F402423
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 313 | 204 | 313 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_113264_c1|nmdc:mga0k408_113264_c1_873_1529 |
| Length | 218 |
| Sequence | VDAVNHHPVVAAVSTLRRLLGATGAAVLVAASLVACDATGNKPAQKLQFKATDITGANYGQSLALTDQDGRQRTLADFKGKVVVVFFGYTQCPDVCPTTMLELAQVKKSLGRDGDRLQAVFITIDPERDTPAVLKSYMASFDPSFVALRGSLEQTQAVAKEFKVFFAKVPGRTPDSYTMDHTAGSYVIDGDGKVRLFVRYGSGAEALTADLKTLLAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 39 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 62 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 97 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 98 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 99 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 100 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 103 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 104 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 106 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 108 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 115 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 116 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 117 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 118 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 119 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 120 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 121 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 125 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 126 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 128 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 129 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 130 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 131 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 132 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 133 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 134 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 135 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 136 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 137 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 138 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 139 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 190 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 191 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 193 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 194 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 195 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 196 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 197 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 198 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 199 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 200 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 202 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 203 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 204 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.45 |
| Nodule | 0 |
| Rhizoplane | 3.19 |
| Rhizosphere | 65.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10018683 | 3300003316 | Bacteria | 5432 |
| 2 | rootH2_10004838 | 3300003320 | Bacteria | 1091 |
| 3 | rootL2_10000579 | 3300003322 | Bacteria | 16628 |
| 4 | rootL2_10154110 | 3300003322 | Bacteria | 1384 |
| 5 | rootH1_10149382 | 3300003323 | Bacteria | 1121 |
| 6 | Ga0070658_10903453 | 3300005327 | Bacteria | 768 |
| 7 | Ga0070676_10472183 | 3300005328 | Bacteria | 886 |
| 8 | Ga0070683_100058343 | 3300005329 | Bacteria | 3586 |
| 9 | Ga0070683_100187546 | 3300005329 | Bacteria | 1963 |
| 10 | Ga0070677_10226786 | 3300005333 | Bacteria | 915 |
| 11 | Ga0068869_100094822 | 3300005334 | Bacteria | 2250 |
| 12 | Ga0070680_100511406 | 3300005336 | Bacteria | 1028 |
| 13 | Ga0070660_101036466 | 3300005339 | Bacteria | 694 |
| 14 | Ga0070689_100057558 | 3300005340 | Bacteria | 3018 |
| 15 | Ga0070661_100087132 | 3300005344 | Bacteria | 2309 |
| 16 | Ga0070668_100237494 | 3300005347 | Bacteria | 1509 |
| 17 | Ga0070675_100649346 | 3300005354 | Bacteria | 959 |
| 18 | Ga0070671_100019405 | 3300005355 | Bacteria | 5532 |
| 19 | Ga0070671_100328922 | 3300005355 | Bacteria | 1303 |
| 20 | Ga0070674_100002407 | 3300005356 | Bacteria | 10331 |
| 21 | Ga0070674_100503031 | 3300005356 | Bacteria | 1009 |
| 22 | Ga0070673_100126081 | 3300005364 | Bacteria | 2142 |
| 23 | Ga0070659_100041287 | 3300005366 | Bacteria | 3605 |
| 24 | Ga0070667_100000849 | 3300005367 | Bacteria | 28386 |
| 25 | Ga0070663_100060662 | 3300005455 | Bacteria | 2721 |
| 26 | Ga0070663_100502012 | 3300005455 | Bacteria | 1007 |
| 27 | Ga0070662_100003686 | 3300005457 | Bacteria | 9578 |
| 28 | Ga0070662_100167376 | 3300005457 | Bacteria | 1723 |
| 29 | Ga0068867_100827875 | 3300005459 | Bacteria | 828 |
| 30 | Ga0070706_100567149 | 3300005467 | Bacteria | 1056 |
| 31 | Ga0070684_100555726 | 3300005535 | Bacteria | 1065 |
| 32 | Ga0068853_100198592 | 3300005539 | Bacteria | 1824 |
| 33 | Ga0068853_100469219 | 3300005539 | Bacteria | 1185 |
| 34 | Ga0070672_100063657 | 3300005543 | Bacteria | 2912 |
| 35 | Ga0070693_100045738 | 3300005547 | Bacteria | 2482 |
| 36 | Ga0070664_100362873 | 3300005564 | Bacteria | 1319 |
| 37 | Ga0068857_100006256 | 3300005577 | Bacteria | 10181 |
| 38 | Ga0068854_100039137 | 3300005578 | Bacteria | 3338 |
| 39 | Ga0068854_100144887 | 3300005578 | Bacteria | 1826 |
| 40 | Ga0068856_100065661 | 3300005614 | Bacteria | 3586 |
| 41 | Ga0068856_100764385 | 3300005614 | Bacteria | 986 |
| 42 | Ga0068852_100237757 | 3300005616 | Bacteria | 1739 |
| 43 | Ga0068852_100346871 | 3300005616 | Bacteria | 1448 |
| 44 | Ga0068851_10041623 | 3300005834 | Bacteria | 2310 |
| 45 | Ga0068858_100006972 | 3300005842 | Bacteria | 10978 |
