F402380
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 313 | 210 | 256 | 287 |
Family's Representative Sequence
| Representative Sequence | 3300048926|Ga0496123_0004114|Ga0496123_0004114_6421_7443 |
| Length | 340 |
| Sequence | MEEFYLLLSKVRETYHPDPMAGQIAWHAGYSEMCPLPFSGVFFMTMHSFRSRLIAGALSLAFALPMSAMAAPDVAVGPQYDTTHVYVQNADIDAFVTSFVNTFGGKASPRAVFTVTPTPSKTASQYVQTPVGMLSVFAFQTPIPYGFGEERTGYLVTDIHEATKAAVEAGADVTVEPFDDPIGKDVIIQWAGGVNMQLYWHTKAPSYAPLHSVPDNRVYVSKVSGDKFINQFKQFAHARVLADDKIDGAEIGRAGEQVRRVQMSSGFGKMMVFVSDGKLPFPYGRETTGYQVDDVAATLEKAAANGVKVLVAPVKTSQGNVSAMVEFPGGYISEIHNAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 3 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 4 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 5 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 6 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 7 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 8 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 9 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 10 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 11 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 12 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 13 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 14 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 15 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 16 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 17 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 18 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 19 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 20 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 21 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 22 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 23 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 24 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 25 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 26 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 27 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 28 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 29 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 30 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 31 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 32 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 33 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 34 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 35 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 36 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 37 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 38 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 39 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 40 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 41 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 42 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 43 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 44 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 45 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 46 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 47 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 48 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 49 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 50 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 51 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 52 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 53 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 54 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 57 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 61 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 75 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 99 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 126 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 131 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 132 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 133 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 134 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 135 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 136 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 137 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 138 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 180 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 181 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 182 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 183 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 184 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 185 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 186 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 187 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 188 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 189 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 190 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 191 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 192 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 195 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 196 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 200 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 201 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 202 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 203 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 204 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 205 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 206 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 207 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 208 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 209 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 210 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.79 |
