F402380

General Info

Members Datasets Scaffolds Average Seq Length
313 210 256 287

Family's Representative Sequence

Representative Sequence 3300048926|Ga0496123_0004114|Ga0496123_0004114_6421_7443
Length 340
Sequence MEEFYLLLSKVRETYHPDPMAGQIAWHAGYSEMCPLPFSGVFFMTMHSFRSRLIAGALSLAFALPMSAMAAPDVAVGPQYDTTHVYVQNADIDAFVTSFVNTFGGKASPRAVFTVTPTPSKTASQYVQTPVGMLSVFAFQTPIPYGFGEERTGYLVTDIHEATKAAVEAGADVTVEPFDDPIGKDVIIQWAGGVNMQLYWHTKAPSYAPLHSVPDNRVYVSKVSGDKFINQFKQFAHARVLADDKIDGAEIGRAGEQVRRVQMSSGFGKMMVFVSDGKLPFPYGRETTGYQVDDVAATLEKAAANGVKVLVAPVKTSQGNVSAMVEFPGGYISEIHNAAK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
3 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
4 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
5 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
6 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
7 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
8 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
9 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
10 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
11 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
12 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
13 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
14 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
15 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
16 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
17 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
18 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
19 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
20 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
21 2738541297 Duganella sp. GV083 Isolate Unclassified
22 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
23 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
24 2738541357 Duganella sp. GV053 Isolate Unclassified
25 2738543003 Duganella sp. GV066 Isolate Unclassified
26 2738543009 Luteibacter sp. OK325 Isolate Unclassified
27 2738543026 Duganella sp. GV089 Isolate Unclassified
28 2738543029 Duganella sp. GV039 Isolate Unclassified
29 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
30 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
31 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
32 2821131069 Duganella sp. 1224 Isolate Unclassified
33 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
34 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
35 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
36 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
37 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
38 2857553236 Duganella sp. R-74557 Isolate Unclassified
39 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
40 2904424332 Duganella sp. 1411 Isolate Rhizosphere
41 2919085039 Luteibacter sp. 1214 Isolate Unclassified
42 2919404418 Luteibacter sp. 3190 Isolate Unclassified
43 2919476304 Duganella sp. 3397 Isolate Unclassified
44 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
45 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
46 2941471342 Luteibacter sp. 621 Isolate Unclassified
47 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
48 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
49 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
50 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
51 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
52 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
53 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
54 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
55 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
56 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
57 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
58 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
59 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
60 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
61 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
62 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
75 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
126 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
132 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
139 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
140 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
172 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
173 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
195 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
200 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
201 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
202 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
204 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
