1000004 3300012497 Bacteria 394735
70 Ga0157373_10005691 3300013100 Bacteria 9340
71 Ga0182008_10004020 3300014497 Bacteria 8686
72 Ga0183362_10002 3300015683 Bacteria 1432711
73 Ga0209674_104281 3300025226 Bacteria 2356
74 Ga0209563_100014 3300025230 Bacteria 940582
75 Ga0209129_1002051 3300025258 Bacteria 10387
76 Ga0209673_1002563 3300025273 Bacteria 12371
77 Ga0209675_1018517 3300025291 Bacteria 1947
78 Ga0209676_1001506 3300025292 Bacteria 21245
79 Ga0209676_1012330 3300025292 Bacteria 3369
80 Ga0209025_1000424 3300025294 Bacteria 83948
81 Ga0209564_1000021 3300025295 Bacteria 571316
82 Ga0209050_1001049 3300025298 Bacteria 34100
83 Ga0209050_1018184 3300025298 Bacteria 2745
84 Ga0209256_1000085 3300025299 Bacteria 219043
85 Ga0209256_1002081 3300025299 Bacteria 17580
86 Ga0209051_1000182 3300025303 Bacteria 113251
87 Ga0209051_1001201 3300025303 Bacteria 23394
88 Ga0209051_1004362 3300025303 Bacteria 8760
89 Ga0209257_1000351 3300025304 Bacteria 94766
90 Ga0209257_1000397 3300025304 Bacteria 85732
91 Ga0209257_1003108 3300025304 Bacteria 14868
92 Ga0207655_1000006 3300025728 Bacteria 861092
93 Ga0207713_1013791 3300025735 Bacteria 4236
94 Ga0207688_10043245 3300025901 Bacteria 2508
95 Ga0207645_10085381 3300025907 Bacteria 2027
96 Ga0207643_10140011 3300025908 Bacteria 1445
97 Ga0207684_10004381 3300025910 Bacteria 13322
98 Ga0207646_10212396 3300025922 Bacteria 1747
99 Ga0207681_10218524 3300025923 Bacteria 1473
100 Ga0207687_10071601 3300025927 Bacteria 2477
101 Ga0207706_10040136 3300025933 Bacteria 4148
102 Ga0207706_10145849 3300025933 Bacteria 2082
103 Ga0207709_10003266 3300025935 Bacteria 9727
104 Ga0207691_10396371 3300025940 Bacteria 1177
105 Ga0207651_10075050 3300025960 Bacteria 2411
106 Ga0207639_10053013 3300026041 Bacteria 3093
107 Ga0207648_10297321 3300026089 Bacteria 1447
108 Ga0207648_10354564 3300026089 Bacteria 1323
109 Ga0207683_10120810 3300026121 Bacteria 2351
110 Ga0207698_10098696 3300026142 Bacteria 2414
111 Ga0209389_1006837 3300027296 Bacteria 9970
112 Ga0209371_1013640 3300027312 Bacteria 2268
113 Ga0268266_10059901 3300028379 Bacteria 3280
114 Ga0307517_10000327 3300028786 Bacteria 82422
115 Ga0307517_10161609 3300028786 Bacteria 1501
116 Ga0307515_10000064 3300028794 Bacteria 245452
117 Ga0307515_10000150 3300028794 Bacteria 169644
118 Ga0307515_10011385 3300028794 Bacteria 16884
119 Ga0307515_10140104 3300028794 Bacteria 2600
120 Ga0268256_1015101 3300030500 Bacteria 2268
121 Ga0316177_1024664 3300030731 Bacteria 1246
122 Ga0314311_1173484 3300030733 Bacteria 2058
123 Ga0316179_1118416 3300030734 Bacteria 3161
124 Ga0316178_1082410 3300030735 Bacteria 3398
125 Ga0316180_1030939 3300030736 Bacteria 4444
126 Ga0316181_1049773 3300030744 Bacteria 1815
127 Ga0316182_1105450 3300030745 Bacteria 2750
128 Ga0316182_1254970 3300030745 Bacteria 4258
129 Ga0307513_10003109 3300031456 Bacteria 22657
130 Ga0307513_10273151 3300031456 Bacteria 1472
131 Ga0307509_10000795 3300031507 Bacteria 54146
132 Ga0307509_10002463 3300031507 Bacteria 29929
133 Ga0307509_10002617 3300031507 Bacteria 28807
134 Ga0307408_100007126 3300031548 Bacteria 7399
135 Ga0307408_100072505 3300031548 Bacteria 2550
136 Ga0307408_100274351 3300031548 Bacteria 1401
137 Ga0307508_10001110 3300031616 Bacteria 31159
138 Ga0307508_10009055 3300031616 Bacteria 9171
139 Ga0307514_10001710 3300031649 Bacteria 25203
140 Ga0307405_10005122 3300031731 Bacteria 6277
141 Ga0307405_10177208 3300031731 Bacteria 1527
142 Ga0307406_10001118 3300031901 Bacteria 14969
143 Ga0307412_10145265 3300031911 Bacteria 1742
144 Ga0307416_100061842 3300032002 Bacteria 3058
145 Ga0307416_100095733 3300032002 Bacteria 2565
146 Ga0307414_10153204 3300032004 Bacteria 1821
147 Ga0307411_10089064 3300032005 Bacteria 2148
148 Ga0307411_10121770 3300032005 Bacteria 1889
149 Ga0307411_10166256 3300032005 Bacteria 1659
150 Ga0307411_10204285 3300032005 Bacteria 1520
151 Ga0307507_10092780 3300033179 Bacteria 2575
152 Ga0307510_10003186 3300033180 Bacteria 19042
153 Ga0307510_10113887 3300033180 Bacteria 2435
154 Ga0395905_0000088 3300037471 Bacteria 152506
155 Ga0395905_0003111 3300037471 Bacteria 17907
156 Ga0395905_0174555 3300037471 Bacteria 2018
157 Ga0439436_0001856 3300041404 Bacteria 6241
158 Ga0439436_0011811 3300041404 Bacteria 2650
159 Ga0439439_0017000 3300041406 Bacteria 1785
160 Ga0439466_0006952 3300041411 Bacteria 4291
161 Ga0439466_0032701 3300041411 Bacteria 1771
162 Ga0439465_0002672 3300041413 Bacteria 5829
163 Ga0439431_0002113 3300041997 Bacteria 4386
164 Ga0439431_0016091 3300041997 Bacteria 1747
165 Ga0439433_0003537 3300041999 Bacteria 3356
166 Ga0439433_0030942 3300041999 Bacteria 1224
167 Ga0439445_0000110 3300042004 Bacteria 13718
168 Ga0439445_0006977 3300042004 Bacteria 2611
169 Ga0439432_015841 3300042006 Bacteria 2539
170 Ga0439432_051571 3300042006 Bacteria 1282
171 Ga0439449_0000377 3300042007 Bacteria 16423
172 Ga0439449_0008172 3300042007 Bacteria 3977
173 Ga0439452_003500 3300042010 Bacteria 5488
174 Ga0439452_009941 3300042010 Bacteria 2786
175 Ga0439454_000234 3300042011 Bacteria 3989
176 Ga0439455_0004137 3300042012 Bacteria 2851
177 Ga0439457_003218 3300042014 Bacteria 4486
178 Ga0439457_012787 3300042014 Bacteria 1889
179 Ga0450890_004992 3300042127 Bacteria 1716
180 Ga0450896_003904 3300042133 Bacteria 2004
181 Ga0439446_0017311 3300042156 Bacteria 2013
182 Ga0439446_0050696 3300042156 Bacteria 1239
183 Ga0450908_002694 3300042184 Bacteria 3466
184 Ga0439434_0012068 3300042435 Bacteria 2555
185 Ga0466963_0022900 3300044694 Bacteria 3961
186 Ga0466963_0072441 3300044694 Bacteria 2321
187 Ga0495617_001094 3300046452 Bacteria 12322
188 Ga0495627_009115 3300046453 Bacteria 3665
189 Ga0495590_0009634 3300046457 Bacteria 3663
190 Ga0495590_0070944 3300046457 Bacteria 1222
191 Ga0495629_0049899 3300046459 Bacteria 2933
192 Ga0495638_0100046 3300046460 Bacteria 1735
193 Ga0495638_0110782 3300046460 Bacteria 1631
194 Ga0495650_0001947 3300046471 Bacteria 18260
195 Ga0495605_0014375 3300046474 Bacteria 4338
196 Ga0495585_0000105 3300046492 Bacteria 89432
197 Ga0495583_0000354 3300046506 Bacteria 72235
198 Ga0495610_0012777 3300046512 Bacteria 5025
199 Ga0495616_0000266 3300046513 Bacteria 42286
200 Ga0495616_0008027 3300046513 Bacteria 6287
201 Ga0495620_0040864 3300046515 Bacteria 2038
202 Ga0495631_0000260 3300046518 Bacteria 36819
203 Ga0495632_0014851 3300046519 Bacteria 4390
204 Ga0495648_0004813 3300046524 Bacteria 11390
205 Ga0495648_0126641 3300046524 Bacteria 1364
206 Ga0495654_0015130 3300046530 Bacteria 4100
207 Ga0495598_0004446 3300046537 Bacteria 3036
208 Ga0495609_0000362 3300046538 Bacteria 39087
209 Ga0495621_0002039 3300046539 Bacteria 5336
210 Ga0495621_0014735 3300046539 Bacteria 2480
211 Ga0495597_0000481 3300046542 Bacteria 33500
212 Ga0495656_0000085 3300046615 Bacteria 41208
213 Ga0495656_0028791 3300046615 Bacteria 2230
214 Ga0495668_0059298 3300046616 Bacteria 2112
215 Ga0495625_0005297 3300046660 Bacteria 11830
216 Ga0495625_0043864 3300046660 Bacteria 3240
217 Ga0495588_0039214 3300046674 Bacteria 2412
218 Ga0495669_0011779 3300046684 Bacteria 3718
219 Ga0495670_0004698 3300046691 Bacteria 6703
220 Ga0495670_0029470 3300046691 Bacteria 2724
221 Ga0495671_0008730 3300046692 Bacteria 5690
222 Ga0495660_0000151 3300046810 Bacteria 74982
223 Ga0495672_0000671 3300047320 Bacteria 37991
224 Ga0495676_0012204 3300047321 Bacteria 7749
225 Ga0495687_007963 3300047443 Bacteria 6150
226 Ga0495677_0072423 3300047445 Bacteria 1285
227 Ga0495673_0003080 3300047469 Bacteria 11207
228 Ga0495593_0027221 3300047673 Bacteria 3148
229 Ga0495614_0006587 3300048089 Bacteria 5202
230 Ga0495626_0083458 3300048091 Bacteria 1415
231 Ga0496102_0004649 3300048905 Bacteria 11622
232 Ga0496117_0044489 3300048920 Bacteria 3216
233 Ga0496118_0056620 3300048921 Bacteria 2946
234 Ga0496121_0014575 3300048924 Bacteria 8327
235 Ga0496122_0047599 3300048925 Bacteria 3309
236 Ga0496122_0077561 3300048925 Bacteria 2332
237 Ga0496124_0010740 3300048927 Bacteria 9233
238 Ga0496125_0037869 3300048928 Bacteria 4187
239 Ga0496125_0056784 3300048928 Bacteria 3176
240 Ga0496126_0132971 3300048929 Bacteria 2148
241 Ga0495682_0009579 3300049460 Bacteria 3778
242 Ga0501225_0023223 3300049705 Bacteria 1710
243 Ga0501262_000162 3300049759 Bacteria 8223
244 nmdc:mga03683_23913_c1 3300050489 Bacteria 2385
245 nmdc:mga03683_84134_c1 3300050489 Bacteria 1378
246 nmdc:mga03n38_49545_c1 3300050490 Bacteria 1868
247 nmdc:mga00v17_15749_c1 3300050491 Bacteria 4250
248 nmdc:mga00v17_22555_c1 3300050491 Bacteria 3633
249 nmdc:mga00v17_4136_c1 3300050491 Bacteria 7510
250 nmdc:mga00v17_45878_c1 3300050491 Bacteria 2642
251 nmdc:mga00v17_90362_c1 3300050491 Bacteria 1922
252 nmdc:mga0k408_102100_c1 3300050493 Bacteria 1692
253 nmdc:mga0k408_12288_c1 3300050493 Bacteria 4678
254 nmdc:mga0k408_274_c1 3300050493 Bacteria 28068
255 nmdc:mga06z11_32639_c1 3300050494 Bacteria 2541
256 nmdc:mga07m45_101320_c1 3300050496 Bacteria 1653
257 nmdc:mga07m45_143043_c1 3300050496 Bacteria 1386
258 nmdc:mga07m45_1832_c1 3300050496 Bacteria 9814
259 nmdc:mga07m45_2224_c1 3300050496 Bacteria 9065
260 nmdc:mga07m45_300_c1 3300050496 Bacteria 19984
261 nmdc:mga05p37_195020_c1 3300050507 Bacteria 2456
262 nmdc:mga05p37_418286_c1 3300050507 Bacteria 1560
263 nmdc:mga09592_15637_c1 3300050508 Bacteria 6200
264 nmdc:mga0sz30_53839_c1 3300050516 Bacteria 1710
265 Ga0500610_0031942 3300053079 Bacteria 2678
266 Ga0500578_0088224 3300053086 Bacteria 1970
267 Ga0500643_006679 3300053087 Bacteria 4778
268 Ga0500651_0001993 3300053093 Bacteria 10596
269 Ga0500571_009714 3300053110 Bacteria 5300
270 Ga0500593_000808 3300053117 Bacteria 11711
271 Ga0500593_000828 3300053117 Bacteria 11572
272 Ga0500593_001775 3300053117 Bacteria 7756
273 Ga0500597_006539 3300053120 Bacteria 3878
274 Ga0500607_008094 3300053121 Bacteria 6421
275 Ga0500626_064966 3300053128 Bacteria 1629
276 Ga0500655_001071 3300053133 Bacteria 5258
277 Ga0500658_0000934 3300053134 Bacteria 11917
278 Ga0500658_0001155 3300053134 Bacteria 10727
279 Ga0500564_010712 3300053138 Bacteria 4028
280 Ga0500568_0006801 3300053139 Bacteria 5697
281 Ga0500619_000221 3300053154 Bacteria 12972
282 Ga0500627_0017114 3300053158 Bacteria 2842
283 Ga0500634_0004247 3300053161 Bacteria 6586
284 Ga0500634_0028903 3300053161 Bacteria 3020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046457 Ga0495590_0070944 Ga0495590_0070944_13_849 271
2 3300046460 Ga0495638_0100046 Ga0495638_0100046_820_1725 296
3 3300005328 Ga0070676_10059572 Ga0070676_100595722 302
4 3300005354 Ga0070675_100091157 Ga0070675_1000911571 302
5 3300005457 Ga0070662_100022761 Ga0070662_1000227614 302
6 3300005577 Ga0068857_100155474 Ga0068857_1001554742 302
7 3300005578 Ga0068854_100024099 Ga0068854_1000240994 302
8 3300006051 Ga0075364_10045109 Ga0075364_100451092 302
9 3300006186 Ga0075369_10047027 Ga0075369_100470272 302
10 3300006353 Ga0075370_10037926 Ga0075370_100379262 302
11 3300009098 Ga0105245_10185815 Ga0105245_101858151 302
12 3300009545 Ga0105237_10043943 Ga0105237_100439431 302
13 3300010375 Ga0105239_10022095 Ga0105239_100220954 302
14 3300025907 Ga0207645_10085381 Ga0207645_100853812 302
15 3300025927 Ga0207687_10071601 Ga0207687_100716012 302
16 3300025933 Ga0207706_10040136 Ga0207706_100401363 302
17 3300026041 Ga0207639_10053013 Ga0207639_100530132 302
18 3300026089 Ga0207648_10354564 Ga0207648_103545642 302
19 3300026142 Ga0207698_10098696 Ga0207698_100986961 302
20 3300050493 nmdc:mga0k408_102100_c1 nmdc:mga0k408_102100_c1_278_1243 302
21 3300050496 nmdc:mga07m45_2224_c1 nmdc:mga07m45_2224_c1_5531_6496 302
22 3300050516 nmdc:mga0sz30_53839_c1 nmdc:mga0sz30_53839_c1_601_1566 302
23 iso_pu_bacteria 2599185292 2599902504 304
24 iso_pu_bacteria 2974320154 2974323833 304
25 3300009011 Ga0105251_10004346 Ga0105251_100043463 305
26 3300009036 Ga0105244_10011395 Ga0105244_100113953 305
27 3300009148 Ga0105243_10069711 Ga0105243_100697112 305
28 iso_pu_bacteria 2928115317 2928119067 305
29 iso_pu_bacteria 2954767861 2954772844 305
30 iso_pu_bacteria 2643221672 2644397184 306
31 iso_pu_bacteria 2885192300 2885197344 306
32 iso_pu_bacteria 2928084124 2928090771 306
33 3300003763 Ga0055529_1000806 Ga0055529_10008069 307
34 3300041999 Ga0439433_0030942 Ga0439433_0030942_63_1049 307
35 3300044694 Ga0466963_0072441 Ga0466963_0072441_1322_2287 307
36 3300048927 Ga0496124_0010740 Ga0496124_0010740_1252_2235 307
37 iso_pu_bacteria 2643221621 2644121202 307
38 3300005937 Ga0081455_10097318 Ga0081455_100973181 308
39 3300006195 Ga0075366_10018002 Ga0075366_100180022 308
40 3300028794 Ga0307515_10000150 Ga0307515_10000150128 308
41 3300028794 Ga0307515_10140104 Ga0307515_101401044 308
42 3300031456 Ga0307513_10003109 Ga0307513_1000310911 308
43 3300032002 Ga0307416_100095733 Ga0307416_1000957333 308
44 3300050493 nmdc:mga0k408_12288_c1 nmdc:mga0k408_12288_c1_1361_2287 308
45 3300050507 nmdc:mga05p37_418286_c1 nmdc:mga05p37_418286_c1_386_1384 308
46 iso_pu_bacteria 2667528176 2671126696 308
47 iso_pu_bacteria 2842718218 2842719758 308
48 iso_pu_bacteria 2919481497 2919483738 308
49 3300030745 Ga0316182_1105450 Ga0316182_11054503 309
50 3300037471 Ga0395905_0000088 Ga0395905_0000088_15699_16643 309
51 3300037471 Ga0395905_0174555 Ga0395905_0174555_886_1818 309
52 3300046471 Ga0495650_0001947 Ga0495650_0001947_4833_5765 309
53 3300050489 nmdc:mga03683_84134_c1 nmdc:mga03683_84134_c1_280_1221 309
54 3300050491 nmdc:mga00v17_22555_c1 nmdc:mga00v17_22555_c1_440_1369 309
55 3300050493 nmdc:mga0k408_274_c1 nmdc:mga0k408_274_c1_13935_14876 309
56 iso_pu_bacteria 2599185214 2599627574 309
57 iso_pu_bacteria 2599185226 2599677827 309
58 iso_pu_bacteria 2599185227 2599685300 309
59 iso_pu_bacteria 2599185229 2599697051 309
60 iso_pu_bacteria 2643221609 2644057144 309
61 iso_pu_bacteria 2643221611 2644072032 309
62 iso_pu_bacteria 2643221658 2644328130 309
63 iso_pu_bacteria 2831864461 2831865269 309
64 iso_pu_bacteria 2842677519 2842678512 309
65 iso_pu_bacteria 2886848708 2886854292 309
66 iso_pu_bacteria 2904449895 2904454976 309
67 iso_pu_bacteria 2904456579 2904457333 309
68 iso_pu_bacteria 2928070936 2928075175 309
69 iso_pu_bacteria 2929520902 2929525228 309
70 iso_pu_bacteria 2945945610 2945948646 309
71 iso_pu_bacteria 2945972063 2945977862 309
72 3300003792 Ga0055540_1001224 Ga0055540_100122412 310
73 3300003794 Ga0055531_10006039 Ga0055531_100060394 310
74 3300006038 Ga0075365_10185220 Ga0075365_101852201 310
75 3300006195 Ga0075366_10016512 Ga0075366_100165123 310
76 3300006353 Ga0075370_10109825 Ga0075370_101098252 310
77 3300006948 Ga0099826_10063652 Ga0099826_100636523 310
78 3300009036 Ga0105244_10023673 Ga0105244_100236733 310
79 3300011119 Ga0105246_10041734 Ga0105246_100417345 310
80 3300011119 Ga0105246_10335364 Ga0105246_103353641 310
81 3300025273 Ga0209673_1002563 Ga0209673_10025638 310
82 3300025291 Ga0209675_1018517 Ga0209675_10185171 310
83 3300025292 Ga0209676_1001506 Ga0209676_100150613 310
84 3300025292 Ga0209676_1012330 Ga0209676_10123303 310
85 3300025298 Ga0209050_1001049 Ga0209050_100104928 310
86 3300025303 Ga0209051_1000182 Ga0209051_100018229 310
87 3300025304 Ga0209257_1000397 Ga0209257_100039738 310
88 3300025933 Ga0207706_10145849 Ga0207706_101458492 310
89 3300031731 Ga0307405_10005122 Ga0307405_100051226 310
90 3300031731 Ga0307405_10177208 Ga0307405_101772081 310
91 3300032004 Ga0307414_10153204 Ga0307414_101532042 310
92 3300032005 Ga0307411_10089064 Ga0307411_100890642 310
93 3300032005 Ga0307411_10204285 Ga0307411_102042852 310
94 3300041404 Ga0439436_0011811 Ga0439436_0011811_112_1044 310
95 3300041406 Ga0439439_0017000 Ga0439439_0017000_354_1286 310
96 3300041411 Ga0439466_0006952 Ga0439466_0006952_1771_2703 310
97 3300041413 Ga0439465_0002672 Ga0439465_0002672_3298_4230 310
98 3300041997 Ga0439431_0002113 Ga0439431_0002113_1712_2644 310
99 3300041999 Ga0439433_0003537 Ga0439433_0003537_2295_3227 310
100 3300042004 Ga0439445_0000110 Ga0439445_0000110_3118_4050 310
101 3300042006 Ga0439432_015841 Ga0439432_015841_1557_2489 310
102 3300042007 Ga0439449_0008172 Ga0439449_0008172_2782_3714 310
103 3300042010 Ga0439452_009941 Ga0439452_009941_167_1099 310
104 3300042012 Ga0439455_0004137 Ga0439455_0004137_1315_2253 310
105 3300042014 Ga0439457_003218 Ga0439457_003218_1446_2378 310
106 3300042156 Ga0439446_0017311 Ga0439446_0017311_78_1010 310
107 3300046459 Ga0495629_0049899 Ga0495629_0049899_947_1879 310
108 3300046460 Ga0495638_0110782 Ga0495638_0110782_195_1127 310
109 3300046512 Ga0495610_0012777 Ga0495610_0012777_2848_3780 310
110 3300046513 Ga0495616_0008027 Ga0495616_0008027_3236_4168 310
111 3300046515 Ga0495620_0040864 Ga0495620_0040864_517_1449 310
112 3300046518 Ga0495631_0000260 Ga0495631_0000260_6079_7011 310
113 3300046530 Ga0495654_0015130 Ga0495654_0015130_225_1157 310
114 3300046539 Ga0495621_0002039 Ga0495621_0002039_2853_3785 310
115 3300046616 Ga0495668_0059298 Ga0495668_0059298_1094_2026 310
116 3300046660 Ga0495625_0043864 Ga0495625_0043864_1646_2578 310
117 3300047321 Ga0495676_0012204 Ga0495676_0012204_5968_6900 310
118 3300047445 Ga0495677_0072423 Ga0495677_0072423_157_1089 310
119 3300047673 Ga0495593_0027221 Ga0495593_0027221_1212_2144 310
120 3300048089 Ga0495614_0006587 Ga0495614_0006587_2736_3668 310
121 3300048920 Ga0496117_0044489 Ga0496117_0044489_669_1601 310
122 3300048921 Ga0496118_0056620 Ga0496118_0056620_1320_2252 310
123 3300048925 Ga0496122_0077561 Ga0496122_0077561_263_1195 310
124 3300048928 Ga0496125_0056784 Ga0496125_0056784_238_1170 310
125 3300048929 Ga0496126_0132971 Ga0496126_0132971_1101_2033 310
126 3300050496 nmdc:mga07m45_101320_c1 nmdc:mga07m45_101320_c1_389_1321 310
127 3300053087 Ga0500643_006679 Ga0500643_006679_2087_3019 310
128 3300053093 Ga0500651_0001993 Ga0500651_0001993_3257_4189 310
129 3300053110 Ga0500571_009714 Ga0500571_009714_1612_2544 310
130 3300053120 Ga0500597_006539 Ga0500597_006539_1167_2099 310
131 3300053128 Ga0500626_064966 Ga0500626_064966_250_1182 310
132 3300053133 Ga0500655_001071 Ga0500655_001071_2898_3830 310
133 3300053134 Ga0500658_0000934 Ga0500658_0000934_8662_9594 310
134 3300053134 Ga0500658_0001155 Ga0500658_0001155_7488_8420 310
135 3300053138 Ga0500564_010712 Ga0500564_010712_673_1605 310
136 3300053139 Ga0500568_0006801 Ga0500568_0006801_1679_2611 310
137 3300003759 Ga0055525_1000036 Ga0055525_1000036269 311
138 3300005543 Ga0070672_100057426 Ga0070672_1000574262 311
139 3300025226 Ga0209674_104281 Ga0209674_1042812 311
140 3300025230 Ga0209563_100014 Ga0209563_100014653 311
141 3300025940 Ga0207691_10396371 Ga0207691_103963711 311
142 3300032002 Ga0307416_100061842 Ga0307416_1000618423 311
143 3300032005 Ga0307411_10166256 Ga0307411_101662562 311
144 3300046539 Ga0495621_0014735 Ga0495621_0014735_840_1778 311
145 3300046542 Ga0495597_0000481 Ga0495597_0000481_1150_2085 311
146 3300046615 Ga0495656_0000085 Ga0495656_0000085_33629_34567 311
147 3300046691 Ga0495670_0029470 Ga0495670_0029470_19_957 311
148 3300050491 nmdc:mga00v17_4136_c1 nmdc:mga00v17_4136_c1_4895_5878 311
149 3300005288 Ga0065714_10106115 Ga0065714_101061152 312
150 3300006058 Ga0075432_10000502 Ga0075432_100005023 312
151 3300014497 Ga0182008_10004020 Ga0182008_100040205 312
152 3300015683 Ga0183362_10002 Ga0183362_100021073 312
153 3300025728 Ga0207655_1000006 Ga0207655_1000006753 312
154 3300025735 Ga0207713_1013791 Ga0207713_10137913 312
155 3300028794 Ga0307515_10000064 Ga0307515_10000064162 312
156 3300037471 Ga0395905_0003111 Ga0395905_0003111_823_1800 312
157 3300046452 Ga0495617_001094 Ga0495617_001094_1057_2076 312
158 3300046453 Ga0495627_009115 Ga0495627_009115_419_1438 312
159 3300046474 Ga0495605_0014375 Ga0495605_0014375_368_1387 312
160 3300046492 Ga0495585_0000105 Ga0495585_0000105_36894_37913 312
161 3300046506 Ga0495583_0000354 Ga0495583_0000354_35750_36769 312
162 3300046513 Ga0495616_0000266 Ga0495616_0000266_5518_6537 312
163 3300046524 Ga0495648_0004813 Ga0495648_0004813_6798_7817 312
164 3300046538 Ga0495609_0000362 Ga0495609_0000362_21412_22431 312
165 3300046615 Ga0495656_0028791 Ga0495656_0028791_188_1207 312
166 3300046660 Ga0495625_0005297 Ga0495625_0005297_5128_6147 312
167 3300046684 Ga0495669_0011779 Ga0495669_0011779_89_1108 312
168 3300046691 Ga0495670_0004698 Ga0495670_0004698_4898_5917 312
169 3300046692 Ga0495671_0008730 Ga0495671_0008730_1792_2811 312
170 3300046810 Ga0495660_0000151 Ga0495660_0000151_35750_36769 312
171 3300047320 Ga0495672_0000671 Ga0495672_0000671_102_1121 312
172 3300047469 Ga0495673_0003080 Ga0495673_0003080_8272_9291 312
173 3300048091 Ga0495626_0083458 Ga0495626_0083458_102_1121 312
174 3300049460 Ga0495682_0009579 Ga0495682_0009579_1011_2030 312
175 iso_pu_bacteria 2511231015 2511317856 312
176 iso_pu_bacteria 8056161164 8056161896 312
177 3300003187 JGI25151J46595_10003335 JGI25151J46595_100033351 313
178 3300003316 rootH1_10039828 rootH1_100398282 313
179 3300003320 rootH2_10017886 rootH2_100178865 313
180 3300003322 rootL2_10000180 rootL2_1000018021 313
181 3300003323 rootH1_10019495 rootH1_1001949516 313
182 3300003578 Ga0006562J51391_1139586 Ga0006562J51391_11395861 313
183 3300003771 Ga0055526_1011324 Ga0055526_10113243 313
184 3300003775 Ga0055524_1000123 Ga0055524_100012357 313
185 3300003794 Ga0055531_10001112 Ga0055531_100011125 313
186 3300004625 Ga0055543_1002841 Ga0055543_10028414 313
187 3300005262 Ga0065165_1000476 Ga0065165_100047640 313
188 3300005356 Ga0070674_100064424 Ga0070674_1000644242 313
189 3300005456 Ga0070678_100046111 Ga0070678_1000461112 313
190 3300005467 Ga0070706_100002762 Ga0070706_10000276214 313
191 3300005518 Ga0070699_100089246 Ga0070699_1000892462 313
192 3300005543 Ga0070672_100075397 Ga0070672_1000753973 313
193 3300005548 Ga0070665_100018477 Ga0070665_1000184778 313
194 3300005844 Ga0068862_100051232 Ga0068862_1000512323 313
195 3300006048 Ga0075363_100078200 Ga0075363_1000782002 313
196 3300006051 Ga0075364_10006140 Ga0075364_100061403 313
197 3300006051 Ga0075364_10032181 Ga0075364_100321812 313
198 3300006177 Ga0075362_10001104 Ga0075362_100011045 313
199 3300006177 Ga0075362_10024948 Ga0075362_100249484 313
200 3300006178 Ga0075367_10003811 Ga0075367_100038113 313
201 3300006178 Ga0075367_10012736 Ga0075367_100127362 313
202 3300006186 Ga0075369_10016716 Ga0075369_100167163 313
203 3300006186 Ga0075369_10022029 Ga0075369_100220294 313
204 3300006195 Ga0075366_10039455 Ga0075366_100394551 313
205 3300006195 Ga0075366_10053983 Ga0075366_100539832 313
206 3300006353 Ga0075370_10007482 Ga0075370_100074824 313
207 3300006353 Ga0075370_10009595 Ga0075370_100095953 313
208 3300006353 Ga0075370_10015938 Ga0075370_100159382 313
209 3300006353 Ga0075370_10048945 Ga0075370_100489454 313
210 3300006353 Ga0075370_10060946 Ga0075370_100609462 313
211 3300006880 Ga0075429_100002378 Ga0075429_1000023785 313
212 3300006944 Ga0099823_1000061 Ga0099823_100006141 313
213 3300009147 Ga0114129_10080603 Ga0114129_100806033 313
214 3300009148 Ga0105243_10003512 Ga0105243_100035122 313
215 3300012497 Ga0157319_1000004 Ga0157319_1000004281 313
216 3300013100 Ga0157373_10005691 Ga0157373_100056914 313
217 3300025258 Ga0209129_1002051 Ga0209129_10020516 313
218 3300025294 Ga0209025_1000424 Ga0209025_100042428 313
219 3300025295 Ga0209564_1000021 Ga0209564_1000021435 313
220 3300025298 Ga0209050_1018184 Ga0209050_10181841 313
221 3300025299 Ga0209256_1000085 Ga0209256_1000085105 313
222 3300025299 Ga0209256_1002081 Ga0209256_100208114 313
223 3300025303 Ga0209051_1001201 Ga0209051_10012013 313
224 3300025303 Ga0209051_1004362 Ga0209051_10043627 313
225 3300025304 Ga0209257_1000351 Ga0209257_100035171 313
226 3300025304 Ga0209257_1003108 Ga0209257_10031089 313
227 3300025901 Ga0207688_10043245 Ga0207688_100432452 313
228 3300025908 Ga0207643_10140011 Ga0207643_101400111 313
229 3300025910 Ga0207684_10004381 Ga0207684_1000438112 313
230 3300025922 Ga0207646_10212396 Ga0207646_102123962 313
231 3300025923 Ga0207681_10218524 Ga0207681_102185242 313
232 3300025935 Ga0207709_10003266 Ga0207709_100032665 313
233 3300025960 Ga0207651_10075050 Ga0207651_100750503 313
234 3300026089 Ga0207648_10297321 Ga0207648_102973212 313
235 3300026121 Ga0207683_10120810 Ga0207683_101208101 313
236 3300027296 Ga0209389_1006837 Ga0209389_10068377 313
237 3300027312 Ga0209371_1013640 Ga0209371_10136402 313
238 3300028379 Ga0268266_10059901 Ga0268266_100599012 313
239 3300028786 Ga0307517_10000327 Ga0307517_1000032716 313
240 3300028786 Ga0307517_10161609 Ga0307517_101616092 313
241 3300028794 Ga0307515_10011385 Ga0307515_1001138514 313
242 3300030500 Ga0268256_1015101 Ga0268256_10151012 313
243 3300030731 Ga0316177_1024664 Ga0316177_10246641 313
244 3300030733 Ga0314311_1173484 Ga0314311_11734842 313
245 3300030734 Ga0316179_1118416 Ga0316179_11184162 313
246 3300030735 Ga0316178_1082410 Ga0316178_10824102 313
247 3300030736 Ga0316180_1030939 Ga0316180_10309395 313
248 3300030744 Ga0316181_1049773 Ga0316181_10497732 313
249 3300030745 Ga0316182_1254970 Ga0316182_12549706 313
250 3300031456 Ga0307513_10273151 Ga0307513_102731512 313
251 3300031507 Ga0307509_10000795 Ga0307509_100007953 313
252 3300031507 Ga0307509_10002463 Ga0307509_1000246310 313
253 3300031507 Ga0307509_10002617 Ga0307509_1000261722 313
254 3300031548 Ga0307408_100007126 Ga0307408_1000071261 313
255 3300031548 Ga0307408_100072505 Ga0307408_1000725052 313
256 3300031548 Ga0307408_100274351 Ga0307408_1002743512 313
257 3300031616 Ga0307508_10001110 Ga0307508_1000111027 313
258 3300031616 Ga0307508_10009055 Ga0307508_100090551 313
259 3300031649 Ga0307514_10001710 Ga0307514_1000171013 313
260 3300031901 Ga0307406_10001118 Ga0307406_1000111816 313
261 3300031911 Ga0307412_10145265 Ga0307412_101452652 313
262 3300032005 Ga0307411_10121770 Ga0307411_101217701 313
263 3300033179 Ga0307507_10092780 Ga0307507_100927803 313
264 3300033180 Ga0307510_10003186 Ga0307510_100031867 313
265 3300033180 Ga0307510_10113887 Ga0307510_101138872 313
266 3300041404 Ga0439436_0001856 Ga0439436_0001856_2148_3149 313
267 3300041411 Ga0439466_0032701 Ga0439466_0032701_395_1396 313
268 3300041997 Ga0439431_0016091 Ga0439431_0016091_718_1689 313
269 3300042004 Ga0439445_0006977 Ga0439445_0006977_1600_2601 313
270 3300042006 Ga0439432_051571 Ga0439432_051571_189_1190 313
271 3300042007 Ga0439449_0000377 Ga0439449_0000377_6383_7384 313
272 3300042010 Ga0439452_003500 Ga0439452_003500_2352_3353 313
273 3300042011 Ga0439454_000234 Ga0439454_000234_1133_2116 313
274 3300042014 Ga0439457_012787 Ga0439457_012787_696_1697 313
275 3300042127 Ga0450890_004992 Ga0450890_004992_412_1395 313
276 3300042133 Ga0450896_003904 Ga0450896_003904_746_1747 313
277 3300042156 Ga0439446_0050696 Ga0439446_0050696_186_1187 313
278 3300042184 Ga0450908_002694 Ga0450908_002694_1615_2616 313
279 3300042435 Ga0439434_0012068 Ga0439434_0012068_468_1469 313
280 3300044694 Ga0466963_0022900 Ga0466963_0022900_782_1765 313
281 3300046457 Ga0495590_0009634 Ga0495590_0009634_2288_3313 313
282 3300046519 Ga0495632_0014851 Ga0495632_0014851_3319_4281 313
283 3300046524 Ga0495648_0126641 Ga0495648_0126641_163_1125 313
284 3300046537 Ga0495598_0004446 Ga0495598_0004446_1788_2786 313
285 3300046674 Ga0495588_0039214 Ga0495588_0039214_35_976 313
286 3300047443 Ga0495687_007963 Ga0495687_007963_505_1476 313
287 3300048905 Ga0496102_0004649 Ga0496102_0004649_2288_3283 313
288 3300048924 Ga0496121_0014575 Ga0496121_0014575_7171_8142 313
289 3300048925 Ga0496122_0047599 Ga0496122_0047599_2246_3217 313
290 3300048928 Ga0496125_0037869 Ga0496125_0037869_1720_2691 313
291 3300049705 Ga0501225_0023223 Ga0501225_0023223_44_985 313
292 3300049759 Ga0501262_000162 Ga0501262_000162_2087_3028 313
293 3300050489 nmdc:mga03683_23913_c1 nmdc:mga03683_23913_c1_568_1518 313
294 3300050490 nmdc:mga03n38_49545_c1 nmdc:mga03n38_49545_c1_185_1186 313
295 3300050491 nmdc:mga00v17_15749_c1 nmdc:mga00v17_15749_c1_1266_2258 313
296 3300050491 nmdc:mga00v17_45878_c1 nmdc:mga00v17_45878_c1_1625_2593 313
297 3300050491 nmdc:mga00v17_90362_c1 nmdc:mga00v17_90362_c1_434_1384 313
298 3300050494 nmdc:mga06z11_32639_c1 nmdc:mga06z11_32639_c1_740_1777 313
299 3300050496 nmdc:mga07m45_143043_c1 nmdc:mga07m45_143043_c1_45_1007 313
300 3300050496 nmdc:mga07m45_1832_c1 nmdc:mga07m45_1832_c1_6526_7476 313
301 3300050496 nmdc:mga07m45_300_c1 nmdc:mga07m45_300_c1_3409_4350 313
302 3300050507 nmdc:mga05p37_195020_c1 nmdc:mga05p37_195020_c1_466_1410 313
303 3300050508 nmdc:mga09592_15637_c1 nmdc:mga09592_15637_c1_4234_5310 313
304 3300053079 Ga0500610_0031942 Ga0500610_0031942_911_1852 313
305 3300053086 Ga0500578_0088224 Ga0500578_0088224_705_1667 313
306 3300053117 Ga0500593_000808 Ga0500593_000808_7099_8040 313
307 3300053117 Ga0500593_000828 Ga0500593_000828_8621_9637 313
308 3300053117 Ga0500593_001775 Ga0500593_001775_1897_2874 313
309 3300053121 Ga0500607_008094 Ga0500607_008094_1593_2534 313
310 3300053154 Ga0500619_000221 Ga0500619_000221_9453_10439 313
311 3300053158 Ga0500627_0017114 Ga0500627_0017114_620_1561 313
312 3300053161 Ga0500634_0004247 Ga0500634_0004247_490_1431 313
313 3300053161 Ga0500634_0028903 Ga0500634_0028903_1147_2088 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

39

98

0.98

PF03466

LysR_substrate

LysR substrate binding domain

122

333

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.8431 12 99
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.8418 12 99
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.8325 12 99
6l33-assembly2.cif.gz_C crystal structure of the regulatory domain of mext, a transcriptional activator in pseudomonas aeruginosa 0.8289 102 305
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.8272 12 96
ID Description Score Start End Superfamily
2fyiD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8888 101 173 3.40.190.10
3fxqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8738 103 175 3.40.190.10
2ql3D01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.87 101 173 3.40.190.10
1iz1B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8681 101 173 3.40.190.10
2f7cA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8674 103 174 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6N0X1J7-F1-model_v4 LysR family transcriptional regulator 0.9 101 307 GO:0005829
GO:0006355
AF-A0A0E1SFF0-F1-model_v4 deleted 0.8993 103 308
AF-A0A843YU20-F1-model_v4 LysR family transcriptional regulator 0.894 12 307 GO:0003700
GO:0005829
AF-A0A4Y9T0Q7-F1-model_v4 LysR family transcriptional regulator 0.8831 45 166 GO:0003700
GO:0005829
AF-A0A5E4TXH3-F1-model_v4 HTH-type transcriptional regulator GbpR 0.8781 10 307 GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
88.6 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map