| Metatranscriptomes | 0 |
| Isolates | 18.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.71 |
| Nodule | 0.96 |
| Rhizoplane | 4.47 |
| Rhizosphere | 67.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1090316 | 2162886007 | Bacteria | 1168 |
| 2 | JGI24738J21930_10000033 | 3300002075 | Bacteria | 26047 |
| 3 | rootH1_10252467 | 3300003323 | Bacteria | 2207 |
| 4 | Ga0055538_1000140 | 3300003751 | Bacteria | 50617 |
| 5 | Ga0055539_1000191 | 3300003752 | Bacteria | 50617 |
| 6 | Ga0055533_1000191 | 3300003756 | Bacteria | 50617 |
| 7 | Ga0055532_1000194 | 3300003758 | Bacteria | 50617 |
| 8 | Ga0055525_1000258 | 3300003759 | Bacteria | 50617 |
| 9 | Ga0055541_1000126 | 3300003841 | Bacteria | 50617 |
| 10 | Ga0065165_1000001 | 3300005262 | Bacteria | 494087 |
| 11 | Ga0070658_10253505 | 3300005327 | Bacteria | 1493 |
| 12 | Ga0070690_100120449 | 3300005330 | Bacteria | 1761 |
| 13 | Ga0070670_100000170 | 3300005331 | Bacteria | 58712 |
| 14 | Ga0070670_100026041 | 3300005331 | Bacteria | 5034 |
| 15 | Ga0070661_100000831 | 3300005344 | Bacteria | 22200 |
| 16 | Ga0070661_100135980 | 3300005344 | Bacteria | 1850 |
| 17 | Ga0070669_100003061 | 3300005353 | Bacteria | 12025 |
| 18 | Ga0070710_10041193 | 3300005437 | Bacteria | 2548 |
| 19 | Ga0070663_100276782 | 3300005455 | Bacteria | 1336 |
| 20 | Ga0070706_100213862 | 3300005467 | Bacteria | 1800 |
| 21 | Ga0070664_100000996 | 3300005564 | Bacteria | 22200 |
| 22 | Ga0068851_10000188 | 3300005834 | Bacteria | 30806 |
| 23 | Ga0068858_100111233 | 3300005842 | Bacteria | 2558 |
| 24 | Ga0070717_10245740 | 3300006028 | Unclassified | 1579 |
| 25 | Ga0075364_10064275 | 3300006051 | Bacteria | 2409 |
| 26 | Ga0075427_10001901 | 3300006194 | Bacteria | 2743 |
| 27 | Ga0079104_1005923 | 3300006946 | Bacteria | 4751 |
| 28 | Ga0075435_100398495 | 3300007076 | Unclassified | 1183 |
| 29 | Ga0099795_10010608 | 3300007788 | Bacteria | 2719 |
| 30 | Ga0099795_10127876 | 3300007788 | Bacteria | 1022 |
| 31 | Ga0105251_10000347 | 3300009011 | Bacteria | 46060 |
| 32 | Ga0105251_10005571 | 3300009011 | Bacteria | 8192 |
| 33 | Ga0105251_10020142 | 3300009011 | Bacteria | 3509 |
| 34 | Ga0105251_10023454 | 3300009011 | Bacteria | 3184 |
| 35 | Ga0105244_10004031 | 3300009036 | Bacteria | 10261 |
| 36 | Ga0105244_10005455 | 3300009036 | Bacteria | 8456 |
| 37 | Ga0105250_10000230 | 3300009092 | Bacteria | 46821 |
| 38 | Ga0105250_10000436 | 3300009092 | Bacteria | 30500 |
| 39 | Ga0105250_10025542 | 3300009092 | Bacteria | 2380 |
| 40 | Ga0105247_10023935 | 3300009101 | Bacteria | 3680 |
| 41 | Ga0105248_10119042 | 3300009177 | Bacteria | 2979 |
| 42 | Ga0105237_10012458 | 3300009545 | Bacteria | 8963 |
| 43 | Ga0105249_10366552 | 3300009553 | Unclassified | 1463 |
| 44 | Ga0099796_10001034 | 3300010159 | Bacteria | 5274 |
| 45 | Ga0105239_10143575 | 3300010375 | Bacteria | 2661 |
| 46 | Ga0157373_10003621 | 3300013100 | Bacteria | 11666 |
| 47 | Ga0157373_10018177 | 3300013100 | Bacteria | 5120 |
| 48 | Ga0157373_10024165 | 3300013100 | Bacteria | 4404 |
| 49 | Ga0157371_10147832 | 3300013102 | Bacteria | 1675 |
| 50 | Ga0157370_10015177 | 3300013104 | Bacteria | 7846 |
| 51 | Ga0157370_10033749 | 3300013104 | Bacteria | 4987 |
| 52 | Ga0157370_10281127 | 3300013104 | Bacteria | 1538 |
| 53 | Ga0157370_10307281 | 3300013104 | Bacteria | 1464 |
| 54 | Ga0157369_10016040 | 3300013105 | Bacteria | 8430 |
| 55 | Ga0157369_10019343 | 3300013105 | Bacteria | 7618 |
| 56 | Ga0163162_10104311 | 3300013306 | Bacteria | 2930 |
| 57 | Ga0157375_10009958 | 3300013308 | Bacteria | 8358 |
| 58 | Ga0182008_10000243 | 3300014497 | Bacteria | 42328 |
| 59 | Ga0182008_10000445 | 3300014497 | Bacteria | 31422 |
| 60 | Ga0182008_10003187 | 3300014497 | Bacteria | 10027 |
| 61 | Ga0182008_10067144 | 3300014497 | Bacteria | 1765 |
| 62 | Ga0182006_1000005 | 3300015261 | Bacteria | 621201 |
| 63 | Ga0182006_1000023 | 3300015261 | Bacteria | 275031 |
| 64 | Ga0182006_1002544 | 3300015261 | Bacteria | 9893 |
| 65 | Ga0182006_1002929 | 3300015261 | Bacteria | 9048 |
| 66 | Ga0182007_10004211 | 3300015262 | Bacteria | 6575 |
| 67 | Ga0182005_1000004 | 3300015265 | Bacteria | 609645 |
| 68 | Ga0182005_1000154 | 3300015265 | Bacteria | 48125 |
| 69 | Ga0182005_1002363 | 3300015265 | Bacteria | 6797 |
| 70 | Ga0163161_10009367 | 3300017792 | Bacteria | 6777 |
| 71 | Ga0163161_10011764 | 3300017792 | Bacteria | 6068 |
| 72 | Ga0163161_10064603 | 3300017792 | Bacteria | 2670 |
| 73 | Ga0213872_10002763 | 3300021361 | Bacteria | 10065 |
| 74 | Ga0213872_10003251 | 3300021361 | Bacteria | 9069 |
| 75 | Ga0209784_100161 | 3300025224 | Bacteria | 58895 |
| 76 | Ga0209566_100213 | 3300025225 | Bacteria | 58895 |
| 77 | Ga0209674_100208 | 3300025226 | Bacteria | 58895 |
| 78 | Ga0209147_100249 | 3300025229 | Bacteria | 51703 |
| 79 | Ga0209563_100159 | 3300025230 | Bacteria | 58895 |
| 80 | Ga0209258_100438 | 3300025242 | Bacteria | 47519 |
| 81 | Ga0209646_1000676 | 3300025246 | Bacteria | 12429 |
| 82 | Ga0209677_100163 | 3300025253 | Bacteria | 58895 |
| 83 | Ga0209051_1001881 | 3300025303 | Bacteria | 16431 |
| 84 | Ga0207656_10003038 | 3300025321 | Bacteria | 5734 |
| 85 | Ga0207696_1000011 | 3300025711 | Bacteria | 530614 |
| 86 | Ga0207696_1000297 | 3300025711 | Bacteria | 57833 |
| 87 | Ga0207655_1003063 | 3300025728 | Bacteria | 12740 |
| 88 | Ga0207655_1036048 | 3300025728 | Bacteria | 2199 |