205 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
206 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
207 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
208 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
209 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
210 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.79
Metatranscriptomes 0
Isolates 18.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.71
Nodule 0.96
Rhizoplane 4.47
Rhizosphere 67.41
Stem 0
Stem Tuber 0
Unclassified 20.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1090316 2162886007 Bacteria 1168
2 JGI24738J21930_10000033 3300002075 Bacteria 26047
3 rootH1_10252467 3300003323 Bacteria 2207
4 Ga0055538_1000140 3300003751 Bacteria 50617
5 Ga0055539_1000191 3300003752 Bacteria 50617
6 Ga0055533_1000191 3300003756 Bacteria 50617
7 Ga0055532_1000194 3300003758 Bacteria 50617
8 Ga0055525_1000258 3300003759 Bacteria 50617
9 Ga0055541_1000126 3300003841 Bacteria 50617
10 Ga0065165_1000001 3300005262 Bacteria 494087
11 Ga0070658_10253505 3300005327 Bacteria 1493
12 Ga0070690_100120449 3300005330 Bacteria 1761
13 Ga0070670_100000170 3300005331 Bacteria 58712
14 Ga0070670_100026041 3300005331 Bacteria 5034
15 Ga0070661_100000831 3300005344 Bacteria 22200
16 Ga0070661_100135980 3300005344 Bacteria 1850
17 Ga0070669_100003061 3300005353 Bacteria 12025
18 Ga0070710_10041193 3300005437 Bacteria 2548
19 Ga0070663_100276782 3300005455 Bacteria 1336
20 Ga0070706_100213862 3300005467 Bacteria 1800
21 Ga0070664_100000996 3300005564 Bacteria 22200
22 Ga0068851_10000188 3300005834 Bacteria 30806
23 Ga0068858_100111233 3300005842 Bacteria 2558
24 Ga0070717_10245740 3300006028 Unclassified 1579
25 Ga0075364_10064275 3300006051 Bacteria 2409
26 Ga0075427_10001901 3300006194 Bacteria 2743
27 Ga0079104_1005923 3300006946 Bacteria 4751
28 Ga0075435_100398495 3300007076 Unclassified 1183
29 Ga0099795_10010608 3300007788 Bacteria 2719
30 Ga0099795_10127876 3300007788 Bacteria 1022
31 Ga0105251_10000347 3300009011 Bacteria 46060
32 Ga0105251_10005571 3300009011 Bacteria 8192
33 Ga0105251_10020142 3300009011 Bacteria 3509
34 Ga0105251_10023454 3300009011 Bacteria 3184
35 Ga0105244_10004031 3300009036 Bacteria 10261
36 Ga0105244_10005455 3300009036 Bacteria 8456
37 Ga0105250_10000230 3300009092 Bacteria 46821
38 Ga0105250_10000436 3300009092 Bacteria 30500
39 Ga0105250_10025542 3300009092 Bacteria 2380
40 Ga0105247_10023935 3300009101 Bacteria 3680
41 Ga0105248_10119042 3300009177 Bacteria 2979
42 Ga0105237_10012458 3300009545 Bacteria 8963
43 Ga0105249_10366552 3300009553 Unclassified 1463
44 Ga0099796_10001034 3300010159 Bacteria 5274
45 Ga0105239_10143575 3300010375 Bacteria 2661
46 Ga0157373_10003621 3300013100 Bacteria 11666
47 Ga0157373_10018177 3300013100 Bacteria 5120
48 Ga0157373_10024165 3300013100 Bacteria 4404
49 Ga0157371_10147832 3300013102 Bacteria 1675
50 Ga0157370_10015177 3300013104 Bacteria 7846
51 Ga0157370_10033749 3300013104 Bacteria 4987
52 Ga0157370_10281127 3300013104 Bacteria 1538
53 Ga0157370_10307281 3300013104 Bacteria 1464
54 Ga0157369_10016040 3300013105 Bacteria 8430
55 Ga0157369_10019343 3300013105 Bacteria 7618
56 Ga0163162_10104311 3300013306 Bacteria 2930
57 Ga0157375_10009958 3300013308 Bacteria 8358
58 Ga0182008_10000243 3300014497 Bacteria 42328
59 Ga0182008_10000445 3300014497 Bacteria 31422
60 Ga0182008_10003187 3300014497 Bacteria 10027
61 Ga0182008_10067144 3300014497 Bacteria 1765
62 Ga0182006_1000005 3300015261 Bacteria 621201
63 Ga0182006_1000023 3300015261 Bacteria 275031
64 Ga0182006_1002544 3300015261 Bacteria 9893
65 Ga0182006_1002929 3300015261 Bacteria 9048
66 Ga0182007_10004211 3300015262 Bacteria 6575
67 Ga0182005_1000004 3300015265 Bacteria 609645
68 Ga0182005_1000154 3300015265 Bacteria 48125
69 Ga0182005_1002363 3300015265 Bacteria 6797
70 Ga0163161_10009367 3300017792 Bacteria 6777
71 Ga0163161_10011764 3300017792 Bacteria 6068
72 Ga0163161_10064603 3300017792 Bacteria 2670
73 Ga0213872_10002763 3300021361 Bacteria 10065
74 Ga0213872_10003251 3300021361 Bacteria 9069
75 Ga0209784_100161 3300025224 Bacteria 58895
76 Ga0209566_100213 3300025225 Bacteria 58895
77 Ga0209674_100208 3300025226 Bacteria 58895
78 Ga0209147_100249 3300025229 Bacteria 51703
79 Ga0209563_100159 3300025230 Bacteria 58895
80 Ga0209258_100438 3300025242 Bacteria 47519
81 Ga0209646_1000676 3300025246 Bacteria 12429
82 Ga0209677_100163 3300025253 Bacteria 58895
83 Ga0209051_1001881 3300025303 Bacteria 16431
84 Ga0207656_10003038 3300025321 Bacteria 5734
85 Ga0207696_1000011 3300025711 Bacteria 530614
86 Ga0207696_1000297 3300025711 Bacteria 57833
87 Ga0207655_1003063 3300025728 Bacteria 12740