| 46 | Ga0068862_100535902 | 3300005844 | Bacteria | 1116 |
| 47 | Ga0075365_10131547 | 3300006038 | Bacteria | 1732 |
| 48 | Ga0075365_10385533 | 3300006038 | Bacteria | 989 |
| 49 | Ga0075368_10040715 | 3300006042 | Bacteria | 1824 |
| 50 | Ga0075368_10056410 | 3300006042 | Bacteria | 1567 |
| 51 | Ga0075363_100100369 | 3300006048 | Bacteria | 1601 |
| 52 | Ga0075363_100526487 | 3300006048 | Bacteria | 704 |
| 53 | Ga0075364_10006049 | 3300006051 | Bacteria | 7084 |
| 54 | Ga0075364_10025873 | 3300006051 | Bacteria | 3739 |
| 55 | Ga0075364_10036286 | 3300006051 | Bacteria | 3187 |
| 56 | Ga0075362_10037002 | 3300006177 | Bacteria | 2138 |
| 57 | Ga0075362_10057172 | 3300006177 | Bacteria | 1757 |
| 58 | Ga0075367_10013431 | 3300006178 | Bacteria | 4401 |
| 59 | Ga0075367_10105442 | 3300006178 | Bacteria | 1726 |
| 60 | Ga0075369_10052200 | 3300006186 | Bacteria | 1772 |
| 61 | Ga0075369_10114628 | 3300006186 | Bacteria | 1216 |
| 62 | Ga0075366_10000238 | 3300006195 | Bacteria | 24452 |
| 63 | Ga0075366_10002285 | 3300006195 | Bacteria | 9796 |
| 64 | Ga0075366_10017161 | 3300006195 | Bacteria | 4164 |
| 65 | Ga0075366_10018456 | 3300006195 | Bacteria | 4028 |
| 66 | Ga0075366_10041147 | 3300006195 | Bacteria | 2735 |
| 67 | Ga0075366_10082456 | 3300006195 | Bacteria | 1921 |
| 68 | Ga0075366_10141190 | 3300006195 | Bacteria | 1456 |
| 69 | Ga0075370_10003622 | 3300006353 | Bacteria | 7389 |
| 70 | Ga0075370_10007889 | 3300006353 | Bacteria | 5446 |
| 71 | Ga0075370_10041584 | 3300006353 | Bacteria | 2594 |
| 72 | Ga0075370_10042650 | 3300006353 | Bacteria | 2563 |
| 73 | Ga0068871_100224745 | 3300006358 | Bacteria | 1628 |
| 74 | Ga0068871_100276271 | 3300006358 | Bacteria | 1468 |
| 75 | Ga0068865_100282539 | 3300006881 | Bacteria | 1322 |
| 76 | Ga0105240_10095273 | 3300009093 | Bacteria | 3630 |
| 77 | Ga0114129_10067958 | 3300009147 | Bacteria | 4969 |
| 78 | Ga0105243_10022829 | 3300009148 | Bacteria | 4757 |
| 79 | Ga0105237_10246641 | 3300009545 | Bacteria | 1788 |
| 80 | Ga0105239_10216893 | 3300010375 | Bacteria | 2145 |
| 81 | Ga0157371_10430153 | 3300013102 | Bacteria | 968 |
| 82 | Ga0157370_10058613 | 3300013104 | Bacteria | 3660 |
| 83 | Ga0157374_10335565 | 3300013296 | Bacteria | 1500 |
| 84 | Ga0157378_10131975 | 3300013297 | Bacteria | 2313 |
| 85 | Ga0163162_10851638 | 3300013306 | Bacteria | 1027 |
| 86 | Ga0157372_10177736 | 3300013307 | Bacteria | 2464 |
| 87 | Ga0157379_10010403 | 3300014968 | Bacteria | 8105 |
| 88 | Ga0157379_10921262 | 3300014968 | Bacteria | 830 |
| 89 | Ga0163161_10275580 | 3300017792 | Bacteria | 1318 |
| 90 | Ga0213872_10000068 | 3300021361 | Bacteria | 91693 |
| 91 | Ga0213872_10120530 | 3300021361 | Bacteria | 1160 |
| 92 | Ga0207425_1001233 | 3300025245 | Bacteria | 11212 |
| 93 | Ga0209129_1000062 | 3300025258 | Bacteria | 240655 |
| 94 | Ga0209565_1044382 | 3300025263 | Bacteria | 818 |
| 95 | Ga0209564_1000176 | 3300025295 | Bacteria | 152363 |
| 96 | Ga0209758_1000129 | 3300025297 | Bacteria | 185022 |
| 97 | Ga0209256_1016245 | 3300025299 | Bacteria | 2549 |
| 98 | Ga0207656_10009941 | 3300025321 | Bacteria | 3545 |
| 99 | Ga0207643_10231914 | 3300025908 | Bacteria | 1132 |
| 100 | Ga0207705_10118267 | 3300025909 | Bacteria | 1964 |
| 101 | Ga0207671_10035764 | 3300025914 | Bacteria | 3683 |
| 102 | Ga0207671_10231913 | 3300025914 | Bacteria | 1448 |
| 103 | Ga0207650_10152026 | 3300025925 | Bacteria | 1827 |
| 104 | Ga0207659_10719134 | 3300025926 | Bacteria | 856 |
| 105 | Ga0207644_10044622 | 3300025931 | Bacteria | 3150 |
| 106 | Ga0207690_10392017 | 3300025932 | Bacteria | 1106 |
| 107 | Ga0207706_10004061 | 3300025933 | Bacteria | 13836 |
| 108 | Ga0207706_10009391 | 3300025933 | Bacteria | 8977 |
| 109 | Ga0207706_10064905 | 3300025933 | Bacteria | 3215 |
| 110 | Ga0207709_10125982 | 3300025935 | Bacteria | 1737 |
| 111 | Ga0207704_10033024 | 3300025938 | Bacteria | 2938 |
| 112 | Ga0207691_10020872 | 3300025940 | Bacteria | 6190 |
| 113 | Ga0207691_10174085 | 3300025940 | Bacteria | 1883 |
| 114 | Ga0207689_10195548 | 3300025942 | Bacteria | 1669 |
| 115 | Ga0207661_10507961 | 3300025944 | Bacteria | 1101 |
| 116 | Ga0207640_10066668 | 3300025981 | Bacteria | 2406 |
| 117 | Ga0207658_10000968 | 3300025986 | Bacteria | 23705 |
| 118 | Ga0207677_10226834 | 3300026023 | Bacteria | 1502 |
| 119 | Ga0207703_10362363 | 3300026035 | Bacteria | 1337 |
| 120 | Ga0207639_10314950 | 3300026041 | Bacteria | 1387 |
| 121 | Ga0207639_11009440 | 3300026041 | Bacteria | 779 |
| 122 | Ga0207678_10010974 | 3300026067 | Bacteria | 7957 |
| 123 | Ga0207678_10252381 | 3300026067 | Bacteria | 1511 |
| 124 | Ga0207702_10050850 | 3300026078 | Bacteria | 3499 |
| 125 | Ga0207702_10473276 | 3300026078 | Bacteria | 1218 |
| 126 | Ga0207648_10012759 | 3300026089 | Bacteria | 7852 |
| 127 | Ga0207648_10094301 | 3300026089 | Bacteria | 2617 |
| 128 | Ga0207674_10024496 | 3300026116 | Bacteria | 6448 |
| 129 | Ga0207674_10028633 | 3300026116 | Bacteria | 5876 |
| 130 | Ga0207675_101074901 | 3300026118 | Bacteria | 824 |
| 131 | Ga0207683_10145337 | 3300026121 | Bacteria | 2138 |
| 132 | Ga0207698_10280331 | 3300026142 | Bacteria | 1541 |
| 133 | Ga0207698_10309102 | 3300026142 | Bacteria | 1475 |
| 134 | Ga0207698_10588782 | 3300026142 | Bacteria | 1095 |
| 135 | Ga0268265_10308556 | 3300028380 | Bacteria | 1428 |
| 136 | Ga0268264_10064704 | 3300028381 | Bacteria | 3078 |
| 137 | Ga0307517_10001975 | 3300028786 | Bacteria | 33407 |
| 138 | Ga0307515_10038558 | 3300028794 | Bacteria | 7637 |
| 139 | Ga0307515_10044865 | 3300028794 | Bacteria | 6812 |
| 140 | Ga0307515_10196311 | 3300028794 | Bacteria | 1909 |
| 141 | Ga0307512_10161654 | 3300030522 | Bacteria | 1310 |
| 142 | Ga0307513_10014677 | 3300031456 | Bacteria | 9536 |
| 143 | Ga0307513_10194205 | 3300031456 | Bacteria | 1878 |