| 89 | Ga0207713_1000193 | 3300025735 | Bacteria | 85067 |
| 90 | Ga0207713_1002416 | 3300025735 | Bacteria | 13636 |
| 91 | Ga0207647_10000306 | 3300025904 | Bacteria | 40485 |
| 92 | Ga0207705_10352569 | 3300025909 | Bacteria | 1134 |
| 93 | Ga0207671_10008342 | 3300025914 | Bacteria | 8798 |
| 94 | Ga0207649_10000088 | 3300025920 | Bacteria | 77105 |
| 95 | Ga0207649_10104747 | 3300025920 | Bacteria | 1879 |
| 96 | Ga0207681_10001801 | 3300025923 | Bacteria | 13741 |
| 97 | Ga0207650_10000077 | 3300025925 | Bacteria | 132010 |
| 98 | Ga0207650_10000357 | 3300025925 | Bacteria | 44045 |
| 99 | Ga0207687_10043942 | 3300025927 | Bacteria | 3081 |
| 100 | Ga0207686_10003595 | 3300025934 | Bacteria | 8310 |
| 101 | Ga0207665_10067775 | 3300025939 | Bacteria | 2431 |
| 102 | Ga0207665_10445870 | 3300025939 | Bacteria | 992 |
| 103 | Ga0207679_10000034 | 3300025945 | Bacteria | 147162 |
| 104 | Ga0207640_10366263 | 3300025981 | Bacteria | 1163 |
| 105 | Ga0207703_10324334 | 3300026035 | Bacteria | 1411 |
| 106 | Ga0207678_10412409 | 3300026067 | Bacteria | 1170 |
| 107 | Ga0209281_1003078 | 3300027111 | Bacteria | 5848 |
| 108 | Ga0316181_1058333 | 3300030744 | Bacteria | 2170 |
| 109 | Ga0307405_10000340 | 3300031731 | Bacteria | 17412 |
| 110 | Ga0307412_10001045 | 3300031911 | Bacteria | 15821 |
| 111 | Ga0436361_0980487 | 3300039447 | Bacteria | 5289 |
| 112 | Ga0436361_1109625 | 3300039447 | Bacteria | 4256 |
| 113 | Ga0439436_0000002 | 3300041404 | Bacteria | 248787 |
| 114 | Ga0439465_0000411 | 3300041413 | Bacteria | 12484 |
| 115 | Ga0451851_0644146 | 3300041507 | Bacteria | 891 |
| 116 | Ga0451853_0353486 | 3300041512 | Bacteria | 914 |
| 117 | Ga0439445_0018594 | 3300042004 | Bacteria | 1726 |
| 118 | Ga0439432_000028 | 3300042006 | Bacteria | 48652 |
| 119 | Ga0450894_008806 | 3300042131 | Bacteria | 1306 |
| 120 | Ga0466968_0035833 | 3300044735 | Bacteria | 2077 |
| 121 | Ga0495617_000016 | 3300046452 | Bacteria | 253600 |
| 122 | Ga0495627_000371 | 3300046453 | Bacteria | 41727 |
| 123 | Ga0495591_000358 | 3300046458 | Bacteria | 39879 |
| 124 | Ga0495638_0000044 | 3300046460 | Bacteria | 221595 |
| 125 | Ga0495638_0033509 | 3300046460 | Bacteria | 3285 |
| 126 | Ga0495638_0142391 | 3300046460 | Bacteria | 1398 |
| 127 | Ga0495653_0000409 | 3300046463 | Bacteria | 34377 |
| 128 | Ga0495650_0011995 | 3300046471 | Bacteria | 4691 |
| 129 | Ga0495650_0093347 | 3300046471 | Bacteria | 1141 |
| 130 | Ga0495605_0000006 | 3300046474 | Bacteria | 361304 |
| 131 | Ga0495584_0009480 | 3300046491 | Bacteria | 5012 |
| 132 | Ga0495585_0000001 | 3300046492 | Bacteria | 609804 |
| 133 | Ga0495585_0000494 | 3300046492 | Bacteria | 37273 |
| 134 | Ga0495585_0003791 | 3300046492 | Bacteria | 10077 |
| 135 | Ga0495607_0000030 | 3300046501 | Bacteria | 154557 |
| 136 | Ga0495583_0005907 | 3300046506 | Bacteria | 8138 |
| 137 | Ga0495583_0018668 | 3300046506 | Bacteria | 3645 |
| 138 | Ga0495606_0000156 | 3300046507 | Bacteria | 118821 |
| 139 | Ga0495606_0001939 | 3300046507 | Bacteria | 25609 |
| 140 | Ga0495606_0002200 | 3300046507 | Bacteria | 23358 |
| 141 | Ga0495606_0008227 | 3300046507 | Bacteria | 9112 |
| 142 | Ga0495606_0010607 | 3300046507 | Bacteria | 7626 |
| 143 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 144 | Ga0495610_0000184 | 3300046512 | Bacteria | 69871 |
| 145 | Ga0495610_0003095 | 3300046512 | Bacteria | 13274 |
| 146 | Ga0495610_0018404 | 3300046512 | Bacteria | 3948 |
| 147 | Ga0495616_0000001 | 3300046513 | Bacteria | 780061 |
| 148 | Ga0495620_0000131 | 3300046515 | Bacteria | 60856 |
| 149 | Ga0495620_0017630 | 3300046515 | Bacteria | 3552 |
| 150 | Ga0495620_0056060 | 3300046515 | Bacteria | 1659 |
| 151 | Ga0495620_0060878 | 3300046515 | Bacteria | 1572 |
| 152 | Ga0495631_0000107 | 3300046518 | Bacteria | 55048 |
| 153 | Ga0495631_0003991 | 3300046518 | Bacteria | 7956 |
| 154 | Ga0495632_0000003 | 3300046519 | Bacteria | 396071 |
| 155 | Ga0495632_0000746 | 3300046519 | Bacteria | 29315 |
| 156 | Ga0495632_0000794 | 3300046519 | Bacteria | 28049 |
| 157 | Ga0495632_0142448 | 3300046519 | Bacteria | 1111 |
| 158 | Ga0495644_0018087 | 3300046523 | Bacteria | 2691 |
| 159 | Ga0495648_0000558 | 3300046524 | Bacteria | 39821 |
| 160 | Ga0495648_0000675 | 3300046524 | Bacteria | 36444 |
| 161 | Ga0495648_0023407 | 3300046524 | Bacteria | 4230 |
| 162 | Ga0495648_0202541 | 3300046524 | Bacteria | 992 |
| 163 | Ga0495654_0008922 | 3300046530 | Bacteria | 5510 |
| 164 | Ga0495609_0000484 | 3300046538 | Bacteria | 31896 |
| 165 | Ga0495609_0006391 | 3300046538 | Bacteria | 6013 |
| 166 | Ga0495668_0000363 | 3300046616 | Bacteria | 60009 |
| 167 | Ga0495668_0009629 | 3300046616 | Bacteria | 5913 |
| 168 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 169 | Ga0495611_0000006 | 3300046648 | Bacteria | 249842 |
| 170 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 171 | Ga0495625_0006505 | 3300046660 | Bacteria | 10382 |
| 172 | Ga0495659_0134456 | 3300046664 | Bacteria | 983 |
| 173 | Ga0495661_0000098 | 3300046665 | Bacteria | 106670 |
| 174 | Ga0495661_0000376 | 3300046665 | Bacteria | 48234 |
| 175 | Ga0495670_0000873 | 3300046691 | Bacteria | 14607 |
| 176 | Ga0495670_0001413 | 3300046691 | Bacteria | 11781 |
| 177 | Ga0495670_0001674 | 3300046691 | Bacteria | 10884 |
| 178 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 179 | Ga0495671_0000766 | 3300046692 | Bacteria | 23070 |
| 180 | Ga0495671_0026257 | 3300046692 | Bacteria | 3020 |
| 181 | Ga0495649_0007824 | 3300046694 | Bacteria | 6476 |
| 182 | Ga0495589_0000016 | 3300046794 | Bacteria | 209027 |
| 183 | Ga0495660_0000018 | 3300046810 | Bacteria | 317061 |