88 Ga0207655_1036048 3300025728 Bacteria 2199
89 Ga0207713_1000193 3300025735 Bacteria 85067
90 Ga0207713_1002416 3300025735 Bacteria 13636
91 Ga0207647_10000306 3300025904 Bacteria 40485
92 Ga0207705_10352569 3300025909 Bacteria 1134
93 Ga0207671_10008342 3300025914 Bacteria 8798
94 Ga0207649_10000088 3300025920 Bacteria 77105
95 Ga0207649_10104747 3300025920 Bacteria 1879
96 Ga0207681_10001801 3300025923 Bacteria 13741
97 Ga0207650_10000077 3300025925 Bacteria 132010
98 Ga0207650_10000357 3300025925 Bacteria 44045
99 Ga0207687_10043942 3300025927 Bacteria 3081
100 Ga0207686_10003595 3300025934 Bacteria 8310
101 Ga0207665_10067775 3300025939 Bacteria 2431
102 Ga0207665_10445870 3300025939 Bacteria 992
103 Ga0207679_10000034 3300025945 Bacteria 147162
104 Ga0207640_10366263 3300025981 Bacteria 1163
105 Ga0207703_10324334 3300026035 Bacteria 1411
106 Ga0207678_10412409 3300026067 Bacteria 1170
107 Ga0209281_1003078 3300027111 Bacteria 5848
108 Ga0316181_1058333 3300030744 Bacteria 2170
109 Ga0307405_10000340 3300031731 Bacteria 17412
110 Ga0307412_10001045 3300031911 Bacteria 15821
111 Ga0436361_0980487 3300039447 Bacteria 5289
112 Ga0436361_1109625 3300039447 Bacteria 4256
113 Ga0439436_0000002 3300041404 Bacteria 248787
114 Ga0439465_0000411 3300041413 Bacteria 12484
115 Ga0451851_0644146 3300041507 Bacteria 891
116 Ga0451853_0353486 3300041512 Bacteria 914
117 Ga0439445_0018594 3300042004 Bacteria 1726
118 Ga0439432_000028 3300042006 Bacteria 48652
119 Ga0450894_008806 3300042131 Bacteria 1306
120 Ga0466968_0035833 3300044735 Bacteria 2077
121 Ga0495617_000016 3300046452 Bacteria 253600
122 Ga0495627_000371 3300046453 Bacteria 41727
123 Ga0495591_000358 3300046458 Bacteria 39879
124 Ga0495638_0000044 3300046460 Bacteria 221595
125 Ga0495638_0033509 3300046460 Bacteria 3285
126 Ga0495638_0142391 3300046460 Bacteria 1398
127 Ga0495653_0000409 3300046463 Bacteria 34377
128 Ga0495650_0011995 3300046471 Bacteria 4691
129 Ga0495650_0093347 3300046471 Bacteria 1141
130 Ga0495605_0000006 3300046474 Bacteria 361304
131 Ga0495584_0009480 3300046491 Bacteria 5012
132 Ga0495585_0000001 3300046492 Bacteria 609804
133 Ga0495585_0000494 3300046492 Bacteria 37273
134 Ga0495585_0003791 3300046492 Bacteria 10077
135 Ga0495607_0000030 3300046501 Bacteria 154557
136 Ga0495583_0005907 3300046506 Bacteria 8138
137 Ga0495583_0018668 3300046506 Bacteria 3645
138 Ga0495606_0000156 3300046507 Bacteria 118821
139 Ga0495606_0001939 3300046507 Bacteria 25609
140 Ga0495606_0002200 3300046507 Bacteria 23358
141 Ga0495606_0008227 3300046507 Bacteria 9112
142 Ga0495606_0010607 3300046507 Bacteria 7626
143 Ga0495610_0000003 3300046512 Bacteria 1203910
144 Ga0495610_0000184 3300046512 Bacteria 69871
145 Ga0495610_0003095 3300046512 Bacteria 13274
146 Ga0495610_0018404 3300046512 Bacteria 3948
147 Ga0495616_0000001 3300046513 Bacteria 780061
148 Ga0495620_0000131 3300046515 Bacteria 60856
149 Ga0495620_0017630 3300046515 Bacteria 3552
150 Ga0495620_0056060 3300046515 Bacteria 1659
151 Ga0495620_0060878 3300046515 Bacteria 1572
152 Ga0495631_0000107 3300046518 Bacteria 55048
153 Ga0495631_0003991 3300046518 Bacteria 7956
154 Ga0495632_0000003 3300046519 Bacteria 396071
155 Ga0495632_0000746 3300046519 Bacteria 29315
156 Ga0495632_0000794 3300046519 Bacteria 28049
157 Ga0495632_0142448 3300046519 Bacteria 1111
158 Ga0495644_0018087 3300046523 Bacteria 2691
159 Ga0495648_0000558 3300046524 Bacteria 39821
160 Ga0495648_0000675 3300046524 Bacteria 36444
161 Ga0495648_0023407 3300046524 Bacteria 4230
162 Ga0495648_0202541 3300046524 Bacteria 992
163 Ga0495654_0008922 3300046530 Bacteria 5510
164 Ga0495609_0000484 3300046538 Bacteria 31896
165 Ga0495609_0006391 3300046538 Bacteria 6013
166 Ga0495668_0000363 3300046616 Bacteria 60009
167 Ga0495668_0009629 3300046616 Bacteria 5913
168 Ga0495611_0000001 3300046648 Bacteria 2628469
169 Ga0495611_0000006 3300046648 Bacteria 249842
170 Ga0495625_0000001 3300046660 Bacteria 1641829
171 Ga0495625_0006505 3300046660 Bacteria 10382
172 Ga0495659_0134456 3300046664 Bacteria 983
173 Ga0495661_0000098 3300046665 Bacteria 106670
174 Ga0495661_0000376 3300046665 Bacteria 48234
175 Ga0495670_0000873 3300046691 Bacteria 14607
176 Ga0495670_0001413 3300046691 Bacteria 11781
177 Ga0495670_0001674 3300046691 Bacteria 10884
178 Ga0495671_0000001 3300046692 Bacteria 1169494
179 Ga0495671_0000766 3300046692 Bacteria 23070
180 Ga0495671_0026257 3300046692 Bacteria 3020
181 Ga0495649_0007824 3300046694 Bacteria 6476
182 Ga0495589_0000016 3300046794 Bacteria 209027
183 Ga0495660_0000018 3300046810 Bacteria 317061
184 Ga0495660_0000025 3300046810 Bacteria 260275
185 Ga0495660_0000203 3300046810 Bacteria 62255