| 144 | Ga0307513_10257173 | 3300031456 | Bacteria | 1538 |
| 145 | Ga0307509_10027173 | 3300031507 | Bacteria | 6369 |
| 146 | Ga0307509_10111454 | 3300031507 | Bacteria | 2739 |
| 147 | Ga0307509_10130739 | 3300031507 | Bacteria | 2466 |
| 148 | Ga0307509_10427668 | 3300031507 | Bacteria | 1023 |
| 149 | Ga0307509_10536870 | 3300031507 | Bacteria | 849 |
| 150 | Ga0307408_100024419 | 3300031548 | Bacteria | 4128 |
| 151 | Ga0307408_100254880 | 3300031548 | Bacteria | 1449 |
| 152 | Ga0307508_10000271 | 3300031616 | Bacteria | 63576 |
| 153 | Ga0307508_10003497 | 3300031616 | Bacteria | 15837 |
| 154 | Ga0307508_10116045 | 3300031616 | Bacteria | 2279 |
| 155 | Ga0307508_10344064 | 3300031616 | Bacteria | 1082 |
| 156 | Ga0307514_10033853 | 3300031649 | Bacteria | 4074 |
| 157 | Ga0307514_10104601 | 3300031649 | Bacteria | 2024 |
| 158 | Ga0307514_10108715 | 3300031649 | Bacteria | 1971 |
| 159 | Ga0265314_10024599 | 3300031711 | Bacteria | 4563 |
| 160 | Ga0307516_10000127 | 3300031730 | Bacteria | 90180 |
| 161 | Ga0307516_10143560 | 3300031730 | Bacteria | 2154 |
| 162 | Ga0307516_10420052 | 3300031730 | Bacteria | 995 |
| 163 | Ga0307405_10022624 | 3300031731 | Bacteria | 3557 |
| 164 | Ga0307405_10168112 | 3300031731 | Bacteria | 1561 |
| 165 | Ga0307413_10083985 | 3300031824 | Bacteria | 2051 |
| 166 | Ga0307410_10121538 | 3300031852 | Bacteria | 1905 |
| 167 | Ga0307406_10039749 | 3300031901 | Bacteria | 2921 |
| 168 | Ga0307406_10100531 | 3300031901 | Bacteria | 1969 |
| 169 | Ga0307407_10019398 | 3300031903 | Bacteria | 3462 |
| 170 | Ga0307407_10401103 | 3300031903 | Bacteria | 984 |
| 171 | Ga0307407_10424913 | 3300031903 | Bacteria | 959 |
| 172 | Ga0307412_10009728 | 3300031911 | Bacteria | 5520 |
| 173 | Ga0307412_10800978 | 3300031911 | Bacteria | 818 |
| 174 | Ga0307409_100038806 | 3300031995 | Bacteria | 3526 |
| 175 | Ga0307409_100083425 | 3300031995 | Bacteria | 2591 |
| 176 | Ga0307409_100138043 | 3300031995 | Bacteria | 2096 |
| 177 | Ga0307416_100433404 | 3300032002 | Bacteria | 1362 |
| 178 | Ga0307416_101050396 | 3300032002 | Bacteria | 918 |
| 179 | Ga0307414_10041632 | 3300032004 | Bacteria | 3114 |
| 180 | Ga0307411_10091055 | 3300032005 | Bacteria | 2129 |
| 181 | Ga0307411_10106287 | 3300032005 | Bacteria | 1997 |
| 182 | Ga0307411_10145293 | 3300032005 | Bacteria | 1755 |
| 183 | Ga0307415_100040686 | 3300032126 | Bacteria | 3081 |
| 184 | Ga0307507_10064056 | 3300033179 | Bacteria | 3396 |
| 185 | Ga0307510_10319001 | 3300033180 | Bacteria | 1011 |
| 186 | Ga0307510_10406506 | 3300033180 | Bacteria | 804 |
| 187 | Ga0373949_0110931 | 3300035090 | Bacteria | 761 |
| 188 | Ga0373931_0097961 | 3300035691 | Bacteria | 1645 |
| 189 | Ga0373927_0109582 | 3300035695 | Bacteria | 1799 |
| 190 | Ga0373925_0145270 | 3300037068 | Bacteria | 1859 |
| 191 | Ga0436365_0759607 | 3300039437 | Bacteria | 2318 |
| 192 | Ga0436360_0914564 | 3300039438 | Bacteria | 1240 |
| 193 | Ga0436361_0209135 | 3300039447 | Bacteria | 2586 |
| 194 | Ga0436361_0793297 | 3300039447 | Bacteria | 22989 |
| 195 | Ga0451800_0591280 | 3300041459 | Bacteria | 774 |
| 196 | Ga0451800_1052011 | 3300041459 | Bacteria | 650 |
| 197 | Ga0451843_1777139 | 3300041509 | Bacteria | 938 |
| 198 | Ga0439431_0025254 | 3300041997 | Bacteria | 1450 |
| 199 | Ga0466969_0000013 | 3300044656 | Bacteria | 111537 |
| 200 | Ga0466972_0000828 | 3300044658 | Bacteria | 14809 |
| 201 | Ga0466966_0018350 | 3300044684 | Bacteria | 4615 |
| 202 | Ga0466961_0011529 | 3300044693 | Bacteria | 5653 |
| 203 | Ga0466964_0015309 | 3300044706 | Bacteria | 2918 |
| 204 | Ga0466971_0081506 | 3300044719 | Bacteria | 1476 |
| 205 | Ga0466970_0043062 | 3300044765 | Bacteria | 2402 |
| 206 | Ga0466957_0256495 | 3300044842 | Bacteria | 1164 |
| 207 | Ga0466959_0008628 | 3300045049 | Bacteria | 7213 |
| 208 | Ga0451576_0006110 | 3300045051 | Bacteria | 14839 |
| 209 | Ga0451576_0155533 | 3300045051 | Bacteria | 2385 |
| 210 | Ga0495617_000108 | 3300046452 | Bacteria | 60724 |
| 211 | Ga0495627_052720 | 3300046453 | Bacteria | 1219 |
| 212 | Ga0495592_0000153 | 3300046454 | Bacteria | 60062 |
| 213 | Ga0495585_0094426 | 3300046492 | Bacteria | 1607 |
| 214 | Ga0495594_0389956 | 3300046499 | Bacteria | 792 |
| 215 | Ga0495596_0012046 | 3300046500 | Bacteria | 3712 |
| 216 | Ga0495583_0000907 | 3300046506 | Bacteria | 35148 |
| 217 | Ga0495616_0040899 | 3300046513 | Bacteria | 2366 |
| 218 | Ga0495620_0074720 | 3300046515 | Bacteria | 1380 |
| 219 | Ga0495631_0018020 | 3300046518 | Bacteria | 3331 |
| 220 | Ga0495632_0008136 | 3300046519 | Bacteria | 6484 |
| 221 | Ga0495632_0009357 | 3300046519 | Bacteria | 5915 |
| 222 | Ga0495632_0143692 | 3300046519 | Bacteria | 1106 |
| 223 | Ga0495644_0012503 | 3300046523 | Bacteria | 3263 |
| 224 | Ga0495648_0075269 | 3300046524 | Bacteria | 1942 |
| 225 | Ga0495648_0211886 | 3300046524 | Bacteria | 962 |
| 226 | Ga0495666_0003395 | 3300046526 | Bacteria | 8033 |
| 227 | Ga0495642_0048622 | 3300046528 | Bacteria | 1740 |
| 228 | Ga0495665_0000878 | 3300046531 | Bacteria | 15744 |
| 229 | Ga0495665_0115206 | 3300046531 | Bacteria | 1408 |
| 230 | Ga0495586_0324961 | 3300046535 | Bacteria | 882 |
| 231 | Ga0495587_0004232 | 3300046536 | Bacteria | 9489 |
| 232 | Ga0495609_0187150 | 3300046538 | Bacteria | 870 |
| 233 | Ga0495622_0000567 | 3300046557 | Bacteria | 22203 |
| 234 | Ga0495622_0011544 | 3300046557 | Bacteria | 4083 |
| 235 | Ga0495622_0128699 | 3300046557 | Bacteria | 1154 |
| 236 | Ga0495633_0031099 | 3300046558 | Bacteria | 2590 |
| 237 | Ga0495656_0100384 | 3300046615 | Bacteria | 1338 |
| 238 | Ga0495668_0032281 | 3300046616 | Bacteria | 2947 |
| 239 | Ga0495611_0003678 | 3300046648 | Bacteria | 6719 |
| 240 | Ga0495625_0051109 | 3300046660 | Bacteria | 2964 |