| 184 | Ga0495660_0000025 | 3300046810 | Bacteria | 260275 |
| 185 | Ga0495660_0000203 | 3300046810 | Bacteria | 62255 |
| 186 | Ga0495660_0000712 | 3300046810 | Bacteria | 25502 |
| 187 | Ga0495660_0001687 | 3300046810 | Bacteria | 14790 |
| 188 | Ga0495660_0038949 | 3300046810 | Bacteria | 2641 |
| 189 | Ga0495672_0005795 | 3300047320 | Bacteria | 9707 |
| 190 | Ga0495683_0012228 | 3300047323 | Bacteria | 4511 |
| 191 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 192 | Ga0495679_011180 | 3300047446 | Bacteria | 3480 |
| 193 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 194 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 195 | Ga0495673_0000018 | 3300047469 | Bacteria | 569190 |
| 196 | Ga0495673_0000030 | 3300047469 | Bacteria | 468915 |
| 197 | Ga0495673_0000100 | 3300047469 | Bacteria | 173962 |
| 198 | Ga0495673_0003952 | 3300047469 | Bacteria | 9497 |
| 199 | Ga0495673_0099305 | 3300047469 | Bacteria | 1179 |
| 200 | Ga0495681_0010927 | 3300047470 | Bacteria | 5454 |
| 201 | Ga0495681_0067179 | 3300047470 | Bacteria | 1635 |
| 202 | Ga0495686_0000037 | 3300047472 | Bacteria | 307937 |
| 203 | Ga0495686_0021501 | 3300047472 | Bacteria | 4282 |
| 204 | Ga0495686_0075136 | 3300047472 | Bacteria | 2072 |
| 205 | Ga0495626_0000004 | 3300048091 | Bacteria | 356599 |
| 206 | Ga0496100_0001279 | 3300048903 | Bacteria | 12275 |
| 207 | Ga0496103_0011278 | 3300048906 | Bacteria | 5293 |
| 208 | Ga0496104_0000014 | 3300048907 | Bacteria | 377972 |
| 209 | Ga0496106_0032811 | 3300048909 | Bacteria | 3872 |
| 210 | Ga0496113_0104269 | 3300048916 | Bacteria | 2200 |
| 211 | Ga0496116_0046794 | 3300048919 | Bacteria | 2917 |
| 212 | Ga0496117_0000790 | 3300048920 | Bacteria | 49640 |
| 213 | Ga0496117_0012500 | 3300048920 | Bacteria | 7474 |
| 214 | Ga0496117_0136773 | 3300048920 | Bacteria | 1474 |
| 215 | Ga0496118_0002619 | 3300048921 | Bacteria | 23871 |
| 216 | Ga0496118_0024837 | 3300048921 | Bacteria | 5160 |
| 217 | Ga0496118_0060955 | 3300048921 | Bacteria | 2797 |
| 218 | Ga0496119_0007005 | 3300048922 | Bacteria | 10269 |
| 219 | Ga0496119_0102956 | 3300048922 | Bacteria | 1599 |
| 220 | Ga0496120_0007221 | 3300048923 | Bacteria | 8317 |
| 221 | Ga0496120_0028464 | 3300048923 | Bacteria | 3424 |
| 222 | Ga0496121_0000044 | 3300048924 | Bacteria | 337672 |
| 223 | Ga0496121_0000501 | 3300048924 | Bacteria | 74907 |
| 224 | Ga0496121_0001054 | 3300048924 | Bacteria | 48888 |
| 225 | Ga0496122_0019807 | 3300048925 | Bacteria | 6126 |
| 226 | Ga0496122_0032555 | 3300048925 | Bacteria | 4308 |
| 227 | Ga0496122_0046262 | 3300048925 | Bacteria | 3372 |
| 228 | Ga0496122_0059843 | 3300048925 | Bacteria | 2810 |
| 229 | Ga0496122_0117911 | 3300048925 | Bacteria | 1722 |
| 230 | Ga0496123_0000022 | 3300048926 | Bacteria | 361832 |
| 231 | Ga0496123_0004114 | 3300048926 | Bacteria | 15593 |
| 232 | Ga0496123_0024773 | 3300048926 | Bacteria | 4548 |
| 233 | Ga0496123_0201537 | 3300048926 | Bacteria | 1019 |
| 234 | Ga0496124_0000944 | 3300048927 | Bacteria | 46593 |
| 235 | Ga0496124_0087416 | 3300048927 | Bacteria | 2549 |
| 236 | Ga0496124_0105247 | 3300048927 | Bacteria | 2280 |
| 237 | Ga0496125_0003182 | 3300048928 | Bacteria | 20322 |
| 238 | Ga0496125_0005972 | 3300048928 | Bacteria | 13327 |
| 239 | Ga0496125_0045582 | 3300048928 | Bacteria | 3688 |
| 240 | Ga0496126_0005097 | 3300048929 | Bacteria | 15231 |
| 241 | Ga0496126_0007003 | 3300048929 | Bacteria | 12454 |
| 242 | Ga0496126_0021064 | 3300048929 | Bacteria | 6378 |
| 243 | Ga0496126_0096418 | 3300048929 | Bacteria | 2592 |
| 244 | Ga0496126_0120578 | 3300048929 | Bacteria | 2275 |
| 245 | Ga0495678_002305 | 3300049459 | Bacteria | 13166 |
| 246 | Ga0495682_0000108 | 3300049460 | Bacteria | 73226 |
| 247 | Ga0501249_001560 | 3300049679 | Bacteria | 4693 |
| 248 | Ga0501269_000266 | 3300049766 | Bacteria | 14820 |
| 249 | nmdc:mga05p37_446828_c1 | 3300050507 | Bacteria | 1498 |
| 250 | nmdc:mga09592_41130_c1 | 3300050508 | Bacteria | 3886 |
| 251 | nmdc:mga06r32_60554_c1 | 3300050510 | Bacteria | 3644 |
| 252 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 253 | Ga0500555_064570 | 3300053103 | Bacteria | 977 |
| 254 | Ga0500569_019983 | 3300053109 | Bacteria | 1750 |
| 255 | Ga0500633_0040358 | 3300053160 | Bacteria | 1565 |
| 256 | Ga0500645_000783 | 3300053730 | Bacteria | 19196 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046471 | Ga0495650_0093347 | Ga0495650_0093347_195_1091 | 232 |
| 2 | 3300046491 | Ga0495584_0009480 | Ga0495584_0009480_1852_2748 | 232 |
| 3 | 3300046492 | Ga0495585_0003791 | Ga0495585_0003791_5347_6243 | 232 |
| 4 | 3300046507 | Ga0495606_0001939 | Ga0495606_0001939_13559_14455 | 232 |
| 5 | 3300046519 | Ga0495632_0142448 | Ga0495632_0142448_197_1093 | 232 |
| 6 | 3300046691 | Ga0495670_0001413 | Ga0495670_0001413_10791_11687 | 232 |
| 7 | 3300047323 | Ga0495683_0012228 | Ga0495683_0012228_2896_3792 | 232 |
| 8 | 3300047472 | Ga0495686_0075136 | Ga0495686_0075136_309_1205 | 232 |
| 9 | 3300048924 | Ga0496121_0001054 | Ga0496121_0001054_33995_34891 | 232 |
| 10 | 3300046513 | Ga0495616_0000001 | Ga0495616_0000001_652883_653764 | 240 |
| 11 | 3300042131 | Ga0450894_008806 | Ga0450894_008806_526_1296 | 244 |
| 12 | 3300014497 | Ga0182008_10067144 | Ga0182008_100671442 | 245 |
| 13 | 3300046460 | Ga0495638_0000044 | Ga0495638_0000044_211316_212200 | 247 |
| 14 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_1409955_1410839 | 247 |
| 15 | 3300046660 | Ga0495625_0000001 | Ga0495625_0000001_505198_506082 | 247 |
| 16 | 3300046794 | Ga0495589_0000016 | Ga0495589_0000016_129285_130169 | 247 |