186 Ga0495660_0000712 3300046810 Bacteria 25502
187 Ga0495660_0001687 3300046810 Bacteria 14790
188 Ga0495660_0038949 3300046810 Bacteria 2641
189 Ga0495672_0005795 3300047320 Bacteria 9707
190 Ga0495683_0012228 3300047323 Bacteria 4511
191 Ga0495679_000001 3300047446 Bacteria 1607568
192 Ga0495679_011180 3300047446 Bacteria 3480
193 Ga0495673_0000001 3300047469 Bacteria 1630730
194 Ga0495673_0000003 3300047469 Bacteria 1491337
195 Ga0495673_0000018 3300047469 Bacteria 569190
196 Ga0495673_0000030 3300047469 Bacteria 468915
197 Ga0495673_0000100 3300047469 Bacteria 173962
198 Ga0495673_0003952 3300047469 Bacteria 9497
199 Ga0495673_0099305 3300047469 Bacteria 1179
200 Ga0495681_0010927 3300047470 Bacteria 5454
201 Ga0495681_0067179 3300047470 Bacteria 1635
202 Ga0495686_0000037 3300047472 Bacteria 307937
203 Ga0495686_0021501 3300047472 Bacteria 4282
204 Ga0495686_0075136 3300047472 Bacteria 2072
205 Ga0495626_0000004 3300048091 Bacteria 356599
206 Ga0496100_0001279 3300048903 Bacteria 12275
207 Ga0496103_0011278 3300048906 Bacteria 5293
208 Ga0496104_0000014 3300048907 Bacteria 377972
209 Ga0496106_0032811 3300048909 Bacteria 3872
210 Ga0496113_0104269 3300048916 Bacteria 2200
211 Ga0496116_0046794 3300048919 Bacteria 2917
212 Ga0496117_0000790 3300048920 Bacteria 49640
213 Ga0496117_0012500 3300048920 Bacteria 7474
214 Ga0496117_0136773 3300048920 Bacteria 1474
215 Ga0496118_0002619 3300048921 Bacteria 23871
216 Ga0496118_0024837 3300048921 Bacteria 5160
217 Ga0496118_0060955 3300048921 Bacteria 2797
218 Ga0496119_0007005 3300048922 Bacteria 10269
219 Ga0496119_0102956 3300048922 Bacteria 1599
220 Ga0496120_0007221 3300048923 Bacteria 8317
221 Ga0496120_0028464 3300048923 Bacteria 3424
222 Ga0496121_0000044 3300048924 Bacteria 337672
223 Ga0496121_0000501 3300048924 Bacteria 74907
224 Ga0496121_0001054 3300048924 Bacteria 48888
225 Ga0496122_0019807 3300048925 Bacteria 6126
226 Ga0496122_0032555 3300048925 Bacteria 4308
227 Ga0496122_0046262 3300048925 Bacteria 3372
228 Ga0496122_0059843 3300048925 Bacteria 2810
229 Ga0496122_0117911 3300048925 Bacteria 1722
230 Ga0496123_0000022 3300048926 Bacteria 361832
231 Ga0496123_0004114 3300048926 Bacteria 15593
232 Ga0496123_0024773 3300048926 Bacteria 4548
233 Ga0496123_0201537 3300048926 Bacteria 1019
234 Ga0496124_0000944 3300048927 Bacteria 46593
235 Ga0496124_0087416 3300048927 Bacteria 2549
236 Ga0496124_0105247 3300048927 Bacteria 2280
237 Ga0496125_0003182 3300048928 Bacteria 20322
238 Ga0496125_0005972 3300048928 Bacteria 13327
239 Ga0496125_0045582 3300048928 Bacteria 3688
240 Ga0496126_0005097 3300048929 Bacteria 15231
241 Ga0496126_0007003 3300048929 Bacteria 12454
242 Ga0496126_0021064 3300048929 Bacteria 6378
243 Ga0496126_0096418 3300048929 Bacteria 2592
244 Ga0496126_0120578 3300048929 Bacteria 2275
245 Ga0495678_002305 3300049459 Bacteria 13166
246 Ga0495682_0000108 3300049460 Bacteria 73226
247 Ga0501249_001560 3300049679 Bacteria 4693
248 Ga0501269_000266 3300049766 Bacteria 14820
249 nmdc:mga05p37_446828_c1 3300050507 Bacteria 1498
250 nmdc:mga09592_41130_c1 3300050508 Bacteria 3886
251 nmdc:mga06r32_60554_c1 3300050510 Bacteria 3644
252 Ga0500643_000002 3300053087 Bacteria 1277657
253 Ga0500555_064570 3300053103 Bacteria 977
254 Ga0500569_019983 3300053109 Bacteria 1750
255 Ga0500633_0040358 3300053160 Bacteria 1565
256 Ga0500645_000783 3300053730 Bacteria 19196

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0093347 Ga0495650_0093347_195_1091 232
2 3300046491 Ga0495584_0009480 Ga0495584_0009480_1852_2748 232
3 3300046492 Ga0495585_0003791 Ga0495585_0003791_5347_6243 232
4 3300046507 Ga0495606_0001939 Ga0495606_0001939_13559_14455 232
5 3300046519 Ga0495632_0142448 Ga0495632_0142448_197_1093 232
6 3300046691 Ga0495670_0001413 Ga0495670_0001413_10791_11687 232
7 3300047323 Ga0495683_0012228 Ga0495683_0012228_2896_3792 232
8 3300047472 Ga0495686_0075136 Ga0495686_0075136_309_1205 232
9 3300048924 Ga0496121_0001054 Ga0496121_0001054_33995_34891 232
10 3300046513 Ga0495616_0000001 Ga0495616_0000001_652883_653764 240
11 3300042131 Ga0450894_008806 Ga0450894_008806_526_1296 244
12 3300014497 Ga0182008_10067144 Ga0182008_100671442 245
13 3300046460 Ga0495638_0000044 Ga0495638_0000044_211316_212200 247
14 3300046648 Ga0495611_0000001 Ga0495611_0000001_1409955_1410839 247
15 3300046660 Ga0495625_0000001 Ga0495625_0000001_505198_506082 247
16 3300046794 Ga0495589_0000016 Ga0495589_0000016_129285_130169 247
17 3300047446 Ga0495679_000001 Ga0495679_000001_176116_177000 247
18 3300047469 Ga0495673_0003952 Ga0495673_0003952_3112_3996 247
19 3300049459 Ga0495678_002305 Ga0495678_002305_9423_10307 247