| 241 | Ga0495625_0448284 | 3300046660 | Bacteria | 798 |
| 242 | Ga0495661_0036387 | 3300046665 | Bacteria | 3083 |
| 243 | Ga0495588_0174819 | 3300046674 | Bacteria | 1135 |
| 244 | Ga0495588_0335901 | 3300046674 | Bacteria | 794 |
| 245 | Ga0495623_0041589 | 3300046679 | Bacteria | 2930 |
| 246 | Ga0495623_0104103 | 3300046679 | Bacteria | 1726 |
| 247 | Ga0495669_0007820 | 3300046684 | Bacteria | 4487 |
| 248 | Ga0495613_0055891 | 3300046689 | Bacteria | 2899 |
| 249 | Ga0495613_0137505 | 3300046689 | Bacteria | 1747 |
| 250 | Ga0495624_0020487 | 3300046690 | Bacteria | 4400 |
| 251 | Ga0495670_0036581 | 3300046691 | Bacteria | 2446 |
| 252 | Ga0495671_0049562 | 3300046692 | Bacteria | 2093 |
| 253 | Ga0495649_0002161 | 3300046694 | Bacteria | 14071 |
| 254 | Ga0495589_0034645 | 3300046794 | Bacteria | 2533 |
| 255 | Ga0495660_0010718 | 3300046810 | Bacteria | 5327 |
| 256 | Ga0495660_0077424 | 3300046810 | Bacteria | 1750 |
| 257 | Ga0495581_0002359 | 3300047315 | Bacteria | 10653 |
| 258 | Ga0495581_0035570 | 3300047315 | Bacteria | 2881 |
| 259 | Ga0495676_0063871 | 3300047321 | Bacteria | 2867 |
| 260 | Ga0495683_0014752 | 3300047323 | Bacteria | 4070 |
| 261 | Ga0495683_0276247 | 3300047323 | Bacteria | 729 |
| 262 | Ga0495687_001027 | 3300047443 | Bacteria | 27802 |
| 263 | Ga0495687_009819 | 3300047443 | Bacteria | 5313 |
| 264 | Ga0495675_0098305 | 3300047444 | Bacteria | 1833 |
| 265 | Ga0495677_0021549 | 3300047445 | Bacteria | 2335 |
| 266 | Ga0495679_025012 | 3300047446 | Bacteria | 2002 |
| 267 | Ga0495681_0102214 | 3300047470 | Bacteria | 1251 |
| 268 | Ga0495686_0001940 | 3300047472 | Bacteria | 20588 |
| 269 | Ga0495593_0041762 | 3300047673 | Bacteria | 2464 |
| 270 | Ga0495593_0226695 | 3300047673 | Bacteria | 937 |
| 271 | Ga0496101_0483473 | 3300048904 | Bacteria | 978 |
| 272 | Ga0496101_0761646 | 3300048904 | Bacteria | 764 |
| 273 | Ga0496102_0007775 | 3300048905 | Bacteria | 9163 |
| 274 | Ga0496108_0591121 | 3300048911 | Bacteria | 967 |
| 275 | Ga0496110_0203340 | 3300048913 | Bacteria | 1800 |
| 276 | Ga0496113_0357269 | 3300048916 | Bacteria | 1172 |
| 277 | Ga0496115_0003645 | 3300048918 | Bacteria | 11085 |
| 278 | Ga0496115_0033513 | 3300048918 | Bacteria | 4055 |
| 279 | Ga0501323_009015 | 3300049539 | Bacteria | 1169 |
| 280 | nmdc:mga03683_145071_c1 | 3300050489 | Bacteria | 1069 |
| 281 | nmdc:mga03683_29296_c1 | 3300050489 | Bacteria | 2195 |
| 282 | nmdc:mga03n38_17134_c1 | 3300050490 | Bacteria | 2832 |
| 283 | nmdc:mga03n38_214113_c1 | 3300050490 | Bacteria | 1003 |
| 284 | nmdc:mga00v17_118447_c1 | 3300050491 | Bacteria | 1685 |
| 285 | nmdc:mga00v17_44472_c1 | 3300050491 | Bacteria | 2678 |
| 286 | nmdc:mga0yw44_22416_c1 | 3300050492 | Bacteria | 3541 |
| 287 | nmdc:mga0k408_113264_c1 | 3300050493 | Bacteria | 1604 |
| 288 | nmdc:mga0k408_11856_c1 | 3300050493 | Bacteria | 4756 |
| 289 | nmdc:mga0k408_1796_c1 | 3300050493 | Bacteria | 11501 |
| 290 | nmdc:mga0k408_24786_c1 | 3300050493 | Bacteria | 3394 |
| 291 | nmdc:mga0k408_30782_c1 | 3300050493 | Bacteria | 3062 |
| 292 | nmdc:mga0k408_328659_c1 | 3300050493 | Bacteria | 912 |
| 293 | nmdc:mga0k408_565_c1 | 3300050493 | Bacteria | 20434 |
| 294 | nmdc:mga0k408_580560_c1 | 3300050493 | Bacteria | 662 |
| 295 | nmdc:mga0k408_603_c1 | 3300050493 | Bacteria | 19842 |
| 296 | nmdc:mga0k408_87714_c1 | 3300050493 | Bacteria | 1828 |
| 297 | nmdc:mga06z11_20660_c1 | 3300050494 | Bacteria | 3047 |
| 298 | nmdc:mga06z11_83032_c1 | 3300050494 | Bacteria | 1724 |
| 299 | nmdc:mga04h51_14131_c1 | 3300050495 | Bacteria | 2275 |
| 300 | nmdc:mga04h51_72677_c1 | 3300050495 | Bacteria | 1204 |
| 301 | nmdc:mga07m45_101920_c1 | 3300050496 | Bacteria | 1649 |
| 302 | nmdc:mga07m45_10986_c1 | 3300050496 | Bacteria | 4746 |
| 303 | nmdc:mga07m45_20992_c1 | 3300050496 | Bacteria | 3552 |
| 304 | nmdc:mga07m45_37776_c1 | 3300050496 | Bacteria | 2694 |
| 305 | nmdc:mga07m45_60646_c1 | 3300050496 | Bacteria | 2142 |
| 306 | nmdc:mga07m45_7796_c1 | 3300050496 | Bacteria | 5480 |
| 307 | nmdc:mga05p37_23603_c1 | 3300050507 | Bacteria | 4839 |
| 308 | nmdc:mga0sz30_24496_c1 | 3300050516 | Bacteria | 2463 |
| 309 | nmdc:mga0sz30_29303_c1 | 3300050516 | Bacteria | 1199 |
| 310 | nmdc:mga0sz30_32654_c1 | 3300050516 | Bacteria | 2160 |
| 311 | Ga0500568_0059138 | 3300053139 | Bacteria | 1487 |
| 312 | Ga0500619_083239 | 3300053154 | Bacteria | 1076 |
| 313 | Ga0466962_0042686 | 3300061719 | Bacteria | 2170 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021361 | Ga0213872_10120530 | Ga0213872_101205302 | 176 |
| 2 | 3300039447 | Ga0436361_0209135 | Ga0436361_0209135_122_754 | 176 |
| 3 | 3300025245 | Ga0207425_1001233 | Ga0207425_10012333 | 177 |
| 4 | 3300025258 | Ga0209129_1000062 | Ga0209129_1000062158 | 177 |
| 5 | 3300025263 | Ga0209565_1044382 | Ga0209565_10443821 | 177 |
| 6 | 3300025295 | Ga0209564_1000176 | Ga0209564_100017678 | 177 |
| 7 | 3300025297 | Ga0209758_1000129 | Ga0209758_100012911 | 177 |
| 8 | 3300025299 | Ga0209256_1016245 | Ga0209256_10162452 | 177 |
| 9 | 3300041459 | Ga0451800_1052011 | Ga0451800_1052011_20_628 | 178 |
| 10 | 3300031731 | Ga0307405_10168112 | Ga0307405_101681122 | 179 |
| 11 | 3300031824 | Ga0307413_10083985 | Ga0307413_100839852 | 179 |
| 12 | 3300031852 | Ga0307410_10121538 | Ga0307410_101215382 | 179 |
| 13 | 3300031995 | Ga0307409_100138043 | Ga0307409_1001380432 | 179 |
| 14 | 3300032005 | Ga0307411_10091055 | Ga0307411_100910552 | 179 |
| 15 | 3300006051 | Ga0075364_10006049 | Ga0075364_100060492 | 180 |
| 16 | 3300021361 | Ga0213872_10000068 | Ga0213872_1000006830 | 180 |
| 17 | 3300039447 | Ga0436361_0793297 | Ga0436361_0793297_15833_16477 | 180 |
| 18 | 3300005340 | Ga0070689_100057558 | Ga0070689_1000575584 | 185 |
| 19 | 3300031507 | Ga0307509_10536870 | Ga0307509_105368701 | 185 |