| 17 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_176116_177000 | 247 |
| 18 | 3300047469 | Ga0495673_0003952 | Ga0495673_0003952_3112_3996 | 247 |
| 19 | 3300049459 | Ga0495678_002305 | Ga0495678_002305_9423_10307 | 247 |
| 20 | 3300053103 | Ga0500555_064570 | Ga0500555_064570_48_932 | 247 |
| 21 | 3300046501 | Ga0495607_0000030 | Ga0495607_0000030_147088_147966 | 251 |
| 22 | 3300046506 | Ga0495583_0018668 | Ga0495583_0018668_1441_2319 | 251 |
| 23 | 3300046538 | Ga0495609_0006391 | Ga0495609_0006391_103_981 | 251 |
| 24 | 3300046691 | Ga0495670_0000873 | Ga0495670_0000873_12365_13243 | 251 |
| 25 | 3300046692 | Ga0495671_0000766 | Ga0495671_0000766_19038_19916 | 251 |
| 26 | 3300046810 | Ga0495660_0000018 | Ga0495660_0000018_273529_274407 | 251 |
| 27 | 3300053087 | Ga0500643_000002 | Ga0500643_000002_405548_406426 | 251 |
| 28 | 3300047469 | Ga0495673_0000018 | Ga0495673_0000018_42223_43131 | 253 |
| 29 | 3300005327 | Ga0070658_10253505 | Ga0070658_102535051 | 254 |
| 30 | 3300005344 | Ga0070661_100135980 | Ga0070661_1001359802 | 254 |
| 31 | 3300005455 | Ga0070663_100276782 | Ga0070663_1002767821 | 254 |
| 32 | 3300009101 | Ga0105247_10023935 | Ga0105247_100239353 | 254 |
| 33 | 3300013104 | Ga0157370_10281127 | Ga0157370_102811272 | 254 |
| 34 | 3300015261 | Ga0182006_1000005 | Ga0182006_1000005292 | 254 |
| 35 | 3300025909 | Ga0207705_10352569 | Ga0207705_103525691 | 254 |
| 36 | 3300025920 | Ga0207649_10104747 | Ga0207649_101047473 | 254 |
| 37 | 3300026067 | Ga0207678_10412409 | Ga0207678_104124092 | 254 |
| 38 | 3300046616 | Ga0495668_0009629 | Ga0495668_0009629_1324_2202 | 254 |
| 39 | 3300046810 | Ga0495660_0000025 | Ga0495660_0000025_259300_260178 | 254 |
| 40 | 3300047469 | Ga0495673_0000001 | Ga0495673_0000001_500981_501859 | 254 |
| 41 | 3300047472 | Ga0495686_0021501 | Ga0495686_0021501_1278_2165 | 254 |
| 42 | 3300048924 | Ga0496121_0000501 | Ga0496121_0000501_74007_74885 | 254 |
| 43 | 3300046452 | Ga0495617_000016 | Ga0495617_000016_218909_219790 | 255 |
| 44 | 3300046515 | Ga0495620_0000131 | Ga0495620_0000131_26621_27502 | 255 |
| 45 | 3300047472 | Ga0495686_0000037 | Ga0495686_0000037_238928_239809 | 255 |
| 46 | 3300046512 | Ga0495610_0018404 | Ga0495610_0018404_2896_3804 | 256 |
| 47 | 3300046515 | Ga0495620_0017630 | Ga0495620_0017630_2364_3272 | 256 |
| 48 | 3300046518 | Ga0495631_0000107 | Ga0495631_0000107_32189_33097 | 256 |
| 49 | 3300046519 | Ga0495632_0000746 | Ga0495632_0000746_3197_4105 | 256 |
| 50 | 3300046524 | Ga0495648_0202541 | Ga0495648_0202541_74_982 | 256 |
| 51 | 3300046648 | Ga0495611_0000006 | Ga0495611_0000006_12362_13270 | 256 |
| 52 | 3300053160 | Ga0500633_0040358 | Ga0500633_0040358_28_936 | 256 |
| 53 | 3300046507 | Ga0495606_0002200 | Ga0495606_0002200_10348_11184 | 265 |
| 54 | 3300046515 | Ga0495620_0056060 | Ga0495620_0056060_697_1533 | 265 |
| 55 | 3300047469 | Ga0495673_0000030 | Ga0495673_0000030_404884_405720 | 268 |
| 56 | 3300017792 | Ga0163161_10011764 | Ga0163161_100117643 | 269 |
| 57 | 3300041507 | Ga0451851_0644146 | Ga0451851_0644146_70_879 | 269 |
| 58 | 3300041512 | Ga0451853_0353486 | Ga0451853_0353486_28_837 | 269 |
| 59 | 3300048903 | Ga0496100_0001279 | Ga0496100_0001279_876_1760 | 269 |
| 60 | 3300048920 | Ga0496117_0136773 | Ga0496117_0136773_18_827 | 269 |
| 61 | 3300048925 | Ga0496122_0117911 | Ga0496122_0117911_533_1417 | 269 |
| 62 | 3300039447 | Ga0436361_1109625 | Ga0436361_1109625_3251_4159 | 270 |
| 63 | 3300015265 | Ga0182005_1000004 | Ga0182005_1000004401 | 271 |
| 64 | 3300048091 | Ga0495626_0000004 | Ga0495626_0000004_191464_192282 | 271 |
| 65 | 3300048926 | Ga0496123_0201537 | Ga0496123_0201537_16_888 | 271 |
| 66 | 3300013104 | Ga0157370_10015177 | Ga0157370_100151777 | 272 |
| 67 | 3300013105 | Ga0157369_10016040 | Ga0157369_100160404 | 272 |
| 68 | 3300025904 | Ga0207647_10000306 | Ga0207647_1000030628 | 272 |
| 69 | 3300048928 | Ga0496125_0003182 | Ga0496125_0003182_15049_15921 | 272 |
| 70 | 3300003323 | rootH1_10252467 | rootH1_102524672 | 274 |
| 71 | 3300005262 | Ga0065165_1000001 | Ga0065165_1000001389 | 275 |
| 72 | 3300025303 | Ga0209051_1001881 | Ga0209051_10018819 | 275 |
| 73 | 3300046492 | Ga0495585_0000001 | Ga0495585_0000001_400561_401436 | 275 |
| 74 | 3300046518 | Ga0495631_0003991 | Ga0495631_0003991_238_1113 | 275 |
| 75 | 3300046524 | Ga0495648_0000558 | Ga0495648_0000558_18062_18937 | 275 |
| 76 | 3300046665 | Ga0495661_0000098 | Ga0495661_0000098_51854_52729 | 275 |
| 77 | 3300049460 | Ga0495682_0000108 | Ga0495682_0000108_45331_46206 | 275 |
| 78 | 3300053730 | Ga0500645_000783 | Ga0500645_000783_9713_10588 | 275 |
| 79 | 3300002075 | JGI24738J21930_10000033 | JGI24738J21930_1000003317 | 276 |
| 80 | 3300014497 | Ga0182008_10003187 | Ga0182008_100031873 | 276 |
| 81 | 3300015261 | Ga0182006_1000023 | Ga0182006_100002315 | 276 |
| 82 | 3300015261 | Ga0182006_1002544 | Ga0182006_10025445 | 276 |
| 83 | 3300015265 | Ga0182005_1000154 | Ga0182005_100015429 | 276 |
| 84 | 3300015265 | Ga0182005_1002363 | Ga0182005_10023633 | 276 |
| 85 | 3300031911 | Ga0307412_10001045 | Ga0307412_100010455 | 276 |
| 86 | 3300041404 | Ga0439436_0000002 | Ga0439436_0000002_244604_245482 | 276 |
| 87 | 3300046512 | Ga0495610_0000184 | Ga0495610_0000184_13421_14299 | 276 |
| 88 | 3300046691 | Ga0495670_0001674 | Ga0495670_0001674_6708_7586 | 276 |
| 89 | 3300046694 | Ga0495649_0007824 | Ga0495649_0007824_1025_1903 | 276 |
| 90 | 3300048922 | Ga0496119_0007005 | Ga0496119_0007005_3995_4873 | 276 |
| 91 | 3300048923 | Ga0496120_0028464 | Ga0496120_0028464_2459_3337 | 276 |
| 92 | 3300006946 | Ga0079104_1005923 | Ga0079104_10059236 | 277 |