20 3300053103 Ga0500555_064570 Ga0500555_064570_48_932 247
21 3300046501 Ga0495607_0000030 Ga0495607_0000030_147088_147966 251
22 3300046506 Ga0495583_0018668 Ga0495583_0018668_1441_2319 251
23 3300046538 Ga0495609_0006391 Ga0495609_0006391_103_981 251
24 3300046691 Ga0495670_0000873 Ga0495670_0000873_12365_13243 251
25 3300046692 Ga0495671_0000766 Ga0495671_0000766_19038_19916 251
26 3300046810 Ga0495660_0000018 Ga0495660_0000018_273529_274407 251
27 3300053087 Ga0500643_000002 Ga0500643_000002_405548_406426 251
28 3300047469 Ga0495673_0000018 Ga0495673_0000018_42223_43131 253
29 3300005327 Ga0070658_10253505 Ga0070658_102535051 254
30 3300005344 Ga0070661_100135980 Ga0070661_1001359802 254
31 3300005455 Ga0070663_100276782 Ga0070663_1002767821 254
32 3300009101 Ga0105247_10023935 Ga0105247_100239353 254
33 3300013104 Ga0157370_10281127 Ga0157370_102811272 254
34 3300015261 Ga0182006_1000005 Ga0182006_1000005292 254
35 3300025909 Ga0207705_10352569 Ga0207705_103525691 254
36 3300025920 Ga0207649_10104747 Ga0207649_101047473 254
37 3300026067 Ga0207678_10412409 Ga0207678_104124092 254
38 3300046616 Ga0495668_0009629 Ga0495668_0009629_1324_2202 254
39 3300046810 Ga0495660_0000025 Ga0495660_0000025_259300_260178 254
40 3300047469 Ga0495673_0000001 Ga0495673_0000001_500981_501859 254
41 3300047472 Ga0495686_0021501 Ga0495686_0021501_1278_2165 254
42 3300048924 Ga0496121_0000501 Ga0496121_0000501_74007_74885 254
43 3300046452 Ga0495617_000016 Ga0495617_000016_218909_219790 255
44 3300046515 Ga0495620_0000131 Ga0495620_0000131_26621_27502 255
45 3300047472 Ga0495686_0000037 Ga0495686_0000037_238928_239809 255
46 3300046512 Ga0495610_0018404 Ga0495610_0018404_2896_3804 256
47 3300046515 Ga0495620_0017630 Ga0495620_0017630_2364_3272 256
48 3300046518 Ga0495631_0000107 Ga0495631_0000107_32189_33097 256
49 3300046519 Ga0495632_0000746 Ga0495632_0000746_3197_4105 256
50 3300046524 Ga0495648_0202541 Ga0495648_0202541_74_982 256
51 3300046648 Ga0495611_0000006 Ga0495611_0000006_12362_13270 256
52 3300053160 Ga0500633_0040358 Ga0500633_0040358_28_936 256
53 3300046507 Ga0495606_0002200 Ga0495606_0002200_10348_11184 265
54 3300046515 Ga0495620_0056060 Ga0495620_0056060_697_1533 265
55 3300047469 Ga0495673_0000030 Ga0495673_0000030_404884_405720 268
56 3300017792 Ga0163161_10011764 Ga0163161_100117643 269
57 3300041507 Ga0451851_0644146 Ga0451851_0644146_70_879 269
58 3300041512 Ga0451853_0353486 Ga0451853_0353486_28_837 269
59 3300048903 Ga0496100_0001279 Ga0496100_0001279_876_1760 269
60 3300048920 Ga0496117_0136773 Ga0496117_0136773_18_827 269
61 3300048925 Ga0496122_0117911 Ga0496122_0117911_533_1417 269
62 3300039447 Ga0436361_1109625 Ga0436361_1109625_3251_4159 270
63 3300015265 Ga0182005_1000004 Ga0182005_1000004401 271
64 3300048091 Ga0495626_0000004 Ga0495626_0000004_191464_192282 271
65 3300048926 Ga0496123_0201537 Ga0496123_0201537_16_888 271
66 3300013104 Ga0157370_10015177 Ga0157370_100151777 272
67 3300013105 Ga0157369_10016040 Ga0157369_100160404 272
68 3300025904 Ga0207647_10000306 Ga0207647_1000030628 272
69 3300048928 Ga0496125_0003182 Ga0496125_0003182_15049_15921 272
70 3300003323 rootH1_10252467 rootH1_102524672 274
71 3300005262 Ga0065165_1000001 Ga0065165_1000001389 275
72 3300025303 Ga0209051_1001881 Ga0209051_10018819 275
73 3300046492 Ga0495585_0000001 Ga0495585_0000001_400561_401436 275
74 3300046518 Ga0495631_0003991 Ga0495631_0003991_238_1113 275
75 3300046524 Ga0495648_0000558 Ga0495648_0000558_18062_18937 275
76 3300046665 Ga0495661_0000098 Ga0495661_0000098_51854_52729 275
77 3300049460 Ga0495682_0000108 Ga0495682_0000108_45331_46206 275
78 3300053730 Ga0500645_000783 Ga0500645_000783_9713_10588 275
79 3300002075 JGI24738J21930_10000033 JGI24738J21930_1000003317 276
80 3300014497 Ga0182008_10003187 Ga0182008_100031873 276
81 3300015261 Ga0182006_1000023 Ga0182006_100002315 276
82 3300015261 Ga0182006_1002544 Ga0182006_10025445 276
83 3300015265 Ga0182005_1000154 Ga0182005_100015429 276
84 3300015265 Ga0182005_1002363 Ga0182005_10023633 276
85 3300031911 Ga0307412_10001045 Ga0307412_100010455 276
86 3300041404 Ga0439436_0000002 Ga0439436_0000002_244604_245482 276
87 3300046512 Ga0495610_0000184 Ga0495610_0000184_13421_14299 276
88 3300046691 Ga0495670_0001674 Ga0495670_0001674_6708_7586 276
89 3300046694 Ga0495649_0007824 Ga0495649_0007824_1025_1903 276
90 3300048922 Ga0496119_0007005 Ga0496119_0007005_3995_4873 276
91 3300048923 Ga0496120_0028464 Ga0496120_0028464_2459_3337 276
92 3300006946 Ga0079104_1005923 Ga0079104_10059236 277
93 3300027111 Ga0209281_1003078 Ga0209281_10030782 277
94 3300049679 Ga0501249_001560 Ga0501249_001560_2828_3715 277
95 3300049766 Ga0501269_000266 Ga0501269_000266_5869_6756 277
96 3300046460 Ga0495638_0033509 Ga0495638_0033509_1512_2399 278
97 3300046460 Ga0495638_0142391 Ga0495638_0142391_185_1093 278
98 3300046471 Ga0495650_0011995 Ga0495650_0011995_2793_3701 278
99 3300046660 Ga0495625_0006505 Ga0495625_0006505_6527_7414 278
100 3300017792 Ga0163161_10009367 Ga0163161_100093677 279
101 3300030744 Ga0316181_1058333 Ga0316181_10583333 279
102 3300048925 Ga0496122_0032555 Ga0496122_0032555_2084_2923 279
103 3300048925 Ga0496122_0059843 Ga0496122_0059843_973_1848 279
104 3300048916 Ga0496113_0104269 Ga0496113_0104269_327_1226 280
105 3300010375 Ga0105239_10143575 Ga0105239_101435751 281
106 iso_pu_bacteria 2738543009 2739226658 282
107 iso_pu_bacteria 2919404418 2919405714 282
108 iso_pu_bacteria 2718218334 2721027212 283
109 iso_pu_bacteria 2941471342 2941471411 283
110 3300041413 Ga0439465_0000411 Ga0439465_0000411_6801_7679 284
111 3300042004 Ga0439445_0018594 Ga0439445_0018594_109_987 284
112 iso_pu_bacteria 2919085039 2919085208 284
113 3300013104 Ga0157370_10307281 Ga0157370_103072812 285
114 3300046524 Ga0495648_0000675 Ga0495648_0000675_2272_3138 285
115 iso_pu_bacteria 2953994433 2953996402 285
116 3300047320 Ga0495672_0005795 Ga0495672_0005795_2284_3189 286
117 3300007788 Ga0099795_10010608 Ga0099795_100106083 287
118 3300009011 Ga0105251_10000347 Ga0105251_1000034723 287
119 3300009092 Ga0105250_10000230 Ga0105250_1000023023 287
120 3300010159 Ga0099796_10001034 Ga0099796_100010342 287
121 3300025711 Ga0207696_1000011 Ga0207696_1000011292 287
122 3300025735 Ga0207713_1000193 Ga0207713_100019358 287
123 3300046507 Ga0495606_0010607 Ga0495606_0010607_3993_4874 287
124 3300046519 Ga0495632_0000003 Ga0495632_0000003_149673_150554 287
125 3300048909 Ga0496106_0032811 Ga0496106_0032811_786_1658 287
126 3300048919 Ga0496116_0046794 Ga0496116_0046794_786_1658 287
127 3300048920 Ga0496117_0012500 Ga0496117_0012500_1945_2817 287
128 3300048921 Ga0496118_0002619 Ga0496118_0002619_7921_8793 287
129 3300048924 Ga0496121_0000044 Ga0496121_0000044_245623_246495 287
130 3300048925 Ga0496122_0046262 Ga0496122_0046262_2206_3078 287
131 3300048926 Ga0496123_0024773 Ga0496123_0024773_3532_4404 287
132 3300048929 Ga0496126_0021064 Ga0496126_0021064_833_1705 287
133 iso_pu_bacteria 2821131069 2821131457 287
134 3300005330 Ga0070690_100120449 Ga0070690_1001204491 288
135 3300005842 Ga0068858_100111233 Ga0068858_1001112333 288
136 3300025927 Ga0207687_10043942 Ga0207687_100439422 288
137 3300026035 Ga0207703_10324334 Ga0207703_103243342 288
138 3300048907 Ga0496104_0000014 Ga0496104_0000014_148906_149814 288
139 3300048926 Ga0496123_0000022 Ga0496123_0000022_179388_180263 288
140 3300048927 Ga0496124_0105247 Ga0496124_0105247_806_1681 288
141 3300009036 Ga0105244_10004031 Ga0105244_1000403110 289
142 3300021361 Ga0213872_10003251 Ga0213872_100032516 289
143 3300025728 Ga0207655_1036048 Ga0207655_10360482 289
144 3300039447 Ga0436361_0980487 Ga0436361_0980487_1195_2097 289
145 3300046463 Ga0495653_0000409 Ga0495653_0000409_3870_4763 289
146 3300046492 Ga0495585_0000494 Ga0495585_0000494_23769_24662 289
147 3300046507 Ga0495606_0000156 Ga0495606_0000156_91267_92160 289
148 3300046512 Ga0495610_0000003 Ga0495610_0000003_453373_454266 289
149 3300046512 Ga0495610_0003095 Ga0495610_0003095_467_1360 289
150 3300046524 Ga0495648_0023407 Ga0495648_0023407_2757_3650 289
151 3300046530 Ga0495654_0008922 Ga0495654_0008922_2561_3454 289
152 3300046616 Ga0495668_0000363 Ga0495668_0000363_47843_48736 289
153 3300046692 Ga0495671_0000001 Ga0495671_0000001_218282_219175 289
154 3300046692 Ga0495671_0026257 Ga0495671_0026257_1817_2710 289
155 3300046810 Ga0495660_0038949 Ga0495660_0038949_663_1556 289
156 3300047446 Ga0495679_011180 Ga0495679_011180_670_1563 289
157 3300047469 Ga0495673_0000003 Ga0495673_0000003_1457831_1458724 289
158 3300047469 Ga0495673_0000100 Ga0495673_0000100_132857_133750 289
159 3300048906 Ga0496103_0011278 Ga0496103_0011278_73_966 289
160 3300048925 Ga0496122_0019807 Ga0496122_0019807_4605_5498 289
161 3300048926 Ga0496123_0004114 Ga0496123_0004114_6421_7443 289
162 3300048929 Ga0496126_0005097 Ga0496126_0005097_9344_10237 289
163 iso_pu_bacteria 2738541297 2738829361 289
164 iso_pu_bacteria 2738541357 2739153157 289
165 iso_pu_bacteria 2738543003 2739195077 289
166 iso_pu_bacteria 2738543026 2739321553 289
167 iso_pu_bacteria 2738543029 2739339891 289
168 iso_pu_bacteria 2904424332 2904428418 289
169 iso_pu_bacteria 8055431914 8055433194 289
170 iso_pu_bacteria 2919476304 2919476364 290
171 3300046523 Ga0495644_0018087 Ga0495644_0018087_298_1203 291
172 3300046538 Ga0495609_0000484 Ga0495609_0000484_14704_15609 291
173 3300046810 Ga0495660_0000203 Ga0495660_0000203_21694_22599 291
174 3300046810 Ga0495660_0000712 Ga0495660_0000712_6957_7862 291
175 3300047470 Ga0495681_0010927 Ga0495681_0010927_1095_2000 291
176 iso_pu_bacteria 2857553236 2857558030 291
177 3300007788 Ga0099795_10127876 Ga0099795_101278761 292
178 3300013100 Ga0157373_10003621 Ga0157373_100036216 293
179 3300015262 Ga0182007_10004211 Ga0182007_1000421110 293
180 iso_pu_bacteria 2946006987 2946009291 293
181 3300005437 Ga0070710_10041193 Ga0070710_100411933 294
182 3300006028 Ga0070717_10245740 Ga0070717_102457401 294
183 3300007076 Ga0075435_100398495 Ga0075435_1003984951 294
184 3300009553 Ga0105249_10366552 Ga0105249_103665521 294
185 3300017792 Ga0163161_10064603 Ga0163161_100646032 294
186 3300025939 Ga0207665_10445870 Ga0207665_104458701 294
187 3300044735 Ga0466968_0035833 Ga0466968_0035833_786_1685 294
188 3300046664 Ga0495659_0134456 Ga0495659_0134456_51_956 294
189 iso_pu_bacteria 2597489888 2597863472 294
190 iso_pu_bacteria 2597489889 2597870558 294
191 iso_pu_bacteria 2599185167 2599399394 294
192 iso_pu_bacteria 2599185179 2599454190 294
193 iso_pu_bacteria 2599185189 2599510477 294
194 iso_pu_bacteria 2599185190 2599513884 294
195 iso_pu_bacteria 2599185191 2599519065 294
196 iso_pu_bacteria 2599185288 2599883927 294
197 iso_pu_bacteria 2599185290 2599892941 294
198 iso_pu_bacteria 2599185303 2599951151 294
199 iso_pu_bacteria 2600255296 2601689204 294
200 iso_pu_bacteria 2619619299 2621299127 294
201 iso_pu_bacteria 2643221571 2643871724 294
202 iso_pu_bacteria 2643221713 2644620792 294
203 iso_pu_bacteria 2721755607 2723248278 294
204 iso_pu_bacteria 2738541265 2738672284 294
205 iso_pu_bacteria 2738541282 2738750677 294
206 iso_pu_bacteria 2738541294 2738812319 294
207 iso_pu_bacteria 2738541303 2738859718 294
208 iso_pu_bacteria 2738541309 2738899641 294
209 iso_pu_bacteria 2808606385 2808980961 294
210 iso_pu_bacteria 2808606388 2808996522 294
211 iso_pu_bacteria 2816332298 2817491791 294
212 iso_pu_bacteria 2834028612 2834030374 294
213 iso_pu_bacteria 2842826826 2842830457 294
214 iso_pu_bacteria 2842837860 2842842015 294
215 iso_pu_bacteria 2852612431 2852617308 294
216 iso_pu_bacteria 2852667396 2852672573 294
217 iso_pu_bacteria 2860867994 2860870174 294
218 iso_pu_bacteria 2929189879 2929192088 294
219 iso_pu_bacteria 2931390751 2931393205 294
220 iso_pu_bacteria 2945928738 2945933978 294
221 iso_pu_bacteria 2946027586 2946030407 294
222 iso_pu_bacteria 2947233263 2947237303 294
223 iso_pu_bacteria 8054285046 8054287877 294
224 iso_pu_bacteria 8054347763 8054351558 294
225 iso_pu_bacteria 8055817908 8055821716 294
226 iso_pu_bacteria 8056131705 8056134276 294
227 iso_pu_bacteria 8056148874 8056154162 294
228 iso_pu_bacteria 8056161164 8056166614 294
229 3300005467 Ga0070706_100213862 Ga0070706_1002138622 295
230 3300006194 Ga0075427_10001901 Ga0075427_100019012 295
231 3300025939 Ga0207665_10067775 Ga0207665_100677752 295
232 3300046506 Ga0495583_0005907 Ga0495583_0005907_4865_5782 295
233 3300050507 nmdc:mga05p37_446828_c1 nmdc:mga05p37_446828_c1_203_1129 295
234 3300050508 nmdc:mga09592_41130_c1 nmdc:mga09592_41130_c1_462_1388 295
235 3300050510 nmdc:mga06r32_60554_c1 nmdc:mga06r32_60554_c1_229_1155 295
236 3300053109 Ga0500569_019983 Ga0500569_019983_354_1286 295
237 3300025981 Ga0207640_10366263 Ga0207640_103662631 297
238 3300046507 Ga0495606_0008227 Ga0495606_0008227_6214_7107 297
239 2162886007 SwRhRL2b_contig_1090316 SwRhRL2b_0275.00000800 298
240 3300003751 Ga0055538_1000140 Ga0055538_100014014 298
241 3300003752 Ga0055539_1000191 Ga0055539_100019114 298
242 3300003756 Ga0055533_1000191 Ga0055533_100019114 298
243 3300003758 Ga0055532_1000194 Ga0055532_100019414 298
244 3300003759 Ga0055525_1000258 Ga0055525_100025814 298
245 3300003841 Ga0055541_1000126 Ga0055541_100012627 298
246 3300005331 Ga0070670_100000170 Ga0070670_10000017019 298
247 3300005331 Ga0070670_100026041 Ga0070670_1000260414 298
248 3300005344 Ga0070661_100000831 Ga0070661_10000083122 298
249 3300005353 Ga0070669_100003061 Ga0070669_1000030613 298
250 3300005564 Ga0070664_100000996 Ga0070664_1000009963 298
251 3300005834 Ga0068851_10000188 Ga0068851_100001889 298
252 3300006051 Ga0075364_10064275 Ga0075364_100642752 298
253 3300009011 Ga0105251_10005571 Ga0105251_100055716 298
254 3300009011 Ga0105251_10020142 Ga0105251_100201423 298
255 3300009011 Ga0105251_10023454 Ga0105251_100234542 298
256 3300009036 Ga0105244_10005455 Ga0105244_100054552 298
257 3300009092 Ga0105250_10000436 Ga0105250_100004363 298
258 3300009092 Ga0105250_10025542 Ga0105250_100255422 298
259 3300009177 Ga0105248_10119042 Ga0105248_101190423 298
260 3300009545 Ga0105237_10012458 Ga0105237_100124582 298
261 3300013100 Ga0157373_10018177 Ga0157373_100181776 298
262 3300013100 Ga0157373_10024165 Ga0157373_100241652 298
263 3300013102 Ga0157371_10147832 Ga0157371_101478322 298
264 3300013104 Ga0157370_10033749 Ga0157370_100337492 298
265 3300013105 Ga0157369_10019343 Ga0157369_100193431 298
266 3300013306 Ga0163162_10104311 Ga0163162_101043113 298
267 3300013308 Ga0157375_10009958 Ga0157375_100099582 298
268 3300014497 Ga0182008_10000243 Ga0182008_1000024338 298
269 3300014497 Ga0182008_10000445 Ga0182008_1000044522 298
270 3300015261 Ga0182006_1002929 Ga0182006_10029296 298
271 3300021361 Ga0213872_10002763 Ga0213872_100027633 298
272 3300025224 Ga0209784_100161 Ga0209784_10016124 298
273 3300025225 Ga0209566_100213 Ga0209566_10021324 298
274 3300025226 Ga0209674_100208 Ga0209674_10020824 298
275 3300025229 Ga0209147_100249 Ga0209147_10024927 298
276 3300025230 Ga0209563_100159 Ga0209563_10015924 298
277 3300025242 Ga0209258_100438 Ga0209258_10043814 298
278 3300025246 Ga0209646_1000676 Ga0209646_10006763 298
279 3300025253 Ga0209677_100163 Ga0209677_10016324 298
280 3300025321 Ga0207656_10003038 Ga0207656_100030385 298
281 3300025711 Ga0207696_1000297 Ga0207696_100029731 298
282 3300025728 Ga0207655_1003063 Ga0207655_10030636 298
283 3300025735 Ga0207713_1002416 Ga0207713_10024166 298
284 3300025914 Ga0207671_10008342 Ga0207671_100083422 298
285 3300025920 Ga0207649_10000088 Ga0207649_100000883 298
286 3300025923 Ga0207681_10001801 Ga0207681_100018018 298
287 3300025925 Ga0207650_10000077 Ga0207650_1000007755 298
288 3300025925 Ga0207650_10000357 Ga0207650_1000035721 298
289 3300025934 Ga0207686_10003595 Ga0207686_100035957 298
290 3300025945 Ga0207679_10000034 Ga0207679_10000034129 298
291 3300031731 Ga0307405_10000340 Ga0307405_1000034018 298
292 3300042006 Ga0439432_000028 Ga0439432_000028_17065_17967 298
293 3300046453 Ga0495627_000371 Ga0495627_000371_9793_10689 298
294 3300046458 Ga0495591_000358 Ga0495591_000358_26777_27673 298
295 3300046474 Ga0495605_0000006 Ga0495605_0000006_27348_28247 298
296 3300046515 Ga0495620_0060878 Ga0495620_0060878_342_1244 298
297 3300046519 Ga0495632_0000794 Ga0495632_0000794_410_1306 298
298 3300046665 Ga0495661_0000376 Ga0495661_0000376_26788_27684 298
299 3300046810 Ga0495660_0001687 Ga0495660_0001687_447_1343 298
300 3300047469 Ga0495673_0099305 Ga0495673_0099305_179_1075 298
301 3300047470 Ga0495681_0067179 Ga0495681_0067179_94_990 298
302 3300048920 Ga0496117_0000790 Ga0496117_0000790_12328_13224 298
303 3300048921 Ga0496118_0024837 Ga0496118_0024837_1326_2222 298
304 3300048921 Ga0496118_0060955 Ga0496118_0060955_1199_2095 298
305 3300048922 Ga0496119_0102956 Ga0496119_0102956_411_1307 298
306 3300048923 Ga0496120_0007221 Ga0496120_0007221_1332_2228 298
307 3300048927 Ga0496124_0000944 Ga0496124_0000944_35547_36449 298
308 3300048927 Ga0496124_0087416 Ga0496124_0087416_1336_2232 298
309 3300048928 Ga0496125_0005972 Ga0496125_0005972_12263_13159 298
310 3300048928 Ga0496125_0045582 Ga0496125_0045582_1185_2081 298
311 3300048929 Ga0496126_0007003 Ga0496126_0007003_1379_2275 298
312 3300048929 Ga0496126_0096418 Ga0496126_0096418_833_1729 298
313 3300048929 Ga0496126_0120578 Ga0496126_0120578_663_1559 298

Structural Annotation

Top 5 Hits

ID Description Score Start End
8aid-assembly2.cif.gz_D crystal structure of n-terminally truncated pa4183 from p. aeruginosa pao1 0.7706 33 161
3r6a-assembly1.cif.gz_B crystal structure of an uncharacterized protein (hypothetical protein mm_3218) from methanosarcina mazei. 0.745 37 164
3fcd-assembly1.cif.gz_A crystal structure of a putative glyoxalase from an environmental bacteria 0.7361 170 296
3r6a-assembly1.cif.gz_B crystal structure of an uncharacterized protein (hypothetical protein mm_3218) from methanosarcina mazei. 0.714 37 164
5ow1-assembly1.cif.gz_A x-ray characterization of striatal-enriched protein tyrosine phosphatase inhibitors 0.7085 127 162
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.88 246 298 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8388 248 295 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8329 246 291 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.787 246 298 3.30.720.110
3r6aA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7763 37 159 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A853QUU6-F1-model_v4 deleted 0.995 31 292
AF-A0A2V8Q2P5-F1-model_v4 Glyoxalase 0.9913 139 294
AF-A0A853QUU6-F1-model_v4 deleted 0.9912 31 292
AF-A0A7J4VVP6-F1-model_v4 Glyoxalase 0.9882 29 298
AF-A0A4R8HMC7-F1-model_v4 Glyoxalase-like domain-containing protein 0.9846 120 297

Feature Viewer

pLDDT pTM Quality
88.28 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map