| 20 | 3300041459 | Ga0451800_0591280 | Ga0451800_0591280_126_683 | 185 |
| 21 | 3300050493 | nmdc:mga0k408_328659_c1 | nmdc:mga0k408_328659_c1_329_886 | 185 |
| 22 | 3300013104 | Ga0157370_10058613 | Ga0157370_100586133 | 186 |
| 23 | 3300044693 | Ga0466961_0011529 | Ga0466961_0011529_1300_1908 | 186 |
| 24 | 3300044706 | Ga0466964_0015309 | Ga0466964_0015309_2136_2744 | 186 |
| 25 | 3300044842 | Ga0466957_0256495 | Ga0466957_0256495_378_986 | 186 |
| 26 | 3300045049 | Ga0466959_0008628 | Ga0466959_0008628_6582_7190 | 186 |
| 27 | 3300061719 | Ga0466962_0042686 | Ga0466962_0042686_56_664 | 186 |
| 28 | 3300005328 | Ga0070676_10472183 | Ga0070676_104721832 | 187 |
| 29 | 3300006038 | Ga0075365_10131547 | Ga0075365_101315472 | 187 |
| 30 | 3300006042 | Ga0075368_10056410 | Ga0075368_100564102 | 187 |
| 31 | 3300006051 | Ga0075364_10036286 | Ga0075364_100362862 | 187 |
| 32 | 3300006177 | Ga0075362_10057172 | Ga0075362_100571722 | 187 |
| 33 | 3300006178 | Ga0075367_10013431 | Ga0075367_100134312 | 187 |
| 34 | 3300006186 | Ga0075369_10052200 | Ga0075369_100522002 | 187 |
| 35 | 3300006195 | Ga0075366_10000238 | Ga0075366_100002385 | 187 |
| 36 | 3300006195 | Ga0075366_10082456 | Ga0075366_100824563 | 187 |
| 37 | 3300006353 | Ga0075370_10041584 | Ga0075370_100415843 | 187 |
| 38 | 3300006881 | Ga0068865_100282539 | Ga0068865_1002825391 | 187 |
| 39 | 3300009148 | Ga0105243_10022829 | Ga0105243_100228292 | 187 |
| 40 | 3300025935 | Ga0207709_10125982 | Ga0207709_101259822 | 187 |
| 41 | 3300025938 | Ga0207704_10033024 | Ga0207704_100330243 | 187 |
| 42 | 3300026089 | Ga0207648_10094301 | Ga0207648_100943012 | 187 |
| 43 | 3300026118 | Ga0207675_101074901 | Ga0207675_1010749011 | 187 |
| 44 | 3300031730 | Ga0307516_10420052 | Ga0307516_104200522 | 187 |
| 45 | 3300046515 | Ga0495620_0074720 | Ga0495620_0074720_395_958 | 187 |
| 46 | 3300046519 | Ga0495632_0008136 | Ga0495632_0008136_5179_5742 | 187 |
| 47 | 3300046694 | Ga0495649_0002161 | Ga0495649_0002161_7253_7816 | 187 |
| 48 | 3300046810 | Ga0495660_0077424 | Ga0495660_0077424_444_1007 | 187 |
| 49 | 3300047323 | Ga0495683_0276247 | Ga0495683_0276247_148_711 | 187 |
| 50 | 3300047443 | Ga0495687_009819 | Ga0495687_009819_2422_2985 | 187 |
| 51 | 3300050493 | nmdc:mga0k408_87714_c1 | nmdc:mga0k408_87714_c1_205_768 | 187 |
| 52 | 3300050495 | nmdc:mga04h51_72677_c1 | nmdc:mga04h51_72677_c1_39_602 | 187 |
| 53 | 3300050496 | nmdc:mga07m45_101920_c1 | nmdc:mga07m45_101920_c1_1020_1583 | 187 |
| 54 | 3300053139 | Ga0500568_0059138 | Ga0500568_0059138_380_943 | 187 |
| 55 | 3300031901 | Ga0307406_10100531 | Ga0307406_101005312 | 188 |
| 56 | 3300046518 | Ga0495631_0018020 | Ga0495631_0018020_1585_2178 | 188 |
| 57 | 3300046524 | Ga0495648_0075269 | Ga0495648_0075269_1152_1745 | 188 |
| 58 | 3300046692 | Ga0495671_0049562 | Ga0495671_0049562_1041_1634 | 188 |
| 59 | 3300047443 | Ga0495687_001027 | Ga0495687_001027_6295_6864 | 188 |
| 60 | 3300048918 | Ga0496115_0033513 | Ga0496115_0033513_169_762 | 188 |
| 61 | 3300005334 | Ga0068869_100094822 | Ga0068869_1000948222 | 190 |
| 62 | 3300005354 | Ga0070675_100649346 | Ga0070675_1006493462 | 190 |
| 63 | 3300005364 | Ga0070673_100126081 | Ga0070673_1001260813 | 190 |
| 64 | 3300005455 | Ga0070663_100060662 | Ga0070663_1000606622 | 190 |
| 65 | 3300005457 | Ga0070662_100167376 | Ga0070662_1001673762 | 190 |
| 66 | 3300005577 | Ga0068857_100006256 | Ga0068857_1000062563 | 190 |
| 67 | 3300005578 | Ga0068854_100039137 | Ga0068854_1000391373 | 190 |
| 68 | 3300005616 | Ga0068852_100237757 | Ga0068852_1002377572 | 190 |
| 69 | 3300006038 | Ga0075365_10385533 | Ga0075365_103855332 | 190 |
| 70 | 3300006042 | Ga0075368_10040715 | Ga0075368_100407151 | 190 |
| 71 | 3300006048 | Ga0075363_100100369 | Ga0075363_1001003692 | 190 |
| 72 | 3300006051 | Ga0075364_10025873 | Ga0075364_100258735 | 190 |
| 73 | 3300006177 | Ga0075362_10037002 | Ga0075362_100370022 | 190 |
| 74 | 3300006178 | Ga0075367_10105442 | Ga0075367_101054422 | 190 |
| 75 | 3300006186 | Ga0075369_10114628 | Ga0075369_101146282 | 190 |
| 76 | 3300009093 | Ga0105240_10095273 | Ga0105240_100952732 | 190 |
| 77 | 3300009545 | Ga0105237_10246641 | Ga0105237_102466412 | 190 |
| 78 | 3300010375 | Ga0105239_10216893 | Ga0105239_102168932 | 190 |
| 79 | 3300014968 | Ga0157379_10921262 | Ga0157379_109212622 | 190 |
| 80 | 3300025914 | Ga0207671_10035764 | Ga0207671_100357643 | 190 |
| 81 | 3300025926 | Ga0207659_10719134 | Ga0207659_107191342 | 190 |
| 82 | 3300025932 | Ga0207690_10392017 | Ga0207690_103920172 | 190 |
| 83 | 3300025933 | Ga0207706_10009391 | Ga0207706_100093916 | 190 |
| 84 | 3300025942 | Ga0207689_10195548 | Ga0207689_101955482 | 190 |
| 85 | 3300025981 | Ga0207640_10066668 | Ga0207640_100666682 | 190 |
| 86 | 3300026023 | Ga0207677_10226834 | Ga0207677_102268342 | 190 |
| 87 | 3300026067 | Ga0207678_10252381 | Ga0207678_102523812 | 190 |
| 88 | 3300026116 | Ga0207674_10024496 | Ga0207674_100244962 | 190 |
| 89 | 3300026142 | Ga0207698_10309102 | Ga0207698_103091022 | 190 |
| 90 | 3300049539 | Ga0501323_009015 | Ga0501323_009015_175_759 | 190 |
| 91 | 3300050489 | nmdc:mga03683_145071_c1 | nmdc:mga03683_145071_c1_201_785 | 190 |
| 92 | 3300050490 | nmdc:mga03n38_214113_c1 | nmdc:mga03n38_214113_c1_118_702 | 190 |
| 93 | 3300050491 | nmdc:mga00v17_44472_c1 | nmdc:mga00v17_44472_c1_943_1527 | 190 |
| 94 | 3300050493 | nmdc:mga0k408_30782_c1 | nmdc:mga0k408_30782_c1_60_644 | 190 |
| 95 | 3300050494 | nmdc:mga06z11_83032_c1 | nmdc:mga06z11_83032_c1_1023_1607 | 190 |
| 96 | 3300050496 | nmdc:mga07m45_60646_c1 | nmdc:mga07m45_60646_c1_285_869 | 190 |
| 97 | 3300050516 | nmdc:mga0sz30_24496_c1 | nmdc:mga0sz30_24496_c1_1232_1816 | 190 |
| 98 | 3300031911 | Ga0307412_10800978 | Ga0307412_108009782 | 191 |
| 99 | 3300046660 | Ga0495625_0448284 | Ga0495625_0448284_158_742 | 191 |