| 93 | 3300027111 | Ga0209281_1003078 | Ga0209281_10030782 | 277 |
| 94 | 3300049679 | Ga0501249_001560 | Ga0501249_001560_2828_3715 | 277 |
| 95 | 3300049766 | Ga0501269_000266 | Ga0501269_000266_5869_6756 | 277 |
| 96 | 3300046460 | Ga0495638_0033509 | Ga0495638_0033509_1512_2399 | 278 |
| 97 | 3300046460 | Ga0495638_0142391 | Ga0495638_0142391_185_1093 | 278 |
| 98 | 3300046471 | Ga0495650_0011995 | Ga0495650_0011995_2793_3701 | 278 |
| 99 | 3300046660 | Ga0495625_0006505 | Ga0495625_0006505_6527_7414 | 278 |
| 100 | 3300017792 | Ga0163161_10009367 | Ga0163161_100093677 | 279 |
| 101 | 3300030744 | Ga0316181_1058333 | Ga0316181_10583333 | 279 |
| 102 | 3300048925 | Ga0496122_0032555 | Ga0496122_0032555_2084_2923 | 279 |
| 103 | 3300048925 | Ga0496122_0059843 | Ga0496122_0059843_973_1848 | 279 |
| 104 | 3300048916 | Ga0496113_0104269 | Ga0496113_0104269_327_1226 | 280 |
| 105 | 3300010375 | Ga0105239_10143575 | Ga0105239_101435751 | 281 |
| 106 | iso_pu_bacteria | 2738543009 | 2739226658 | 282 |
| 107 | iso_pu_bacteria | 2919404418 | 2919405714 | 282 |
| 108 | iso_pu_bacteria | 2718218334 | 2721027212 | 283 |
| 109 | iso_pu_bacteria | 2941471342 | 2941471411 | 283 |
| 110 | 3300041413 | Ga0439465_0000411 | Ga0439465_0000411_6801_7679 | 284 |
| 111 | 3300042004 | Ga0439445_0018594 | Ga0439445_0018594_109_987 | 284 |
| 112 | iso_pu_bacteria | 2919085039 | 2919085208 | 284 |
| 113 | 3300013104 | Ga0157370_10307281 | Ga0157370_103072812 | 285 |
| 114 | 3300046524 | Ga0495648_0000675 | Ga0495648_0000675_2272_3138 | 285 |
| 115 | iso_pu_bacteria | 2953994433 | 2953996402 | 285 |
| 116 | 3300047320 | Ga0495672_0005795 | Ga0495672_0005795_2284_3189 | 286 |
| 117 | 3300007788 | Ga0099795_10010608 | Ga0099795_100106083 | 287 |
| 118 | 3300009011 | Ga0105251_10000347 | Ga0105251_1000034723 | 287 |
| 119 | 3300009092 | Ga0105250_10000230 | Ga0105250_1000023023 | 287 |
| 120 | 3300010159 | Ga0099796_10001034 | Ga0099796_100010342 | 287 |
| 121 | 3300025711 | Ga0207696_1000011 | Ga0207696_1000011292 | 287 |
| 122 | 3300025735 | Ga0207713_1000193 | Ga0207713_100019358 | 287 |
| 123 | 3300046507 | Ga0495606_0010607 | Ga0495606_0010607_3993_4874 | 287 |
| 124 | 3300046519 | Ga0495632_0000003 | Ga0495632_0000003_149673_150554 | 287 |
| 125 | 3300048909 | Ga0496106_0032811 | Ga0496106_0032811_786_1658 | 287 |
| 126 | 3300048919 | Ga0496116_0046794 | Ga0496116_0046794_786_1658 | 287 |
| 127 | 3300048920 | Ga0496117_0012500 | Ga0496117_0012500_1945_2817 | 287 |
| 128 | 3300048921 | Ga0496118_0002619 | Ga0496118_0002619_7921_8793 | 287 |
| 129 | 3300048924 | Ga0496121_0000044 | Ga0496121_0000044_245623_246495 | 287 |
| 130 | 3300048925 | Ga0496122_0046262 | Ga0496122_0046262_2206_3078 | 287 |
| 131 | 3300048926 | Ga0496123_0024773 | Ga0496123_0024773_3532_4404 | 287 |
| 132 | 3300048929 | Ga0496126_0021064 | Ga0496126_0021064_833_1705 | 287 |
| 133 | iso_pu_bacteria | 2821131069 | 2821131457 | 287 |
| 134 | 3300005330 | Ga0070690_100120449 | Ga0070690_1001204491 | 288 |
| 135 | 3300005842 | Ga0068858_100111233 | Ga0068858_1001112333 | 288 |
| 136 | 3300025927 | Ga0207687_10043942 | Ga0207687_100439422 | 288 |
| 137 | 3300026035 | Ga0207703_10324334 | Ga0207703_103243342 | 288 |
| 138 | 3300048907 | Ga0496104_0000014 | Ga0496104_0000014_148906_149814 | 288 |
| 139 | 3300048926 | Ga0496123_0000022 | Ga0496123_0000022_179388_180263 | 288 |
| 140 | 3300048927 | Ga0496124_0105247 | Ga0496124_0105247_806_1681 | 288 |
| 141 | 3300009036 | Ga0105244_10004031 | Ga0105244_1000403110 | 289 |
| 142 | 3300021361 | Ga0213872_10003251 | Ga0213872_100032516 | 289 |
| 143 | 3300025728 | Ga0207655_1036048 | Ga0207655_10360482 | 289 |
| 144 | 3300039447 | Ga0436361_0980487 | Ga0436361_0980487_1195_2097 | 289 |
| 145 | 3300046463 | Ga0495653_0000409 | Ga0495653_0000409_3870_4763 | 289 |
| 146 | 3300046492 | Ga0495585_0000494 | Ga0495585_0000494_23769_24662 | 289 |
| 147 | 3300046507 | Ga0495606_0000156 | Ga0495606_0000156_91267_92160 | 289 |
| 148 | 3300046512 | Ga0495610_0000003 | Ga0495610_0000003_453373_454266 | 289 |
| 149 | 3300046512 | Ga0495610_0003095 | Ga0495610_0003095_467_1360 | 289 |
| 150 | 3300046524 | Ga0495648_0023407 | Ga0495648_0023407_2757_3650 | 289 |
| 151 | 3300046530 | Ga0495654_0008922 | Ga0495654_0008922_2561_3454 | 289 |
| 152 | 3300046616 | Ga0495668_0000363 | Ga0495668_0000363_47843_48736 | 289 |
| 153 | 3300046692 | Ga0495671_0000001 | Ga0495671_0000001_218282_219175 | 289 |
| 154 | 3300046692 | Ga0495671_0026257 | Ga0495671_0026257_1817_2710 | 289 |
| 155 | 3300046810 | Ga0495660_0038949 | Ga0495660_0038949_663_1556 | 289 |
| 156 | 3300047446 | Ga0495679_011180 | Ga0495679_011180_670_1563 | 289 |
| 157 | 3300047469 | Ga0495673_0000003 | Ga0495673_0000003_1457831_1458724 | 289 |
| 158 | 3300047469 | Ga0495673_0000100 | Ga0495673_0000100_132857_133750 | 289 |
| 159 | 3300048906 | Ga0496103_0011278 | Ga0496103_0011278_73_966 | 289 |
| 160 | 3300048925 | Ga0496122_0019807 | Ga0496122_0019807_4605_5498 | 289 |
| 161 | 3300048926 | Ga0496123_0004114 | Ga0496123_0004114_6421_7443 | 289 |
| 162 | 3300048929 | Ga0496126_0005097 | Ga0496126_0005097_9344_10237 | 289 |
| 163 | iso_pu_bacteria | 2738541297 | 2738829361 | 289 |
| 164 | iso_pu_bacteria | 2738541357 | 2739153157 | 289 |
| 165 | iso_pu_bacteria | 2738543003 | 2739195077 | 289 |
| 166 | iso_pu_bacteria | 2738543026 | 2739321553 | 289 |
| 167 | iso_pu_bacteria | 2738543029 | 2739339891 | 289 |
| 168 | iso_pu_bacteria | 2904424332 | 2904428418 | 289 |
| 169 | iso_pu_bacteria | 8055431914 | 8055433194 | 289 |
| 170 | iso_pu_bacteria | 2919476304 | 2919476364 | 290 |
| 171 | 3300046523 | Ga0495644_0018087 | Ga0495644_0018087_298_1203 | 291 |
| 172 | 3300046538 | Ga0495609_0000484 | Ga0495609_0000484_14704_15609 | 291 |
| 173 | 3300046810 | Ga0495660_0000203 | Ga0495660_0000203_21694_22599 | 291 |
| 174 | 3300046810 | Ga0495660_0000712 | Ga0495660_0000712_6957_7862 | 291 |
| 175 | 3300047470 | Ga0495681_0010927 | Ga0495681_0010927_1095_2000 | 291 |
| 176 | iso_pu_bacteria | 2857553236 | 2857558030 | 291 |
| 177 | 3300007788 | Ga0099795_10127876 | Ga0099795_101278761 | 292 |
| 178 | 3300013100 | Ga0157373_10003621 | Ga0157373_100036216 | 293 |
| 179 | 3300015262 | Ga0182007_10004211 | Ga0182007_1000421110 | 293 |
| 180 | iso_pu_bacteria | 2946006987 | 2946009291 | 293 |
| 181 | 3300005437 | Ga0070710_10041193 | Ga0070710_100411933 | 294 |
| 182 | 3300006028 | Ga0070717_10245740 | Ga0070717_102457401 | 294 |
| 183 | 3300007076 | Ga0075435_100398495 | Ga0075435_1003984951 | 294 |
| 184 | 3300009553 | Ga0105249_10366552 | Ga0105249_103665521 | 294 |
| 185 | 3300017792 | Ga0163161_10064603 | Ga0163161_100646032 | 294 |
| 186 | 3300025939 | Ga0207665_10445870 | Ga0207665_104458701 | 294 |
| 187 | 3300044735 | Ga0466968_0035833 | Ga0466968_0035833_786_1685 | 294 |
| 188 | 3300046664 | Ga0495659_0134456 | Ga0495659_0134456_51_956 | 294 |
| 189 | iso_pu_bacteria | 2597489888 | 2597863472 | 294 |
| 190 | iso_pu_bacteria | 2597489889 | 2597870558 | 294 |
| 191 | iso_pu_bacteria | 2599185167 | 2599399394 | 294 |
| 192 | iso_pu_bacteria | 2599185179 | 2599454190 | 294 |
| 193 | iso_pu_bacteria | 2599185189 | 2599510477 | 294 |
| 194 | iso_pu_bacteria | 2599185190 | 2599513884 | 294 |
| 195 | iso_pu_bacteria | 2599185191 | 2599519065 | 294 |
| 196 | iso_pu_bacteria | 2599185288 | 2599883927 | 294 |
| 197 | iso_pu_bacteria | 2599185290 | 2599892941 | 294 |
| 198 | iso_pu_bacteria | 2599185303 | 2599951151 | 294 |
| 199 | iso_pu_bacteria | 2600255296 | 2601689204 | 294 |
| 200 | iso_pu_bacteria | 2619619299 | 2621299127 | 294 |
| 201 | iso_pu_bacteria | 2643221571 | 2643871724 | 294 |
| 202 | iso_pu_bacteria | 2643221713 | 2644620792 | 294 |
| 203 | iso_pu_bacteria | 2721755607 | 2723248278 | 294 |
| 204 | iso_pu_bacteria | 2738541265 | 2738672284 | 294 |
| 205 | iso_pu_bacteria | 2738541282 | 2738750677 | 294 |
| 206 | iso_pu_bacteria | 2738541294 | 2738812319 | 294 |
| 207 | iso_pu_bacteria | 2738541303 | 2738859718 | 294 |
| 208 | iso_pu_bacteria | 2738541309 | 2738899641 | 294 |
| 209 | iso_pu_bacteria | 2808606385 | 2808980961 | 294 |
| 210 | iso_pu_bacteria | 2808606388 | 2808996522 | 294 |
| 211 | iso_pu_bacteria | 2816332298 | 2817491791 | 294 |
| 212 | iso_pu_bacteria | 2834028612 | 2834030374 | 294 |
| 213 | iso_pu_bacteria | 2842826826 | 2842830457 | 294 |
| 214 | iso_pu_bacteria | 2842837860 | 2842842015 | 294 |
| 215 | iso_pu_bacteria | 2852612431 | 2852617308 | 294 |
| 216 | iso_pu_bacteria | 2852667396 | 2852672573 | 294 |
| 217 | iso_pu_bacteria | 2860867994 | 2860870174 | 294 |
| 218 | iso_pu_bacteria | 2929189879 | 2929192088 | 294 |
| 219 | iso_pu_bacteria | 2931390751 | 2931393205 | 294 |
| 220 | iso_pu_bacteria | 2945928738 | 2945933978 | 294 |
| 221 | iso_pu_bacteria | 2946027586 | 2946030407 | 294 |
| 222 | iso_pu_bacteria | 2947233263 | 2947237303 | 294 |
| 223 | iso_pu_bacteria | 8054285046 | 8054287877 | 294 |
| 224 | iso_pu_bacteria | 8054347763 | 8054351558 | 294 |
| 225 | iso_pu_bacteria | 8055817908 | 8055821716 | 294 |
| 226 | iso_pu_bacteria | 8056131705 | 8056134276 | 294 |
| 227 | iso_pu_bacteria | 8056148874 | 8056154162 | 294 |
| 228 | iso_pu_bacteria | 8056161164 | 8056166614 | 294 |
| 229 | 3300005467 | Ga0070706_100213862 | Ga0070706_1002138622 | 295 |
| 230 | 3300006194 | Ga0075427_10001901 | Ga0075427_100019012 | 295 |
| 231 | 3300025939 | Ga0207665_10067775 | Ga0207665_100677752 | 295 |
| 232 | 3300046506 | Ga0495583_0005907 | Ga0495583_0005907_4865_5782 | 295 |
| 233 | 3300050507 | nmdc:mga05p37_446828_c1 | nmdc:mga05p37_446828_c1_203_1129 | 295 |
| 234 | 3300050508 | nmdc:mga09592_41130_c1 | nmdc:mga09592_41130_c1_462_1388 | 295 |
| 235 | 3300050510 | nmdc:mga06r32_60554_c1 | nmdc:mga06r32_60554_c1_229_1155 | 295 |
| 236 | 3300053109 | Ga0500569_019983 | Ga0500569_019983_354_1286 | 295 |
| 237 | 3300025981 | Ga0207640_10366263 | Ga0207640_103662631 | 297 |
| 238 | 3300046507 | Ga0495606_0008227 | Ga0495606_0008227_6214_7107 | 297 |
| 239 | 2162886007 | SwRhRL2b_contig_1090316 | SwRhRL2b_0275.00000800 | 298 |
| 240 | 3300003751 | Ga0055538_1000140 | Ga0055538_100014014 | 298 |
| 241 | 3300003752 | Ga0055539_1000191 | Ga0055539_100019114 | 298 |
| 242 | 3300003756 | Ga0055533_1000191 | Ga0055533_100019114 | 298 |
| 243 | 3300003758 | Ga0055532_1000194 | Ga0055532_100019414 | 298 |
| 244 | 3300003759 | Ga0055525_1000258 | Ga0055525_100025814 | 298 |
| 245 | 3300003841 | Ga0055541_1000126 | Ga0055541_100012627 | 298 |
| 246 | 3300005331 | Ga0070670_100000170 | Ga0070670_10000017019 | 298 |
| 247 | 3300005331 | Ga0070670_100026041 | Ga0070670_1000260414 | 298 |
| 248 | 3300005344 | Ga0070661_100000831 | Ga0070661_10000083122 | 298 |
| 249 | 3300005353 | Ga0070669_100003061 | Ga0070669_1000030613 | 298 |
| 250 | 3300005564 | Ga0070664_100000996 | Ga0070664_1000009963 | 298 |
| 251 | 3300005834 | Ga0068851_10000188 | Ga0068851_100001889 | 298 |
| 252 | 3300006051 | Ga0075364_10064275 | Ga0075364_100642752 | 298 |
| 253 | 3300009011 | Ga0105251_10005571 | Ga0105251_100055716 | 298 |
| 254 | 3300009011 | Ga0105251_10020142 | Ga0105251_100201423 | 298 |
| 255 | 3300009011 | Ga0105251_10023454 | Ga0105251_100234542 | 298 |
| 256 | 3300009036 | Ga0105244_10005455 | Ga0105244_100054552 | 298 |
| 257 | 3300009092 | Ga0105250_10000436 | Ga0105250_100004363 | 298 |
| 258 | 3300009092 | Ga0105250_10025542 | Ga0105250_100255422 | 298 |
| 259 | 3300009177 | Ga0105248_10119042 | Ga0105248_101190423 | 298 |
| 260 | 3300009545 | Ga0105237_10012458 | Ga0105237_100124582 | 298 |
| 261 | 3300013100 | Ga0157373_10018177 | Ga0157373_100181776 | 298 |
| 262 | 3300013100 | Ga0157373_10024165 | Ga0157373_100241652 | 298 |
| 263 | 3300013102 | Ga0157371_10147832 | Ga0157371_101478322 | 298 |
| 264 | 3300013104 | Ga0157370_10033749 | Ga0157370_100337492 | 298 |
| 265 | 3300013105 | Ga0157369_10019343 | Ga0157369_100193431 | 298 |
| 266 | 3300013306 | Ga0163162_10104311 | Ga0163162_101043113 | 298 |
| 267 | 3300013308 | Ga0157375_10009958 | Ga0157375_100099582 | 298 |
| 268 | 3300014497 | Ga0182008_10000243 | Ga0182008_1000024338 | 298 |
| 269 | 3300014497 | Ga0182008_10000445 | Ga0182008_1000044522 | 298 |
| 270 | 3300015261 | Ga0182006_1002929 | Ga0182006_10029296 | 298 |
| 271 | 3300021361 | Ga0213872_10002763 | Ga0213872_100027633 | 298 |
| 272 | 3300025224 | Ga0209784_100161 | Ga0209784_10016124 | 298 |
| 273 | 3300025225 | Ga0209566_100213 | Ga0209566_10021324 | 298 |
| 274 | 3300025226 | Ga0209674_100208 | Ga0209674_10020824 | 298 |
| 275 | 3300025229 | Ga0209147_100249 | Ga0209147_10024927 | 298 |
| 276 | 3300025230 | Ga0209563_100159 | Ga0209563_10015924 | 298 |
| 277 | 3300025242 | Ga0209258_100438 | Ga0209258_10043814 | 298 |
| 278 | 3300025246 | Ga0209646_1000676 | Ga0209646_10006763 | 298 |
| 279 | 3300025253 | Ga0209677_100163 | Ga0209677_10016324 | 298 |
| 280 | 3300025321 | Ga0207656_10003038 | Ga0207656_100030385 | 298 |
| 281 | 3300025711 | Ga0207696_1000297 | Ga0207696_100029731 | 298 |
| 282 | 3300025728 | Ga0207655_1003063 | Ga0207655_10030636 | 298 |
| 283 | 3300025735 | Ga0207713_1002416 | Ga0207713_10024166 | 298 |
| 284 | 3300025914 | Ga0207671_10008342 | Ga0207671_100083422 | 298 |
| 285 | 3300025920 | Ga0207649_10000088 | Ga0207649_100000883 | 298 |
| 286 | 3300025923 | Ga0207681_10001801 | Ga0207681_100018018 | 298 |
| 287 | 3300025925 | Ga0207650_10000077 | Ga0207650_1000007755 | 298 |
| 288 | 3300025925 | Ga0207650_10000357 | Ga0207650_1000035721 | 298 |
| 289 | 3300025934 | Ga0207686_10003595 | Ga0207686_100035957 | 298 |
| 290 | 3300025945 | Ga0207679_10000034 | Ga0207679_10000034129 | 298 |
| 291 | 3300031731 | Ga0307405_10000340 | Ga0307405_1000034018 | 298 |
| 292 | 3300042006 | Ga0439432_000028 | Ga0439432_000028_17065_17967 | 298 |
| 293 | 3300046453 | Ga0495627_000371 | Ga0495627_000371_9793_10689 | 298 |
| 294 | 3300046458 | Ga0495591_000358 | Ga0495591_000358_26777_27673 | 298 |
| 295 | 3300046474 | Ga0495605_0000006 | Ga0495605_0000006_27348_28247 | 298 |
| 296 | 3300046515 | Ga0495620_0060878 | Ga0495620_0060878_342_1244 | 298 |
| 297 | 3300046519 | Ga0495632_0000794 | Ga0495632_0000794_410_1306 | 298 |
| 298 | 3300046665 | Ga0495661_0000376 | Ga0495661_0000376_26788_27684 | 298 |
| 299 | 3300046810 | Ga0495660_0001687 | Ga0495660_0001687_447_1343 | 298 |
| 300 | 3300047469 | Ga0495673_0099305 | Ga0495673_0099305_179_1075 | 298 |
| 301 | 3300047470 | Ga0495681_0067179 | Ga0495681_0067179_94_990 | 298 |
| 302 | 3300048920 | Ga0496117_0000790 | Ga0496117_0000790_12328_13224 | 298 |
| 303 | 3300048921 | Ga0496118_0024837 | Ga0496118_0024837_1326_2222 | 298 |
| 304 | 3300048921 | Ga0496118_0060955 | Ga0496118_0060955_1199_2095 | 298 |
| 305 | 3300048922 | Ga0496119_0102956 | Ga0496119_0102956_411_1307 | 298 |
| 306 | 3300048923 | Ga0496120_0007221 | Ga0496120_0007221_1332_2228 | 298 |
| 307 | 3300048927 | Ga0496124_0000944 | Ga0496124_0000944_35547_36449 | 298 |
| 308 | 3300048927 | Ga0496124_0087416 | Ga0496124_0087416_1336_2232 | 298 |
| 309 | 3300048928 | Ga0496125_0005972 | Ga0496125_0005972_12263_13159 | 298 |
| 310 | 3300048928 | Ga0496125_0045582 | Ga0496125_0045582_1185_2081 | 298 |
| 311 | 3300048929 | Ga0496126_0007003 | Ga0496126_0007003_1379_2275 | 298 |
| 312 | 3300048929 | Ga0496126_0096418 | Ga0496126_0096418_833_1729 | 298 |
| 313 | 3300048929 | Ga0496126_0120578 | Ga0496126_0120578_663_1559 | 298 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8aid-assembly2.cif.gz_D | crystal structure of n-terminally truncated pa4183 from p. aeruginosa pao1 | 0.7706 | 33 | 161 |
| 3r6a-assembly1.cif.gz_B | crystal structure of an uncharacterized protein (hypothetical protein mm_3218) from methanosarcina mazei. | 0.745 | 37 | 164 |
| 3fcd-assembly1.cif.gz_A | crystal structure of a putative glyoxalase from an environmental bacteria | 0.7361 | 170 | 296 |
| 3r6a-assembly1.cif.gz_B | crystal structure of an uncharacterized protein (hypothetical protein mm_3218) from methanosarcina mazei. | 0.714 | 37 | 164 |
| 5ow1-assembly1.cif.gz_A | x-ray characterization of striatal-enriched protein tyrosine phosphatase inhibitors | 0.7085 | 127 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.88 | 246 | 298 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8388 | 248 | 295 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8329 | 246 | 291 | 3.30.720.110 |
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.787 | 246 | 298 | 3.30.720.110 |
| 3r6aA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7763 | 37 | 159 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A853QUU6-F1-model_v4 | deleted | 0.995 | 31 | 292 |
|
| AF-A0A2V8Q2P5-F1-model_v4 | Glyoxalase | 0.9913 | 139 | 294 |
|
| AF-A0A853QUU6-F1-model_v4 | deleted | 0.9912 | 31 | 292 |
|
| AF-A0A7J4VVP6-F1-model_v4 | Glyoxalase | 0.9882 | 29 | 298 |
|
| AF-A0A4R8HMC7-F1-model_v4 | Glyoxalase-like domain-containing protein | 0.9846 | 120 | 297 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar