F402423

General Info

Members Datasets Scaffolds Average Seq Length
313 204 313 196

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_113264_c1|nmdc:mga0k408_113264_c1_873_1529
Length 218
Sequence VDAVNHHPVVAAVSTLRRLLGATGAAVLVAASLVACDATGNKPAQKLQFKATDITGANYGQSLALTDQDGRQRTLADFKGKVVVVFFGYTQCPDVCPTTMLELAQVKKSLGRDGDRLQAVFITIDPERDTPAVLKSYMASFDPSFVALRGSLEQTQAVAKEFKVFFAKVPGRTPDSYTMDHTAGSYVIDGDGKVRLFVRYGSGAEALTADLKTLLAAG

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
127 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.45
Nodule 0
Rhizoplane 3.19
Rhizosphere 65.81
Stem 0
Stem Tuber 0
Unclassified 10.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10018683 3300003316 Bacteria 5432
2 rootH2_10004838 3300003320 Bacteria 1091
3 rootL2_10000579 3300003322 Bacteria 16628
4 rootL2_10154110 3300003322 Bacteria 1384
5 rootH1_10149382 3300003323 Bacteria 1121
6 Ga0070658_10903453 3300005327 Bacteria 768
7 Ga0070676_10472183 3300005328 Bacteria 886
8 Ga0070683_100058343 3300005329 Bacteria 3586
9 Ga0070683_100187546 3300005329 Bacteria 1963
10 Ga0070677_10226786 3300005333 Bacteria 915
11 Ga0068869_100094822 3300005334 Bacteria 2250
12 Ga0070680_100511406 3300005336 Bacteria 1028
13 Ga0070660_101036466 3300005339 Bacteria 694
14 Ga0070689_100057558 3300005340 Bacteria 3018
15 Ga0070661_100087132 3300005344 Bacteria 2309
16 Ga0070668_100237494 3300005347 Bacteria 1509
17 Ga0070675_100649346 3300005354 Bacteria 959
18 Ga0070671_100019405 3300005355 Bacteria 5532
19 Ga0070671_100328922 3300005355 Bacteria 1303
20 Ga0070674_100002407 3300005356 Bacteria 10331
21 Ga0070674_100503031 3300005356 Bacteria 1009
22 Ga0070673_100126081 3300005364 Bacteria 2142
23 Ga0070659_100041287 3300005366 Bacteria 3605
24 Ga0070667_100000849 3300005367 Bacteria 28386
25 Ga0070663_100060662 3300005455 Bacteria 2721
26 Ga0070663_100502012 3300005455 Bacteria 1007
27 Ga0070662_100003686 3300005457 Bacteria 9578
28 Ga0070662_100167376 3300005457 Bacteria 1723
29 Ga0068867_100827875 3300005459 Bacteria 828
30 Ga0070706_100567149 3300005467 Bacteria 1056
31 Ga0070684_100555726 3300005535 Bacteria 1065
32 Ga0068853_100198592 3300005539 Bacteria 1824
33 Ga0068853_100469219 3300005539 Bacteria 1185
34 Ga0070672_100063657 3300005543 Bacteria 2912
35 Ga0070693_100045738 3300005547 Bacteria 2482
36 Ga0070664_100362873 3300005564 Bacteria 1319
37 Ga0068857_100006256 3300005577 Bacteria 10181
38 Ga0068854_100039137 3300005578 Bacteria 3338
39 Ga0068854_100144887 3300005578 Bacteria 1826
40 Ga0068856_100065661 3300005614 Bacteria 3586
41 Ga0068856_100764385 3300005614 Bacteria 986
42 Ga0068852_100237757 3300005616 Bacteria 1739
43 Ga0068852_100346871 3300005616 Bacteria 1448
44 Ga0068851_10041623 3300005834 Bacteria 2310
45 Ga0068858_100006972 3300005842 Bacteria 10978
46 Ga0068862_100535902 3300005844 Bacteria 1116
47 Ga0075365_10131547 3300006038 Bacteria 1732
48 Ga0075365_10385533 3300006038 Bacteria 989
49 Ga0075368_10040715 3300006042 Bacteria 1824
50 Ga0075368_10056410 3300006042 Bacteria 1567
51 Ga0075363_100100369 3300006048 Bacteria 1601
52 Ga0075363_100526487 3300006048 Bacteria 704
53 Ga0075364_10006049 3300006051 Bacteria 7084
54 Ga0075364_10025873 3300006051 Bacteria 3739
55 Ga0075364_10036286 3300006051 Bacteria 3187
56 Ga0075362_10037002 3300006177 Bacteria 2138
57 Ga0075362_10057172 3300006177 Bacteria 1757
58 Ga0075367_10013431 3300006178 Bacteria 4401
59 Ga0075367_10105442 3300006178 Bacteria 1726
60 Ga0075369_10052200 3300006186 Bacteria 1772
61 Ga0075369_10114628 3300006186 Bacteria 1216
62 Ga0075366_10000238 3300006195 Bacteria 24452
63 Ga0075366_10002285 3300006195 Bacteria 9796
64 Ga0075366_10017161 3300006195 Bacteria 4164
65 Ga0075366_10018456 3300006195 Bacteria 4028
66 Ga0075366_10041147 3300006195 Bacteria 2735
67 Ga0075366_10082456 3300006195 Bacteria 1921
68 Ga0075366_10141190 3300006195 Bacteria 1456
69 Ga0075370_10003622 3300006353 Bacteria 7389
70 Ga0075370_10007889 3300006353 Bacteria 5446
71 Ga0075370_10041584 3300006353 Bacteria 2594
72 Ga0075370_10042650 3300006353 Bacteria 2563
73 Ga0068871_100224745 3300006358 Bacteria 1628
74 Ga0068871_100276271 3300006358 Bacteria 1468
75 Ga0068865_100282539 3300006881 Bacteria 1322
76 Ga0105240_10095273 3300009093 Bacteria 3630
77 Ga0114129_10067958 3300009147 Bacteria 4969
78 Ga0105243_10022829 3300009148 Bacteria 4757
79 Ga0105237_10246641 3300009545 Bacteria 1788
80 Ga0105239_10216893 3300010375 Bacteria 2145
81 Ga0157371_10430153 3300013102 Bacteria 968
82 Ga0157370_10058613 3300013104 Bacteria 3660
83 Ga0157374_10335565 3300013296 Bacteria 1500
84 Ga0157378_10131975 3300013297 Bacteria 2313
85 Ga0163162_10851638 3300013306 Bacteria 1027
86 Ga0157372_10177736 3300013307 Bacteria 2464
87 Ga0157379_10010403 3300014968 Bacteria 8105
88 Ga0157379_10921262 3300014968 Bacteria 830
89 Ga0163161_10275580 3300017792 Bacteria 1318
90 Ga0213872_10000068 3300021361 Bacteria 91693
91 Ga0213872_10120530 3300021361 Bacteria 1160
92 Ga0207425_1001233 3300025245 Bacteria 11212
93 Ga0209129_1000062 3300025258 Bacteria 240655
94 Ga0209565_1044382 3300025263 Bacteria 818
95 Ga0209564_1000176 3300025295 Bacteria 152363
96 Ga0209758_1000129 3300025297 Bacteria 185022
97 Ga0209256_1016245 3300025299 Bacteria 2549
98 Ga0207656_10009941 3300025321 Bacteria 3545
99 Ga0207643_10231914 3300025908 Bacteria 1132
100 Ga0207705_10118267 3300025909 Bacteria 1964
101 Ga0207671_10035764 3300025914 Bacteria 3683
102 Ga0207671_10231913 3300025914 Bacteria 1448
103 Ga0207650_10152026 3300025925 Bacteria 1827
104 Ga0207659_10719134 3300025926 Bacteria 856
105 Ga0207644_10044622 3300025931 Bacteria 3150
106 Ga0207690_10392017 3300025932 Bacteria 1106
107 Ga0207706_10004061 3300025933 Bacteria 13836
108 Ga0207706_10009391 3300025933 Bacteria 8977
109 Ga0207706_10064905 3300025933 Bacteria 3215
110 Ga0207709_10125982 3300025935 Bacteria 1737
111 Ga0207704_10033024 3300025938 Bacteria 2938
112 Ga0207691_10020872 3300025940 Bacteria 6190
113 Ga0207691_10174085 3300025940 Bacteria 1883
114 Ga0207689_10195548 3300025942 Bacteria 1669
115 Ga0207661_10507961 3300025944 Bacteria 1101
116 Ga0207640_10066668 3300025981 Bacteria 2406
117 Ga0207658_10000968 3300025986 Bacteria 23705
118 Ga0207677_10226834 3300026023 Bacteria 1502
119 Ga0207703_10362363 3300026035 Bacteria 1337
120 Ga0207639_10314950 3300026041 Bacteria 1387
121 Ga0207639_11009440 3300026041 Bacteria 779
122 Ga0207678_10010974 3300026067 Bacteria 7957
123 Ga0207678_10252381 3300026067 Bacteria 1511
124 Ga0207702_10050850 3300026078 Bacteria 3499
125 Ga0207702_10473276 3300026078 Bacteria 1218
126 Ga0207648_10012759 3300026089 Bacteria 7852
127 Ga0207648_10094301 3300026089 Bacteria 2617
128 Ga0207674_10024496 3300026116 Bacteria 6448
129 Ga0207674_10028633 3300026116 Bacteria 5876
130 Ga0207675_101074901 3300026118 Bacteria 824
131 Ga0207683_10145337 3300026121 Bacteria 2138
132 Ga0207698_10280331 3300026142 Bacteria 1541
133 Ga0207698_10309102 3300026142 Bacteria 1475
134 Ga0207698_10588782 3300026142 Bacteria 1095
135 Ga0268265_10308556 3300028380 Bacteria 1428
136 Ga0268264_10064704 3300028381 Bacteria 3078
137 Ga0307517_10001975 3300028786 Bacteria 33407
138 Ga0307515_10038558 3300028794 Bacteria 7637
139 Ga0307515_10044865 3300028794 Bacteria 6812
140 Ga0307515_10196311 3300028794 Bacteria 1909
141 Ga0307512_10161654 3300030522 Bacteria 1310
142 Ga0307513_10014677 3300031456 Bacteria 9536
143 Ga0307513_10194205 3300031456 Bacteria 1878
144 Ga0307513_10257173 3300031456 Bacteria 1538
145 Ga0307509_10027173 3300031507 Bacteria 6369
146 Ga0307509_10111454 3300031507 Bacteria 2739
147 Ga0307509_10130739 3300031507 Bacteria 2466
148 Ga0307509_10427668 3300031507 Bacteria 1023
149 Ga0307509_10536870 3300031507 Bacteria 849
150 Ga0307408_100024419 3300031548 Bacteria 4128
151 Ga0307408_100254880 3300031548 Bacteria 1449
152 Ga0307508_10000271 3300031616 Bacteria 63576
153 Ga0307508_10003497 3300031616 Bacteria 15837
154 Ga0307508_10116045 3300031616 Bacteria 2279
155 Ga0307508_10344064 3300031616 Bacteria 1082
156 Ga0307514_10033853 3300031649 Bacteria 4074
157 Ga0307514_10104601 3300031649 Bacteria 2024
158 Ga0307514_10108715 3300031649 Bacteria 1971
159 Ga0265314_10024599 3300031711 Bacteria 4563
160 Ga0307516_10000127 3300031730 Bacteria 90180
161 Ga0307516_10143560 3300031730 Bacteria 2154
162 Ga0307516_10420052 3300031730 Bacteria 995
163 Ga0307405_10022624 3300031731 Bacteria 3557
164 Ga0307405_10168112 3300031731 Bacteria 1561
165 Ga0307413_10083985 3300031824 Bacteria 2051
166 Ga0307410_10121538 3300031852 Bacteria 1905
167 Ga0307406_10039749 3300031901 Bacteria 2921
168 Ga0307406_10100531 3300031901 Bacteria 1969
169 Ga0307407_10019398 3300031903 Bacteria 3462
170 Ga0307407_10401103 3300031903 Bacteria 984
171 Ga0307407_10424913 3300031903 Bacteria 959
172 Ga0307412_10009728 3300031911 Bacteria 5520
173 Ga0307412_10800978 3300031911 Bacteria 818
174 Ga0307409_100038806 3300031995 Bacteria 3526
175 Ga0307409_100083425 3300031995 Bacteria 2591
176 Ga0307409_100138043 3300031995 Bacteria 2096
177 Ga0307416_100433404 3300032002 Bacteria 1362
178 Ga0307416_101050396 3300032002 Bacteria 918
179 Ga0307414_10041632 3300032004 Bacteria 3114
180 Ga0307411_10091055 3300032005 Bacteria 2129
181 Ga0307411_10106287 3300032005 Bacteria 1997
182 Ga0307411_10145293 3300032005 Bacteria 1755
183 Ga0307415_100040686 3300032126 Bacteria 3081
184 Ga0307507_10064056 3300033179 Bacteria 3396
185 Ga0307510_10319001 3300033180 Bacteria 1011
186 Ga0307510_10406506 3300033180 Bacteria 804
187 Ga0373949_0110931 3300035090 Bacteria 761
188 Ga0373931_0097961 3300035691 Bacteria 1645
189 Ga0373927_0109582 3300035695 Bacteria 1799
190 Ga0373925_0145270 3300037068 Bacteria 1859
191 Ga0436365_0759607 3300039437 Bacteria 2318
192 Ga0436360_0914564 3300039438 Bacteria 1240
193 Ga0436361_0209135 3300039447 Bacteria 2586
194 Ga0436361_0793297 3300039447 Bacteria 22989
195 Ga0451800_0591280 3300041459 Bacteria 774
196 Ga0451800_1052011 3300041459 Bacteria 650
197 Ga0451843_1777139 3300041509 Bacteria 938
198 Ga0439431_0025254 3300041997 Bacteria 1450
199 Ga0466969_0000013 3300044656 Bacteria 111537
200 Ga0466972_0000828 3300044658 Bacteria 14809
201 Ga0466966_0018350 3300044684 Bacteria 4615
202 Ga0466961_0011529 3300044693 Bacteria 5653
203 Ga0466964_0015309 3300044706 Bacteria 2918
204 Ga0466971_0081506 3300044719 Bacteria 1476
205 Ga0466970_0043062 3300044765 Bacteria 2402
206 Ga0466957_0256495 3300044842 Bacteria 1164
207 Ga0466959_0008628 3300045049 Bacteria 7213
208 Ga0451576_0006110 3300045051 Bacteria 14839
209 Ga0451576_0155533 3300045051 Bacteria 2385
210 Ga0495617_000108 3300046452 Bacteria 60724
211 Ga0495627_052720 3300046453 Bacteria 1219
212 Ga0495592_0000153 3300046454 Bacteria 60062
213 Ga0495585_0094426 3300046492 Bacteria 1607
214 Ga0495594_0389956 3300046499 Bacteria 792
215 Ga0495596_0012046 3300046500 Bacteria 3712
216 Ga0495583_0000907 3300046506 Bacteria 35148
217 Ga0495616_0040899 3300046513 Bacteria 2366
218 Ga0495620_0074720 3300046515 Bacteria 1380
219 Ga0495631_0018020 3300046518 Bacteria 3331
220 Ga0495632_0008136 3300046519 Bacteria 6484
221 Ga0495632_0009357 3300046519 Bacteria 5915
222 Ga0495632_0143692 3300046519 Bacteria 1106
223 Ga0495644_0012503 3300046523 Bacteria 3263
224 Ga0495648_0075269 3300046524 Bacteria 1942
225 Ga0495648_0211886 3300046524 Bacteria 962
226 Ga0495666_0003395 3300046526 Bacteria 8033
227 Ga0495642_0048622 3300046528 Bacteria 1740
228 Ga0495665_0000878 3300046531 Bacteria 15744
229 Ga0495665_0115206 3300046531 Bacteria 1408
230 Ga0495586_0324961 3300046535 Bacteria 882
231 Ga0495587_0004232 3300046536 Bacteria 9489
232 Ga0495609_0187150 3300046538 Bacteria 870
233 Ga0495622_0000567 3300046557 Bacteria 22203
234 Ga0495622_0011544 3300046557 Bacteria 4083
235 Ga0495622_0128699 3300046557 Bacteria 1154
236 Ga0495633_0031099 3300046558 Bacteria 2590
237 Ga0495656_0100384 3300046615 Bacteria 1338
238 Ga0495668_0032281 3300046616 Bacteria 2947
239 Ga0495611_0003678 3300046648 Bacteria 6719
240 Ga0495625_0051109 3300046660 Bacteria 2964
241 Ga0495625_0448284 3300046660 Bacteria 798
242 Ga0495661_0036387 3300046665 Bacteria 3083
243 Ga0495588_0174819 3300046674 Bacteria 1135
244 Ga0495588_0335901 3300046674 Bacteria 794
245 Ga0495623_0041589 3300046679 Bacteria 2930
246 Ga0495623_0104103 3300046679 Bacteria 1726
247 Ga0495669_0007820 3300046684 Bacteria 4487
248 Ga0495613_0055891 3300046689 Bacteria 2899
249 Ga0495613_0137505 3300046689 Bacteria 1747
250 Ga0495624_0020487 3300046690 Bacteria 4400
251 Ga0495670_0036581 3300046691 Bacteria 2446
252 Ga0495671_0049562 3300046692 Bacteria 2093
253 Ga0495649_0002161 3300046694 Bacteria 14071
254 Ga0495589_0034645 3300046794 Bacteria 2533
255 Ga0495660_0010718 3300046810 Bacteria 5327
256 Ga0495660_0077424 3300046810 Bacteria 1750
257 Ga0495581_0002359 3300047315 Bacteria 10653
258 Ga0495581_0035570 3300047315 Bacteria 2881
259 Ga0495676_0063871 3300047321 Bacteria 2867
260 Ga0495683_0014752 3300047323 Bacteria 4070
261 Ga0495683_0276247 3300047323 Bacteria 729
262 Ga0495687_001027 3300047443 Bacteria 27802
263 Ga0495687_009819 3300047443 Bacteria 5313
264 Ga0495675_0098305 3300047444 Bacteria 1833
265 Ga0495677_0021549 3300047445 Bacteria 2335
266 Ga0495679_025012 3300047446 Bacteria 2002
267 Ga0495681_0102214 3300047470 Bacteria 1251
268 Ga0495686_0001940 3300047472 Bacteria 20588
269 Ga0495593_0041762 3300047673 Bacteria 2464
270 Ga0495593_0226695 3300047673 Bacteria 937
271 Ga0496101_0483473 3300048904 Bacteria 978
272 Ga0496101_0761646 3300048904 Bacteria 764
273 Ga0496102_0007775 3300048905 Bacteria 9163
274 Ga0496108_0591121 3300048911 Bacteria 967
275 Ga0496110_0203340 3300048913 Bacteria 1800
276 Ga0496113_0357269 3300048916 Bacteria 1172
277 Ga0496115_0003645 3300048918 Bacteria 11085
278 Ga0496115_0033513 3300048918 Bacteria 4055
279 Ga0501323_009015 3300049539 Bacteria 1169
280 nmdc:mga03683_145071_c1 3300050489 Bacteria 1069
281 nmdc:mga03683_29296_c1 3300050489 Bacteria 2195
282 nmdc:mga03n38_17134_c1 3300050490 Bacteria 2832
283 nmdc:mga03n38_214113_c1 3300050490 Bacteria 1003
284 nmdc:mga00v17_118447_c1 3300050491 Bacteria 1685
285 nmdc:mga00v17_44472_c1 3300050491 Bacteria 2678
286 nmdc:mga0yw44_22416_c1 3300050492 Bacteria 3541
287 nmdc:mga0k408_113264_c1 3300050493 Bacteria 1604
288 nmdc:mga0k408_11856_c1 3300050493 Bacteria 4756
289 nmdc:mga0k408_1796_c1 3300050493 Bacteria 11501
290 nmdc:mga0k408_24786_c1 3300050493 Bacteria 3394
291 nmdc:mga0k408_30782_c1 3300050493 Bacteria 3062
292 nmdc:mga0k408_328659_c1 3300050493 Bacteria 912
293 nmdc:mga0k408_565_c1 3300050493 Bacteria 20434
294 nmdc:mga0k408_580560_c1 3300050493 Bacteria 662
295 nmdc:mga0k408_603_c1 3300050493 Bacteria 19842
296 nmdc:mga0k408_87714_c1 3300050493 Bacteria 1828
297 nmdc:mga06z11_20660_c1 3300050494 Bacteria 3047
298 nmdc:mga06z11_83032_c1 3300050494 Bacteria 1724
299 nmdc:mga04h51_14131_c1 3300050495 Bacteria 2275
300 nmdc:mga04h51_72677_c1 3300050495 Bacteria 1204
301 nmdc:mga07m45_101920_c1 3300050496 Bacteria 1649
302 nmdc:mga07m45_10986_c1 3300050496 Bacteria 4746
303 nmdc:mga07m45_20992_c1 3300050496 Bacteria 3552
304 nmdc:mga07m45_37776_c1 3300050496 Bacteria 2694
305 nmdc:mga07m45_60646_c1 3300050496 Bacteria 2142
306 nmdc:mga07m45_7796_c1 3300050496 Bacteria 5480
307 nmdc:mga05p37_23603_c1 3300050507 Bacteria 4839
308 nmdc:mga0sz30_24496_c1 3300050516 Bacteria 2463
309 nmdc:mga0sz30_29303_c1 3300050516 Bacteria 1199
310 nmdc:mga0sz30_32654_c1 3300050516 Bacteria 2160
311 Ga0500568_0059138 3300053139 Bacteria 1487
312 Ga0500619_083239 3300053154 Bacteria 1076
313 Ga0466962_0042686 3300061719 Bacteria 2170

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021361 Ga0213872_10120530 Ga0213872_101205302 176
2 3300039447 Ga0436361_0209135 Ga0436361_0209135_122_754 176
3 3300025245 Ga0207425_1001233 Ga0207425_10012333 177
4 3300025258 Ga0209129_1000062 Ga0209129_1000062158 177
5 3300025263 Ga0209565_1044382 Ga0209565_10443821 177
6 3300025295 Ga0209564_1000176 Ga0209564_100017678 177
7 3300025297 Ga0209758_1000129 Ga0209758_100012911 177
8 3300025299 Ga0209256_1016245 Ga0209256_10162452 177
9 3300041459 Ga0451800_1052011 Ga0451800_1052011_20_628 178
10 3300031731 Ga0307405_10168112 Ga0307405_101681122 179
11 3300031824 Ga0307413_10083985 Ga0307413_100839852 179
12 3300031852 Ga0307410_10121538 Ga0307410_101215382 179
13 3300031995 Ga0307409_100138043 Ga0307409_1001380432 179
14 3300032005 Ga0307411_10091055 Ga0307411_100910552 179
15 3300006051 Ga0075364_10006049 Ga0075364_100060492 180
16 3300021361 Ga0213872_10000068 Ga0213872_1000006830 180
17 3300039447 Ga0436361_0793297 Ga0436361_0793297_15833_16477 180
18 3300005340 Ga0070689_100057558 Ga0070689_1000575584 185
19 3300031507 Ga0307509_10536870 Ga0307509_105368701 185
20 3300041459 Ga0451800_0591280 Ga0451800_0591280_126_683 185
21 3300050493 nmdc:mga0k408_328659_c1 nmdc:mga0k408_328659_c1_329_886 185
22 3300013104 Ga0157370_10058613 Ga0157370_100586133 186
23 3300044693 Ga0466961_0011529 Ga0466961_0011529_1300_1908 186
24 3300044706 Ga0466964_0015309 Ga0466964_0015309_2136_2744 186
25 3300044842 Ga0466957_0256495 Ga0466957_0256495_378_986 186
26 3300045049 Ga0466959_0008628 Ga0466959_0008628_6582_7190 186
27 3300061719 Ga0466962_0042686 Ga0466962_0042686_56_664 186
28 3300005328 Ga0070676_10472183 Ga0070676_104721832 187
29 3300006038 Ga0075365_10131547 Ga0075365_101315472 187
30 3300006042 Ga0075368_10056410 Ga0075368_100564102 187
31 3300006051 Ga0075364_10036286 Ga0075364_100362862 187
32 3300006177 Ga0075362_10057172 Ga0075362_100571722 187
33 3300006178 Ga0075367_10013431 Ga0075367_100134312 187
34 3300006186 Ga0075369_10052200 Ga0075369_100522002 187
35 3300006195 Ga0075366_10000238 Ga0075366_100002385 187
36 3300006195 Ga0075366_10082456 Ga0075366_100824563 187
37 3300006353 Ga0075370_10041584 Ga0075370_100415843 187
38 3300006881 Ga0068865_100282539 Ga0068865_1002825391 187
39 3300009148 Ga0105243_10022829 Ga0105243_100228292 187
40 3300025935 Ga0207709_10125982 Ga0207709_101259822 187
41 3300025938 Ga0207704_10033024 Ga0207704_100330243 187
42 3300026089 Ga0207648_10094301 Ga0207648_100943012 187
43 3300026118 Ga0207675_101074901 Ga0207675_1010749011 187
44 3300031730 Ga0307516_10420052 Ga0307516_104200522 187
45 3300046515 Ga0495620_0074720 Ga0495620_0074720_395_958 187
46 3300046519 Ga0495632_0008136 Ga0495632_0008136_5179_5742 187
47 3300046694 Ga0495649_0002161 Ga0495649_0002161_7253_7816 187
48 3300046810 Ga0495660_0077424 Ga0495660_0077424_444_1007 187
49 3300047323 Ga0495683_0276247 Ga0495683_0276247_148_711 187
50 3300047443 Ga0495687_009819 Ga0495687_009819_2422_2985 187
51 3300050493 nmdc:mga0k408_87714_c1 nmdc:mga0k408_87714_c1_205_768 187
52 3300050495 nmdc:mga04h51_72677_c1 nmdc:mga04h51_72677_c1_39_602 187
53 3300050496 nmdc:mga07m45_101920_c1 nmdc:mga07m45_101920_c1_1020_1583 187
54 3300053139 Ga0500568_0059138 Ga0500568_0059138_380_943 187
55 3300031901 Ga0307406_10100531 Ga0307406_101005312 188
56 3300046518 Ga0495631_0018020 Ga0495631_0018020_1585_2178 188
57 3300046524 Ga0495648_0075269 Ga0495648_0075269_1152_1745 188
58 3300046692 Ga0495671_0049562 Ga0495671_0049562_1041_1634 188
59 3300047443 Ga0495687_001027 Ga0495687_001027_6295_6864 188
60 3300048918 Ga0496115_0033513 Ga0496115_0033513_169_762 188
61 3300005334 Ga0068869_100094822 Ga0068869_1000948222 190
62 3300005354 Ga0070675_100649346 Ga0070675_1006493462 190
63 3300005364 Ga0070673_100126081 Ga0070673_1001260813 190
64 3300005455 Ga0070663_100060662 Ga0070663_1000606622 190
65 3300005457 Ga0070662_100167376 Ga0070662_1001673762 190
66 3300005577 Ga0068857_100006256 Ga0068857_1000062563 190
67 3300005578 Ga0068854_100039137 Ga0068854_1000391373 190
68 3300005616 Ga0068852_100237757 Ga0068852_1002377572 190
69 3300006038 Ga0075365_10385533 Ga0075365_103855332 190
70 3300006042 Ga0075368_10040715 Ga0075368_100407151 190
71 3300006048 Ga0075363_100100369 Ga0075363_1001003692 190
72 3300006051 Ga0075364_10025873 Ga0075364_100258735 190
73 3300006177 Ga0075362_10037002 Ga0075362_100370022 190
74 3300006178 Ga0075367_10105442 Ga0075367_101054422 190
75 3300006186 Ga0075369_10114628 Ga0075369_101146282 190
76 3300009093 Ga0105240_10095273 Ga0105240_100952732 190
77 3300009545 Ga0105237_10246641 Ga0105237_102466412 190
78 3300010375 Ga0105239_10216893 Ga0105239_102168932 190
79 3300014968 Ga0157379_10921262 Ga0157379_109212622 190
80 3300025914 Ga0207671_10035764 Ga0207671_100357643 190
81 3300025926 Ga0207659_10719134 Ga0207659_107191342 190
82 3300025932 Ga0207690_10392017 Ga0207690_103920172 190
83 3300025933 Ga0207706_10009391 Ga0207706_100093916 190
84 3300025942 Ga0207689_10195548 Ga0207689_101955482 190
85 3300025981 Ga0207640_10066668 Ga0207640_100666682 190
86 3300026023 Ga0207677_10226834 Ga0207677_102268342 190
87 3300026067 Ga0207678_10252381 Ga0207678_102523812 190
88 3300026116 Ga0207674_10024496 Ga0207674_100244962 190
89 3300026142 Ga0207698_10309102 Ga0207698_103091022 190
90 3300049539 Ga0501323_009015 Ga0501323_009015_175_759 190
91 3300050489 nmdc:mga03683_145071_c1 nmdc:mga03683_145071_c1_201_785 190
92 3300050490 nmdc:mga03n38_214113_c1 nmdc:mga03n38_214113_c1_118_702 190
93 3300050491 nmdc:mga00v17_44472_c1 nmdc:mga00v17_44472_c1_943_1527 190
94 3300050493 nmdc:mga0k408_30782_c1 nmdc:mga0k408_30782_c1_60_644 190
95 3300050494 nmdc:mga06z11_83032_c1 nmdc:mga06z11_83032_c1_1023_1607 190
96 3300050496 nmdc:mga07m45_60646_c1 nmdc:mga07m45_60646_c1_285_869 190
97 3300050516 nmdc:mga0sz30_24496_c1 nmdc:mga0sz30_24496_c1_1232_1816 190
98 3300031911 Ga0307412_10800978 Ga0307412_108009782 191
99 3300046660 Ga0495625_0448284 Ga0495625_0448284_158_742 191
100 3300046794 Ga0495589_0034645 Ga0495589_0034645_1944_2519 191
101 3300048916 Ga0496113_0357269 Ga0496113_0357269_13_591 191
102 3300050489 nmdc:mga03683_29296_c1 nmdc:mga03683_29296_c1_1383_1967 191
103 3300050490 nmdc:mga03n38_17134_c1 nmdc:mga03n38_17134_c1_723_1307 191
104 3300050491 nmdc:mga00v17_118447_c1 nmdc:mga00v17_118447_c1_707_1291 191
105 3300050492 nmdc:mga0yw44_22416_c1 nmdc:mga0yw44_22416_c1_2699_3283 191
106 3300050493 nmdc:mga0k408_1796_c1 nmdc:mga0k408_1796_c1_1181_1765 191
107 3300050493 nmdc:mga0k408_565_c1 nmdc:mga0k408_565_c1_9735_10319 191
108 3300050494 nmdc:mga06z11_20660_c1 nmdc:mga06z11_20660_c1_1860_2444 191
109 3300050495 nmdc:mga04h51_14131_c1 nmdc:mga04h51_14131_c1_774_1358 191
110 3300050496 nmdc:mga07m45_10986_c1 nmdc:mga07m45_10986_c1_1115_1699 191
111 3300050516 nmdc:mga0sz30_29303_c1 nmdc:mga0sz30_29303_c1_573_1157 191
112 3300050516 nmdc:mga0sz30_32654_c1 nmdc:mga0sz30_32654_c1_1250_1834 191
113 3300005459 Ga0068867_100827875 Ga0068867_1008278752 192
114 3300005614 Ga0068856_100764385 Ga0068856_1007643852 192
115 3300006048 Ga0075363_100526487 Ga0075363_1005264872 192
116 3300006195 Ga0075366_10002285 Ga0075366_100022855 192
117 3300006195 Ga0075366_10041147 Ga0075366_100411472 192
118 3300006353 Ga0075370_10003622 Ga0075370_100036224 192
119 3300006353 Ga0075370_10007889 Ga0075370_100078891 192
120 3300026078 Ga0207702_10050850 Ga0207702_100508502 192
121 3300031903 Ga0307407_10424913 Ga0307407_104249132 192
122 3300050493 nmdc:mga0k408_11856_c1 nmdc:mga0k408_11856_c1_1903_2481 192
123 3300050493 nmdc:mga0k408_580560_c1 nmdc:mga0k408_580560_c1_21_599 192
124 3300050493 nmdc:mga0k408_603_c1 nmdc:mga0k408_603_c1_15455_16042 192
125 3300050496 nmdc:mga07m45_37776_c1 nmdc:mga07m45_37776_c1_2007_2594 192
126 3300050496 nmdc:mga07m45_7796_c1 nmdc:mga07m45_7796_c1_4848_5438 192
127 3300005844 Ga0068862_100535902 Ga0068862_1005359022 193
128 3300006195 Ga0075366_10017161 Ga0075366_100171615 193
129 3300028380 Ga0268265_10308556 Ga0268265_103085562 193
130 3300031456 Ga0307513_10257173 Ga0307513_102571732 193
131 3300031649 Ga0307514_10104601 Ga0307514_101046012 193
132 3300031730 Ga0307516_10143560 Ga0307516_101435602 193
133 3300046454 Ga0495592_0000153 Ga0495592_0000153_6179_6763 193
134 3300053154 Ga0500619_083239 Ga0500619_083239_266_850 193
135 3300030522 Ga0307512_10161654 Ga0307512_101616542 194
136 3300033180 Ga0307510_10406506 Ga0307510_104065061 194
137 3300041997 Ga0439431_0025254 Ga0439431_0025254_559_1143 194
138 3300046499 Ga0495594_0389956 Ga0495594_0389956_86_679 194
139 3300046526 Ga0495666_0003395 Ga0495666_0003395_6620_7213 194
140 3300046531 Ga0495665_0000878 Ga0495665_0000878_3769_4362 194
141 3300046531 Ga0495665_0115206 Ga0495665_0115206_621_1214 194
142 3300046535 Ga0495586_0324961 Ga0495586_0324961_213_806 194
143 3300046536 Ga0495587_0004232 Ga0495587_0004232_5583_6176 194
144 3300046557 Ga0495622_0000567 Ga0495622_0000567_15517_16110 194
145 3300046660 Ga0495625_0051109 Ga0495625_0051109_1667_2260 194
146 3300046674 Ga0495588_0335901 Ga0495588_0335901_135_728 194
147 3300046679 Ga0495623_0041589 Ga0495623_0041589_2150_2743 194
148 3300046679 Ga0495623_0104103 Ga0495623_0104103_236_829 194
149 3300046689 Ga0495613_0055891 Ga0495613_0055891_325_918 194
150 3300046689 Ga0495613_0137505 Ga0495613_0137505_788_1381 194
151 3300046690 Ga0495624_0020487 Ga0495624_0020487_3723_4316 194
152 3300047315 Ga0495581_0002359 Ga0495581_0002359_6505_7098 194
153 3300047315 Ga0495581_0035570 Ga0495581_0035570_1914_2507 194
154 3300047444 Ga0495675_0098305 Ga0495675_0098305_620_1213 194
155 3300047673 Ga0495593_0041762 Ga0495593_0041762_1247_1840 194
156 3300047673 Ga0495593_0226695 Ga0495593_0226695_309_902 194
157 3300048918 Ga0496115_0003645 Ga0496115_0003645_8650_9243 194
158 3300037068 Ga0373925_0145270 Ga0373925_0145270_210_797 195
159 3300046452 Ga0495617_000108 Ga0495617_000108_6315_6920 195
160 3300046453 Ga0495627_052720 Ga0495627_052720_219_824 195
161 3300046500 Ga0495596_0012046 Ga0495596_0012046_241_837 195
162 3300046506 Ga0495583_0000907 Ga0495583_0000907_28226_28822 195
163 3300046513 Ga0495616_0040899 Ga0495616_0040899_1086_1682 195
164 3300046519 Ga0495632_0009357 Ga0495632_0009357_4117_4713 195
165 3300046523 Ga0495644_0012503 Ga0495644_0012503_1709_2305 195
166 3300046528 Ga0495642_0048622 Ga0495642_0048622_515_1111 195
167 3300046538 Ga0495609_0187150 Ga0495609_0187150_81_677 195
168 3300046558 Ga0495633_0031099 Ga0495633_0031099_90_686 195
169 3300046615 Ga0495656_0100384 Ga0495656_0100384_297_893 195
170 3300046616 Ga0495668_0032281 Ga0495668_0032281_1792_2388 195
171 3300046648 Ga0495611_0003678 Ga0495611_0003678_2092_2688 195
172 3300046665 Ga0495661_0036387 Ga0495661_0036387_1244_1840 195
173 3300046684 Ga0495669_0007820 Ga0495669_0007820_923_1519 195
174 3300046691 Ga0495670_0036581 Ga0495670_0036581_171_767 195
175 3300046810 Ga0495660_0010718 Ga0495660_0010718_991_1587 195
176 3300047323 Ga0495683_0014752 Ga0495683_0014752_2229_2825 195
177 3300047445 Ga0495677_0021549 Ga0495677_0021549_994_1590 195
178 3300047446 Ga0495679_025012 Ga0495679_025012_1057_1653 195
179 3300047470 Ga0495681_0102214 Ga0495681_0102214_433_1029 195
180 3300047472 Ga0495686_0001940 Ga0495686_0001940_13517_14107 195
181 3300048905 Ga0496102_0007775 Ga0496102_0007775_2134_2733 195
182 3300050496 nmdc:mga07m45_20992_c1 nmdc:mga07m45_20992_c1_2427_3017 195
183 3300031711 Ga0265314_10024599 Ga0265314_100245992 196
184 3300045051 Ga0451576_0006110 Ga0451576_0006110_6250_6843 196
185 3300046492 Ga0495585_0094426 Ga0495585_0094426_818_1417 196
186 3300046557 Ga0495622_0011544 Ga0495622_0011544_1282_1881 196
187 3300046674 Ga0495588_0174819 Ga0495588_0174819_73_672 196
188 3300047321 Ga0495676_0063871 Ga0495676_0063871_144_743 196
189 3300005457 Ga0070662_100003686 Ga0070662_10000368610 197
190 3300025933 Ga0207706_10004061 Ga0207706_100040619 197
191 3300031730 Ga0307516_10000127 Ga0307516_1000012754 197
192 3300039437 Ga0436365_0759607 Ga0436365_0759607_361_954 197
193 3300005329 Ga0070683_100058343 Ga0070683_1000583434 198
194 3300005329 Ga0070683_100187546 Ga0070683_1001875462 198
195 3300005336 Ga0070680_100511406 Ga0070680_1005114062 198
196 3300005344 Ga0070661_100087132 Ga0070661_1000871322 198
197 3300005355 Ga0070671_100328922 Ga0070671_1003289221 198
198 3300005366 Ga0070659_100041287 Ga0070659_1000412872 198
199 3300005455 Ga0070663_100502012 Ga0070663_1005020121 198
200 3300005535 Ga0070684_100555726 Ga0070684_1005557262 198
201 3300005539 Ga0068853_100198592 Ga0068853_1001985922 198
202 3300005539 Ga0068853_100469219 Ga0068853_1004692192 198
203 3300005543 Ga0070672_100063657 Ga0070672_1000636572 198
204 3300005547 Ga0070693_100045738 Ga0070693_1000457383 198
205 3300005564 Ga0070664_100362873 Ga0070664_1003628732 198
206 3300005578 Ga0068854_100144887 Ga0068854_1001448872 198
207 3300005614 Ga0068856_100065661 Ga0068856_1000656614 198
208 3300005616 Ga0068852_100346871 Ga0068852_1003468712 198
209 3300005834 Ga0068851_10041623 Ga0068851_100416233 198
210 3300005842 Ga0068858_100006972 Ga0068858_10000697211 198
211 3300009147 Ga0114129_10067958 Ga0114129_100679581 198
212 3300013102 Ga0157371_10430153 Ga0157371_104301532 198
213 3300013296 Ga0157374_10335565 Ga0157374_103355651 198
214 3300013306 Ga0163162_10851638 Ga0163162_108516382 198
215 3300014968 Ga0157379_10010403 Ga0157379_100104033 198
216 3300025321 Ga0207656_10009941 Ga0207656_100099413 198
217 3300025914 Ga0207671_10231913 Ga0207671_102319132 198
218 3300025940 Ga0207691_10020872 Ga0207691_100208724 198
219 3300025944 Ga0207661_10507961 Ga0207661_105079612 198
220 3300026035 Ga0207703_10362363 Ga0207703_103623632 198
221 3300026041 Ga0207639_10314950 Ga0207639_103149502 198
222 3300026041 Ga0207639_11009440 Ga0207639_110094402 198
223 3300026078 Ga0207702_10473276 Ga0207702_104732762 198
224 3300026116 Ga0207674_10028633 Ga0207674_100286334 198
225 3300026142 Ga0207698_10280331 Ga0207698_102803312 198
226 3300028381 Ga0268264_10064704 Ga0268264_100647043 198
227 3300044658 Ga0466972_0000828 Ga0466972_0000828_6758_7366 198
228 3300045051 Ga0451576_0155533 Ga0451576_0155533_1432_2031 198
229 3300003322 rootL2_10154110 rootL2_101541102 199
230 3300005327 Ga0070658_10903453 Ga0070658_109034531 199
231 3300005333 Ga0070677_10226786 Ga0070677_102267862 199
232 3300005339 Ga0070660_101036466 Ga0070660_1010364661 199
233 3300005347 Ga0070668_100237494 Ga0070668_1002374941 199
234 3300005355 Ga0070671_100019405 Ga0070671_1000194052 199
235 3300005356 Ga0070674_100002407 Ga0070674_1000024077 199
236 3300005356 Ga0070674_100503031 Ga0070674_1005030312 199
237 3300005467 Ga0070706_100567149 Ga0070706_1005671491 199
238 3300006195 Ga0075366_10018456 Ga0075366_100184563 199
239 3300006195 Ga0075366_10141190 Ga0075366_101411902 199
240 3300006358 Ga0068871_100224745 Ga0068871_1002247452 199
241 3300006358 Ga0068871_100276271 Ga0068871_1002762711 199
242 3300013297 Ga0157378_10131975 Ga0157378_101319753 199
243 3300013307 Ga0157372_10177736 Ga0157372_101777362 199
244 3300017792 Ga0163161_10275580 Ga0163161_102755802 199
245 3300025908 Ga0207643_10231914 Ga0207643_102319142 199
246 3300025909 Ga0207705_10118267 Ga0207705_101182672 199
247 3300025925 Ga0207650_10152026 Ga0207650_101520262 199
248 3300025931 Ga0207644_10044622 Ga0207644_100446222 199
249 3300025933 Ga0207706_10064905 Ga0207706_100649053 199
250 3300025940 Ga0207691_10174085 Ga0207691_101740853 199
251 3300026067 Ga0207678_10010974 Ga0207678_100109744 199
252 3300026089 Ga0207648_10012759 Ga0207648_100127593 199
253 3300026121 Ga0207683_10145337 Ga0207683_101453373 199
254 3300026142 Ga0207698_10588782 Ga0207698_105887822 199
255 3300028794 Ga0307515_10044865 Ga0307515_100448651 199
256 3300031456 Ga0307513_10014677 Ga0307513_1001467711 199
257 3300031548 Ga0307408_100024419 Ga0307408_1000244194 199
258 3300031548 Ga0307408_100254880 Ga0307408_1002548801 199
259 3300031616 Ga0307508_10000271 Ga0307508_1000027141 199
260 3300031649 Ga0307514_10033853 Ga0307514_100338533 199
261 3300031731 Ga0307405_10022624 Ga0307405_100226243 199
262 3300031901 Ga0307406_10039749 Ga0307406_100397492 199
263 3300031903 Ga0307407_10019398 Ga0307407_100193983 199
264 3300031903 Ga0307407_10401103 Ga0307407_104011032 199
265 3300031911 Ga0307412_10009728 Ga0307412_100097286 199
266 3300031995 Ga0307409_100038806 Ga0307409_1000388062 199
267 3300031995 Ga0307409_100083425 Ga0307409_1000834253 199
268 3300032002 Ga0307416_100433404 Ga0307416_1004334042 199
269 3300032002 Ga0307416_101050396 Ga0307416_1010503962 199
270 3300032004 Ga0307414_10041632 Ga0307414_100416324 199
271 3300032005 Ga0307411_10106287 Ga0307411_101062872 199
272 3300032005 Ga0307411_10145293 Ga0307411_101452933 199
273 3300032126 Ga0307415_100040686 Ga0307415_1000406863 199
274 3300033179 Ga0307507_10064056 Ga0307507_100640564 199
275 3300039438 Ga0436360_0914564 Ga0436360_0914564_448_1053 199
276 3300044656 Ga0466969_0000013 Ga0466969_0000013_62181_62795 199
277 3300044684 Ga0466966_0018350 Ga0466966_0018350_2227_2841 199
278 3300044719 Ga0466971_0081506 Ga0466971_0081506_471_1082 199
279 3300044765 Ga0466970_0043062 Ga0466970_0043062_1472_2086 199
280 3300048904 Ga0496101_0761646 Ga0496101_0761646_126_749 199
281 3300048911 Ga0496108_0591121 Ga0496108_0591121_191_799 199
282 3300048913 Ga0496110_0203340 Ga0496110_0203340_156_764 199
283 3300050493 nmdc:mga0k408_113264_c1 nmdc:mga0k408_113264_c1_873_1529 199
284 3300050493 nmdc:mga0k408_24786_c1 nmdc:mga0k408_24786_c1_1115_1723 199
285 3300050507 nmdc:mga05p37_23603_c1 nmdc:mga05p37_23603_c1_4216_4824 199
286 3300005367 Ga0070667_100000849 Ga0070667_10000084910 200
287 3300006353 Ga0075370_10042650 Ga0075370_100426502 200
288 3300025986 Ga0207658_10000968 Ga0207658_1000096824 200
289 3300028786 Ga0307517_10001975 Ga0307517_1000197521 200
290 3300028794 Ga0307515_10038558 Ga0307515_1003855811 200
291 3300028794 Ga0307515_10196311 Ga0307515_101963113 200
292 3300031456 Ga0307513_10194205 Ga0307513_101942052 200
293 3300031507 Ga0307509_10027173 Ga0307509_100271732 200
294 3300031507 Ga0307509_10111454 Ga0307509_101114543 200
295 3300031507 Ga0307509_10130739 Ga0307509_101307392 200
296 3300031507 Ga0307509_10427668 Ga0307509_104276682 200
297 3300031616 Ga0307508_10003497 Ga0307508_100034978 200
298 3300031616 Ga0307508_10116045 Ga0307508_101160453 200
299 3300031616 Ga0307508_10344064 Ga0307508_103440642 200
300 3300031649 Ga0307514_10108715 Ga0307514_101087152 200
301 3300033180 Ga0307510_10319001 Ga0307510_103190011 200
302 3300035090 Ga0373949_0110931 Ga0373949_0110931_119_733 200
303 3300035691 Ga0373931_0097961 Ga0373931_0097961_379_993 200
304 3300041509 Ga0451843_1777139 Ga0451843_1777139_286_903 200
305 3300046519 Ga0495632_0143692 Ga0495632_0143692_288_905 200
306 3300046524 Ga0495648_0211886 Ga0495648_0211886_276_893 200
307 3300046557 Ga0495622_0128699 Ga0495622_0128699_121_741 200
308 3300048904 Ga0496101_0483473 Ga0496101_0483473_18_632 200
309 3300035695 Ga0373927_0109582 Ga0373927_0109582_546_1160 201
310 3300003316 rootH1_10018683 rootH1_100186832 205
311 3300003320 rootH2_10004838 rootH2_100048382 205
312 3300003322 rootL2_10000579 rootL2_1000057910 205
313 3300003323 rootH1_10149382 rootH1_101493821 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02630

SCO1-SenC

SCO1/SenC

60

194

0.97

PF00578

AhpC-TSA

AhpC/TSA family

51

197

0.89

PF08534

Redoxin

Redoxin

41

206

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gt6-assembly1.cif.gz_A solution structure of human cu(i) sco1 0.9193 46 204
1wp0-assembly1.cif.gz_A human sco1 0.9152 49 205
6n5u-assembly3.cif.gz_C crystal structure of arabidopsis thaliana scoi with copper bound 0.9133 49 200
6n5u-assembly2.cif.gz_B crystal structure of arabidopsis thaliana scoi with copper bound 0.9024 49 200
1wp0-assembly1.cif.gz_A human sco1 0.8938 49 205
ID Description Score Start End Superfamily
af_K7MTL0_161_316_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9215 62 204 3.40.30.10
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9124 49 205 3.40.30.10
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8962 49 205 3.40.30.10
4txoH00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8765 49 202 3.40.30.10
af_Q4D9Q9_96_284_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8715 49 205 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6L6PHQ9-F1-model_v4 Redoxin domain-containing protein 0.9649 49 203 GO:0046872
AF-A0A127P773-F1-model_v4 AhpC/TSA family protein 0.9647 30 202 GO:0046872
AF-A0A2M8NCA2-F1-model_v4 SCO family protein 0.9637 54 203 GO:0046872
AF-A0A2G3L7A3-F1-model_v4 SCO family protein 0.9619 33 205 GO:0046872
AF-A0A6I1HBX6-F1-model_v4 Redoxin domain-containing protein 0.9607 31 204 GO:0046872

Feature Viewer

pLDDT pTM Quality
87.35 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map