| 100 | 3300046794 | Ga0495589_0034645 | Ga0495589_0034645_1944_2519 | 191 |
| 101 | 3300048916 | Ga0496113_0357269 | Ga0496113_0357269_13_591 | 191 |
| 102 | 3300050489 | nmdc:mga03683_29296_c1 | nmdc:mga03683_29296_c1_1383_1967 | 191 |
| 103 | 3300050490 | nmdc:mga03n38_17134_c1 | nmdc:mga03n38_17134_c1_723_1307 | 191 |
| 104 | 3300050491 | nmdc:mga00v17_118447_c1 | nmdc:mga00v17_118447_c1_707_1291 | 191 |
| 105 | 3300050492 | nmdc:mga0yw44_22416_c1 | nmdc:mga0yw44_22416_c1_2699_3283 | 191 |
| 106 | 3300050493 | nmdc:mga0k408_1796_c1 | nmdc:mga0k408_1796_c1_1181_1765 | 191 |
| 107 | 3300050493 | nmdc:mga0k408_565_c1 | nmdc:mga0k408_565_c1_9735_10319 | 191 |
| 108 | 3300050494 | nmdc:mga06z11_20660_c1 | nmdc:mga06z11_20660_c1_1860_2444 | 191 |
| 109 | 3300050495 | nmdc:mga04h51_14131_c1 | nmdc:mga04h51_14131_c1_774_1358 | 191 |
| 110 | 3300050496 | nmdc:mga07m45_10986_c1 | nmdc:mga07m45_10986_c1_1115_1699 | 191 |
| 111 | 3300050516 | nmdc:mga0sz30_29303_c1 | nmdc:mga0sz30_29303_c1_573_1157 | 191 |
| 112 | 3300050516 | nmdc:mga0sz30_32654_c1 | nmdc:mga0sz30_32654_c1_1250_1834 | 191 |
| 113 | 3300005459 | Ga0068867_100827875 | Ga0068867_1008278752 | 192 |
| 114 | 3300005614 | Ga0068856_100764385 | Ga0068856_1007643852 | 192 |
| 115 | 3300006048 | Ga0075363_100526487 | Ga0075363_1005264872 | 192 |
| 116 | 3300006195 | Ga0075366_10002285 | Ga0075366_100022855 | 192 |
| 117 | 3300006195 | Ga0075366_10041147 | Ga0075366_100411472 | 192 |
| 118 | 3300006353 | Ga0075370_10003622 | Ga0075370_100036224 | 192 |
| 119 | 3300006353 | Ga0075370_10007889 | Ga0075370_100078891 | 192 |
| 120 | 3300026078 | Ga0207702_10050850 | Ga0207702_100508502 | 192 |
| 121 | 3300031903 | Ga0307407_10424913 | Ga0307407_104249132 | 192 |
| 122 | 3300050493 | nmdc:mga0k408_11856_c1 | nmdc:mga0k408_11856_c1_1903_2481 | 192 |
| 123 | 3300050493 | nmdc:mga0k408_580560_c1 | nmdc:mga0k408_580560_c1_21_599 | 192 |
| 124 | 3300050493 | nmdc:mga0k408_603_c1 | nmdc:mga0k408_603_c1_15455_16042 | 192 |
| 125 | 3300050496 | nmdc:mga07m45_37776_c1 | nmdc:mga07m45_37776_c1_2007_2594 | 192 |
| 126 | 3300050496 | nmdc:mga07m45_7796_c1 | nmdc:mga07m45_7796_c1_4848_5438 | 192 |
| 127 | 3300005844 | Ga0068862_100535902 | Ga0068862_1005359022 | 193 |
| 128 | 3300006195 | Ga0075366_10017161 | Ga0075366_100171615 | 193 |
| 129 | 3300028380 | Ga0268265_10308556 | Ga0268265_103085562 | 193 |
| 130 | 3300031456 | Ga0307513_10257173 | Ga0307513_102571732 | 193 |
| 131 | 3300031649 | Ga0307514_10104601 | Ga0307514_101046012 | 193 |
| 132 | 3300031730 | Ga0307516_10143560 | Ga0307516_101435602 | 193 |
| 133 | 3300046454 | Ga0495592_0000153 | Ga0495592_0000153_6179_6763 | 193 |
| 134 | 3300053154 | Ga0500619_083239 | Ga0500619_083239_266_850 | 193 |
| 135 | 3300030522 | Ga0307512_10161654 | Ga0307512_101616542 | 194 |
| 136 | 3300033180 | Ga0307510_10406506 | Ga0307510_104065061 | 194 |
| 137 | 3300041997 | Ga0439431_0025254 | Ga0439431_0025254_559_1143 | 194 |
| 138 | 3300046499 | Ga0495594_0389956 | Ga0495594_0389956_86_679 | 194 |
| 139 | 3300046526 | Ga0495666_0003395 | Ga0495666_0003395_6620_7213 | 194 |
| 140 | 3300046531 | Ga0495665_0000878 | Ga0495665_0000878_3769_4362 | 194 |
| 141 | 3300046531 | Ga0495665_0115206 | Ga0495665_0115206_621_1214 | 194 |
| 142 | 3300046535 | Ga0495586_0324961 | Ga0495586_0324961_213_806 | 194 |
| 143 | 3300046536 | Ga0495587_0004232 | Ga0495587_0004232_5583_6176 | 194 |
| 144 | 3300046557 | Ga0495622_0000567 | Ga0495622_0000567_15517_16110 | 194 |
| 145 | 3300046660 | Ga0495625_0051109 | Ga0495625_0051109_1667_2260 | 194 |
| 146 | 3300046674 | Ga0495588_0335901 | Ga0495588_0335901_135_728 | 194 |
| 147 | 3300046679 | Ga0495623_0041589 | Ga0495623_0041589_2150_2743 | 194 |
| 148 | 3300046679 | Ga0495623_0104103 | Ga0495623_0104103_236_829 | 194 |
| 149 | 3300046689 | Ga0495613_0055891 | Ga0495613_0055891_325_918 | 194 |
| 150 | 3300046689 | Ga0495613_0137505 | Ga0495613_0137505_788_1381 | 194 |
| 151 | 3300046690 | Ga0495624_0020487 | Ga0495624_0020487_3723_4316 | 194 |
| 152 | 3300047315 | Ga0495581_0002359 | Ga0495581_0002359_6505_7098 | 194 |
| 153 | 3300047315 | Ga0495581_0035570 | Ga0495581_0035570_1914_2507 | 194 |
| 154 | 3300047444 | Ga0495675_0098305 | Ga0495675_0098305_620_1213 | 194 |
| 155 | 3300047673 | Ga0495593_0041762 | Ga0495593_0041762_1247_1840 | 194 |
| 156 | 3300047673 | Ga0495593_0226695 | Ga0495593_0226695_309_902 | 194 |
| 157 | 3300048918 | Ga0496115_0003645 | Ga0496115_0003645_8650_9243 | 194 |
| 158 | 3300037068 | Ga0373925_0145270 | Ga0373925_0145270_210_797 | 195 |
| 159 | 3300046452 | Ga0495617_000108 | Ga0495617_000108_6315_6920 | 195 |
| 160 | 3300046453 | Ga0495627_052720 | Ga0495627_052720_219_824 | 195 |
| 161 | 3300046500 | Ga0495596_0012046 | Ga0495596_0012046_241_837 | 195 |
| 162 | 3300046506 | Ga0495583_0000907 | Ga0495583_0000907_28226_28822 | 195 |
| 163 | 3300046513 | Ga0495616_0040899 | Ga0495616_0040899_1086_1682 | 195 |
| 164 | 3300046519 | Ga0495632_0009357 | Ga0495632_0009357_4117_4713 | 195 |
| 165 | 3300046523 | Ga0495644_0012503 | Ga0495644_0012503_1709_2305 | 195 |
| 166 | 3300046528 | Ga0495642_0048622 | Ga0495642_0048622_515_1111 | 195 |
| 167 | 3300046538 | Ga0495609_0187150 | Ga0495609_0187150_81_677 | 195 |
| 168 | 3300046558 | Ga0495633_0031099 | Ga0495633_0031099_90_686 | 195 |
| 169 | 3300046615 | Ga0495656_0100384 | Ga0495656_0100384_297_893 | 195 |
| 170 | 3300046616 | Ga0495668_0032281 | Ga0495668_0032281_1792_2388 | 195 |
| 171 | 3300046648 | Ga0495611_0003678 | Ga0495611_0003678_2092_2688 | 195 |
| 172 | 3300046665 | Ga0495661_0036387 | Ga0495661_0036387_1244_1840 | 195 |
| 173 | 3300046684 | Ga0495669_0007820 | Ga0495669_0007820_923_1519 | 195 |
| 174 | 3300046691 | Ga0495670_0036581 | Ga0495670_0036581_171_767 | 195 |
| 175 | 3300046810 | Ga0495660_0010718 | Ga0495660_0010718_991_1587 | 195 |
| 176 | 3300047323 | Ga0495683_0014752 | Ga0495683_0014752_2229_2825 | 195 |
| 177 | 3300047445 | Ga0495677_0021549 | Ga0495677_0021549_994_1590 | 195 |
| 178 | 3300047446 | Ga0495679_025012 | Ga0495679_025012_1057_1653 | 195 |
| 179 | 3300047470 | Ga0495681_0102214 | Ga0495681_0102214_433_1029 | 195 |
| 180 | 3300047472 | Ga0495686_0001940 | Ga0495686_0001940_13517_14107 | 195 |
| 181 | 3300048905 | Ga0496102_0007775 | Ga0496102_0007775_2134_2733 | 195 |
| 182 | 3300050496 | nmdc:mga07m45_20992_c1 | nmdc:mga07m45_20992_c1_2427_3017 | 195 |
| 183 | 3300031711 | Ga0265314_10024599 | Ga0265314_100245992 | 196 |
| 184 | 3300045051 | Ga0451576_0006110 | Ga0451576_0006110_6250_6843 | 196 |
| 185 | 3300046492 | Ga0495585_0094426 | Ga0495585_0094426_818_1417 | 196 |
| 186 | 3300046557 | Ga0495622_0011544 | Ga0495622_0011544_1282_1881 | 196 |
| 187 | 3300046674 | Ga0495588_0174819 | Ga0495588_0174819_73_672 | 196 |
| 188 | 3300047321 | Ga0495676_0063871 | Ga0495676_0063871_144_743 | 196 |
| 189 | 3300005457 | Ga0070662_100003686 | Ga0070662_10000368610 | 197 |
| 190 | 3300025933 | Ga0207706_10004061 | Ga0207706_100040619 | 197 |
| 191 | 3300031730 | Ga0307516_10000127 | Ga0307516_1000012754 | 197 |
| 192 | 3300039437 | Ga0436365_0759607 | Ga0436365_0759607_361_954 | 197 |
| 193 | 3300005329 | Ga0070683_100058343 | Ga0070683_1000583434 | 198 |
| 194 | 3300005329 | Ga0070683_100187546 | Ga0070683_1001875462 | 198 |
| 195 | 3300005336 | Ga0070680_100511406 | Ga0070680_1005114062 | 198 |
| 196 | 3300005344 | Ga0070661_100087132 | Ga0070661_1000871322 | 198 |
| 197 | 3300005355 | Ga0070671_100328922 | Ga0070671_1003289221 | 198 |
| 198 | 3300005366 | Ga0070659_100041287 | Ga0070659_1000412872 | 198 |
| 199 | 3300005455 | Ga0070663_100502012 | Ga0070663_1005020121 | 198 |
| 200 | 3300005535 | Ga0070684_100555726 | Ga0070684_1005557262 | 198 |
| 201 | 3300005539 | Ga0068853_100198592 | Ga0068853_1001985922 | 198 |
| 202 | 3300005539 | Ga0068853_100469219 | Ga0068853_1004692192 | 198 |
| 203 | 3300005543 | Ga0070672_100063657 | Ga0070672_1000636572 | 198 |
| 204 | 3300005547 | Ga0070693_100045738 | Ga0070693_1000457383 | 198 |
| 205 | 3300005564 | Ga0070664_100362873 | Ga0070664_1003628732 | 198 |
| 206 | 3300005578 | Ga0068854_100144887 | Ga0068854_1001448872 | 198 |
| 207 | 3300005614 | Ga0068856_100065661 | Ga0068856_1000656614 | 198 |
| 208 | 3300005616 | Ga0068852_100346871 | Ga0068852_1003468712 | 198 |
| 209 | 3300005834 | Ga0068851_10041623 | Ga0068851_100416233 | 198 |
| 210 | 3300005842 | Ga0068858_100006972 | Ga0068858_10000697211 | 198 |
| 211 | 3300009147 | Ga0114129_10067958 | Ga0114129_100679581 | 198 |
| 212 | 3300013102 | Ga0157371_10430153 | Ga0157371_104301532 | 198 |
| 213 | 3300013296 | Ga0157374_10335565 | Ga0157374_103355651 | 198 |
| 214 | 3300013306 | Ga0163162_10851638 | Ga0163162_108516382 | 198 |
| 215 | 3300014968 | Ga0157379_10010403 | Ga0157379_100104033 | 198 |
| 216 | 3300025321 | Ga0207656_10009941 | Ga0207656_100099413 | 198 |
| 217 | 3300025914 | Ga0207671_10231913 | Ga0207671_102319132 | 198 |
| 218 | 3300025940 | Ga0207691_10020872 | Ga0207691_100208724 | 198 |
| 219 | 3300025944 | Ga0207661_10507961 | Ga0207661_105079612 | 198 |
| 220 | 3300026035 | Ga0207703_10362363 | Ga0207703_103623632 | 198 |
| 221 | 3300026041 | Ga0207639_10314950 | Ga0207639_103149502 | 198 |
| 222 | 3300026041 | Ga0207639_11009440 | Ga0207639_110094402 | 198 |
| 223 | 3300026078 | Ga0207702_10473276 | Ga0207702_104732762 | 198 |
| 224 | 3300026116 | Ga0207674_10028633 | Ga0207674_100286334 | 198 |
| 225 | 3300026142 | Ga0207698_10280331 | Ga0207698_102803312 | 198 |
| 226 | 3300028381 | Ga0268264_10064704 | Ga0268264_100647043 | 198 |
| 227 | 3300044658 | Ga0466972_0000828 | Ga0466972_0000828_6758_7366 | 198 |
| 228 | 3300045051 | Ga0451576_0155533 | Ga0451576_0155533_1432_2031 | 198 |
| 229 | 3300003322 | rootL2_10154110 | rootL2_101541102 | 199 |
| 230 | 3300005327 | Ga0070658_10903453 | Ga0070658_109034531 | 199 |
| 231 | 3300005333 | Ga0070677_10226786 | Ga0070677_102267862 | 199 |
| 232 | 3300005339 | Ga0070660_101036466 | Ga0070660_1010364661 | 199 |
| 233 | 3300005347 | Ga0070668_100237494 | Ga0070668_1002374941 | 199 |
| 234 | 3300005355 | Ga0070671_100019405 | Ga0070671_1000194052 | 199 |
| 235 | 3300005356 | Ga0070674_100002407 | Ga0070674_1000024077 | 199 |
| 236 | 3300005356 | Ga0070674_100503031 | Ga0070674_1005030312 | 199 |
| 237 | 3300005467 | Ga0070706_100567149 | Ga0070706_1005671491 | 199 |
| 238 | 3300006195 | Ga0075366_10018456 | Ga0075366_100184563 | 199 |
| 239 | 3300006195 | Ga0075366_10141190 | Ga0075366_101411902 | 199 |
| 240 | 3300006358 | Ga0068871_100224745 | Ga0068871_1002247452 | 199 |
| 241 | 3300006358 | Ga0068871_100276271 | Ga0068871_1002762711 | 199 |
| 242 | 3300013297 | Ga0157378_10131975 | Ga0157378_101319753 | 199 |
| 243 | 3300013307 | Ga0157372_10177736 | Ga0157372_101777362 | 199 |
| 244 | 3300017792 | Ga0163161_10275580 | Ga0163161_102755802 | 199 |
| 245 | 3300025908 | Ga0207643_10231914 | Ga0207643_102319142 | 199 |
| 246 | 3300025909 | Ga0207705_10118267 | Ga0207705_101182672 | 199 |
| 247 | 3300025925 | Ga0207650_10152026 | Ga0207650_101520262 | 199 |
| 248 | 3300025931 | Ga0207644_10044622 | Ga0207644_100446222 | 199 |
| 249 | 3300025933 | Ga0207706_10064905 | Ga0207706_100649053 | 199 |
| 250 | 3300025940 | Ga0207691_10174085 | Ga0207691_101740853 | 199 |
| 251 | 3300026067 | Ga0207678_10010974 | Ga0207678_100109744 | 199 |
| 252 | 3300026089 | Ga0207648_10012759 | Ga0207648_100127593 | 199 |
| 253 | 3300026121 | Ga0207683_10145337 | Ga0207683_101453373 | 199 |
| 254 | 3300026142 | Ga0207698_10588782 | Ga0207698_105887822 | 199 |
| 255 | 3300028794 | Ga0307515_10044865 | Ga0307515_100448651 | 199 |
| 256 | 3300031456 | Ga0307513_10014677 | Ga0307513_1001467711 | 199 |
| 257 | 3300031548 | Ga0307408_100024419 | Ga0307408_1000244194 | 199 |
| 258 | 3300031548 | Ga0307408_100254880 | Ga0307408_1002548801 | 199 |
| 259 | 3300031616 | Ga0307508_10000271 | Ga0307508_1000027141 | 199 |
| 260 | 3300031649 | Ga0307514_10033853 | Ga0307514_100338533 | 199 |
| 261 | 3300031731 | Ga0307405_10022624 | Ga0307405_100226243 | 199 |
| 262 | 3300031901 | Ga0307406_10039749 | Ga0307406_100397492 | 199 |
| 263 | 3300031903 | Ga0307407_10019398 | Ga0307407_100193983 | 199 |
| 264 | 3300031903 | Ga0307407_10401103 | Ga0307407_104011032 | 199 |
| 265 | 3300031911 | Ga0307412_10009728 | Ga0307412_100097286 | 199 |
| 266 | 3300031995 | Ga0307409_100038806 | Ga0307409_1000388062 | 199 |
| 267 | 3300031995 | Ga0307409_100083425 | Ga0307409_1000834253 | 199 |
| 268 | 3300032002 | Ga0307416_100433404 | Ga0307416_1004334042 | 199 |
| 269 | 3300032002 | Ga0307416_101050396 | Ga0307416_1010503962 | 199 |
| 270 | 3300032004 | Ga0307414_10041632 | Ga0307414_100416324 | 199 |
| 271 | 3300032005 | Ga0307411_10106287 | Ga0307411_101062872 | 199 |
| 272 | 3300032005 | Ga0307411_10145293 | Ga0307411_101452933 | 199 |
| 273 | 3300032126 | Ga0307415_100040686 | Ga0307415_1000406863 | 199 |
| 274 | 3300033179 | Ga0307507_10064056 | Ga0307507_100640564 | 199 |
| 275 | 3300039438 | Ga0436360_0914564 | Ga0436360_0914564_448_1053 | 199 |
| 276 | 3300044656 | Ga0466969_0000013 | Ga0466969_0000013_62181_62795 | 199 |
| 277 | 3300044684 | Ga0466966_0018350 | Ga0466966_0018350_2227_2841 | 199 |
| 278 | 3300044719 | Ga0466971_0081506 | Ga0466971_0081506_471_1082 | 199 |
| 279 | 3300044765 | Ga0466970_0043062 | Ga0466970_0043062_1472_2086 | 199 |
| 280 | 3300048904 | Ga0496101_0761646 | Ga0496101_0761646_126_749 | 199 |
| 281 | 3300048911 | Ga0496108_0591121 | Ga0496108_0591121_191_799 | 199 |
| 282 | 3300048913 | Ga0496110_0203340 | Ga0496110_0203340_156_764 | 199 |
| 283 | 3300050493 | nmdc:mga0k408_113264_c1 | nmdc:mga0k408_113264_c1_873_1529 | 199 |
| 284 | 3300050493 | nmdc:mga0k408_24786_c1 | nmdc:mga0k408_24786_c1_1115_1723 | 199 |
| 285 | 3300050507 | nmdc:mga05p37_23603_c1 | nmdc:mga05p37_23603_c1_4216_4824 | 199 |
| 286 | 3300005367 | Ga0070667_100000849 | Ga0070667_10000084910 | 200 |
| 287 | 3300006353 | Ga0075370_10042650 | Ga0075370_100426502 | 200 |
| 288 | 3300025986 | Ga0207658_10000968 | Ga0207658_1000096824 | 200 |
| 289 | 3300028786 | Ga0307517_10001975 | Ga0307517_1000197521 | 200 |
| 290 | 3300028794 | Ga0307515_10038558 | Ga0307515_1003855811 | 200 |
| 291 | 3300028794 | Ga0307515_10196311 | Ga0307515_101963113 | 200 |
| 292 | 3300031456 | Ga0307513_10194205 | Ga0307513_101942052 | 200 |
| 293 | 3300031507 | Ga0307509_10027173 | Ga0307509_100271732 | 200 |
| 294 | 3300031507 | Ga0307509_10111454 | Ga0307509_101114543 | 200 |
| 295 | 3300031507 | Ga0307509_10130739 | Ga0307509_101307392 | 200 |
| 296 | 3300031507 | Ga0307509_10427668 | Ga0307509_104276682 | 200 |
| 297 | 3300031616 | Ga0307508_10003497 | Ga0307508_100034978 | 200 |
| 298 | 3300031616 | Ga0307508_10116045 | Ga0307508_101160453 | 200 |
| 299 | 3300031616 | Ga0307508_10344064 | Ga0307508_103440642 | 200 |
| 300 | 3300031649 | Ga0307514_10108715 | Ga0307514_101087152 | 200 |
| 301 | 3300033180 | Ga0307510_10319001 | Ga0307510_103190011 | 200 |
| 302 | 3300035090 | Ga0373949_0110931 | Ga0373949_0110931_119_733 | 200 |
| 303 | 3300035691 | Ga0373931_0097961 | Ga0373931_0097961_379_993 | 200 |
| 304 | 3300041509 | Ga0451843_1777139 | Ga0451843_1777139_286_903 | 200 |
| 305 | 3300046519 | Ga0495632_0143692 | Ga0495632_0143692_288_905 | 200 |
| 306 | 3300046524 | Ga0495648_0211886 | Ga0495648_0211886_276_893 | 200 |
| 307 | 3300046557 | Ga0495622_0128699 | Ga0495622_0128699_121_741 | 200 |
| 308 | 3300048904 | Ga0496101_0483473 | Ga0496101_0483473_18_632 | 200 |
| 309 | 3300035695 | Ga0373927_0109582 | Ga0373927_0109582_546_1160 | 201 |
| 310 | 3300003316 | rootH1_10018683 | rootH1_100186832 | 205 |
| 311 | 3300003320 | rootH2_10004838 | rootH2_100048382 | 205 |
| 312 | 3300003322 | rootL2_10000579 | rootL2_1000057910 | 205 |
| 313 | 3300003323 | rootH1_10149382 | rootH1_101493821 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gt6-assembly1.cif.gz_A | solution structure of human cu(i) sco1 | 0.9193 | 46 | 204 |
| 1wp0-assembly1.cif.gz_A | human sco1 | 0.9152 | 49 | 205 |
| 6n5u-assembly3.cif.gz_C | crystal structure of arabidopsis thaliana scoi with copper bound | 0.9133 | 49 | 200 |
| 6n5u-assembly2.cif.gz_B | crystal structure of arabidopsis thaliana scoi with copper bound | 0.9024 | 49 | 200 |
| 1wp0-assembly1.cif.gz_A | human sco1 | 0.8938 | 49 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7MTL0_161_316_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9215 | 62 | 204 | 3.40.30.10 |
| af_Q54TT7_154_312_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9124 | 49 | 205 | 3.40.30.10 |
| af_Q54TT7_154_312_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8962 | 49 | 205 | 3.40.30.10 |
| 4txoH00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8765 | 49 | 202 | 3.40.30.10 |
| af_Q4D9Q9_96_284_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8715 | 49 | 205 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L6PHQ9-F1-model_v4 | Redoxin domain-containing protein | 0.9649 | 49 | 203 |
GO:0046872
|
| AF-A0A127P773-F1-model_v4 | AhpC/TSA family protein | 0.9647 | 30 | 202 |
GO:0046872
|
| AF-A0A2M8NCA2-F1-model_v4 | SCO family protein | 0.9637 | 54 | 203 |
GO:0046872
|
| AF-A0A2G3L7A3-F1-model_v4 | SCO family protein | 0.9619 | 33 | 205 |
GO:0046872
|
| AF-A0A6I1HBX6-F1-model_v4 | Redoxin domain-containing protein | 0.9607 | 31 | 204 |
GO:0046872
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar