F402262

General Info

Members Datasets Scaffolds Average Seq Length
313 245 626 339

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0015616|Ga0373926_0015616_689_1762
Length 357
Sequence MVRAAIVGLGRWGRSLVASVQGKSDDIRFVAAHTRTRAAADDFCRDQGIPLVDSYQQILGDVDVDAVVLATPHSLHERQILAAAAAGKHIHVEKPITLDRGSADAAVAAARKAGVVLAVGYCRRFHPSVVELRRRLRDGRLGTVVSMVAQHTTSTGQFIPPDNWRAAPEEAPGGALTAVGVHSLDHMIEFAGRVRDVRCVTARQIPGPCDDTTTVMLHFDSGATGLIFCSVATATNFSFTLYGSKGLAEISKPTLQRLRFVPTSEHAPTGPVTAPPDEVSEHAGFDMLNAELTAFARAISDRKPYPVPIDEVLHGMAVFDAIVRAGQSGQIEPVAGPPQRSQSEHKRGNLEERTWKS

Samples

Sample ID Description Type Environment
1 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.75
Nodule 0
Rhizoplane 9.58
Rhizosphere 84.03
Stem 0
Stem Tuber 0
Unclassified 5.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373926_0015616 3300035083 Bacteria 2589
2 JGI24747J21853_1003309 3300001978 Unclassified 1387
3 JGI24742J22300_10003488 3300002244 Bacteria 2551
4 JGI25153J46596_10010475 3300003215 Bacteria 4189
5 Ga0070683_100012603 3300005329 Bacteria 7351
6 Ga0070690_100018003 3300005330 Bacteria 4260
7 Ga0070670_100003319 3300005331 Bacteria 13314
8 Ga0070670_100024732 3300005331 Bacteria 5166
9 Ga0068869_100012929 3300005334 Bacteria 5531
10 Ga0070666_10068597 3300005335 Bacteria 2410
11 Ga0070680_100154112 3300005336 Bacteria 1930
12 Ga0068868_100000347 3300005338 Bacteria 31431
13 Ga0070689_100067516 3300005340 Bacteria 2788
14 Ga0070687_100163478 3300005343 Bacteria 1318
15 Ga0070692_10023703 3300005345 Bacteria 3010
16 Ga0070668_100141945 3300005347 Unclassified 1936
17 Ga0070669_100029223 3300005353 Bacteria 3973
18 Ga0070671_100021663 3300005355 Bacteria 5249
19 Ga0070674_100011260 3300005356 Bacteria 5439
20 Ga0070674_100163973 3300005356 Bacteria 1689
21 Ga0070673_100046101 3300005364 Bacteria 3384
22 Ga0070688_100028988 3300005365 Bacteria 3310
23 Ga0070659_100149158 3300005366 Bacteria 1907
24 Ga0070714_100130934 3300005435 Bacteria 2242
25 Ga0070714_100264841 3300005435 Bacteria 1592
26 Ga0070713_100022531 3300005436 Bacteria 4869
27 Ga0070713_100290218 3300005436 Unclassified 1503
28 Ga0070701_10002458 3300005438 Bacteria 7151
29 Ga0070711_100028336 3300005439 Bacteria 3685
30 Ga0070711_100067786 3300005439 Bacteria 2505
31 Ga0070705_100061906 3300005440 Bacteria 2226
32 Ga0070662_100099023 3300005457 Bacteria 2203
33 Ga0070681_10216483 3300005458 Bacteria 1831
34 Ga0070681_10485736 3300005458 Bacteria 1148
35 Ga0068867_100008904 3300005459 Bacteria 7083
36 Ga0070685_10005125 3300005466 Bacteria 6641
37 Ga0070699_100007469 3300005518 Bacteria 9509
38 Ga0070699_100136807 3300005518 Bacteria 2161
39 Ga0070679_100009660 3300005530 Bacteria 9125
40 Ga0070679_100079349 3300005530 Bacteria 3272
41 Ga0070686_100044145 3300005544 Bacteria 2799
42 Ga0070696_100152614 3300005546 Bacteria 1697
43 Ga0070665_100024817 3300005548 Bacteria 6040
44 Ga0070664_100026768 3300005564 Bacteria 4788
45 Ga0070664_100316204 3300005564 Bacteria 1414
46 Ga0068857_100200712 3300005577 Unclassified 1818
47 Ga0068856_100396593 3300005614 Unclassified 1400
48 Ga0070702_100000703 3300005615 Bacteria 12618
49 Ga0068859_100086772 3300005617 Bacteria 3177
50 Ga0068864_100000490 3300005618 Bacteria 34225
51 Ga0068870_10001007 3300005840 Bacteria 11132
52 Ga0068863_100003597 3300005841 Bacteria 15298
53 Ga0068858_100011147 3300005842 Bacteria 8498
54 Ga0068860_100015358 3300005843 Bacteria 7481
55 Ga0081455_10017936 3300005937 Bacteria 6762
56 Ga0081455_10046989 3300005937 Bacteria 3741
57 Ga0081455_10056850 3300005937 Bacteria 3319
58 Ga0081455_10059258 3300005937 Bacteria 3234
59 Ga0081538_10006306 3300005981 Bacteria 10473
60 Ga0081538_10014013 3300005981 Bacteria 6307
61 Ga0081538_10066729 3300005981 Bacteria 2014
62 Ga0081540_1000273 3300005983 Bacteria 53925
63 Ga0081539_10011719 3300005985 Bacteria 6879
64 Ga0070717_10195522 3300006028 Bacteria 1769
65 Ga0075365_10056815 3300006038 Bacteria 2602
66 Ga0075365_10083789 3300006038 Unclassified 2163
67 Ga0075365_10093963 3300006038 Bacteria 2046
68 Ga0075365_10131184 3300006038 Unclassified 1734
69 Ga0070715_10028996 3300006163 Bacteria 2226
70 Ga0070712_100037815 3300006175 Unclassified 3293
71 Ga0075367_10048248 3300006178 Unclassified 2507
72 Ga0075366_10001178 3300006195 Bacteria 12963
73 Ga0075366_10033154 3300006195 Bacteria 3042
74 Ga0068871_100018459 3300006358 Bacteria 5301
75 Ga0075428_100021266 3300006844 Bacteria 7184
76 Ga0075428_100235622 3300006844 Bacteria 1975
77 Ga0075428_100311786 3300006844 Bacteria 1691
78 Ga0075430_100000975 3300006846 Bacteria 22553
79 Ga0075431_100017917 3300006847 Bacteria 7203
80 Ga0075433_10393561 3300006852 Bacteria 1223
81 Ga0075434_100023338 3300006871 Bacteria 6026
82 Ga0075434_100171422 3300006871 Bacteria 2190
83 Ga0068865_100041896 3300006881 Bacteria 3118
84 Ga0097620_100086775 3300006931 Bacteria 3177
85 Ga0099794_10033069 3300007265 Bacteria 2430
86 Ga0105240_10012818 3300009093 Bacteria 11550
87 Ga0111539_10108792 3300009094 Bacteria 3253
88 Ga0105245_10022905 3300009098 Bacteria 5480
89 Ga0105247_10003061 3300009101 Bacteria 11070
90 Ga0114129_10035252 3300009147 Bacteria 7069
91 Ga0114129_10050883 3300009147 Bacteria 5817
92 Ga0114129_10183442 3300009147 Bacteria 2846
93 Ga0114129_10199015 3300009147 Bacteria 2715
94 Ga0105243_10150123 3300009148 Unclassified 1998
95 Ga0105242_10136732 3300009176 Bacteria 2122
96 Ga0105248_10013997 3300009177 Bacteria 8825
97 Ga0105237_10382966 3300009545 Unclassified 1411
98 Ga0105238_10089298 3300009551 Bacteria 3069
99 Ga0105249_10088652 3300009553 Bacteria 2890
100 Ga0105239_10156136 3300010375 Bacteria 2548
101 Ga0105239_10312777 3300010375 Bacteria 1770
102 Ga0163162_10234604 3300013306 Bacteria 1965
103 Ga0163162_10367046 3300013306 Unclassified 1573
104 Ga0163163_10007671 3300014325 Bacteria 9532
105 Ga0163163_10023569 3300014325 Bacteria 5843
106 Ga0157377_10030816 3300014745 Bacteria 2909
107 Ga0157376_10085780 3300014969 Bacteria 2713
108 Ga0224572_1001502 3300024225 Bacteria 3475
109 Ga0209758_1000364 3300025297 Bacteria 80651
110 Ga0207426_1025606 3300025302 Bacteria 1984
111 Ga0207642_10031090 3300025899 Bacteria 2232
112 Ga0207688_10025574 3300025901 Bacteria 3243
113 Ga0207647_10029144 3300025904 Bacteria 3575
114 Ga0207685_10015086 3300025905 Bacteria 2439
115 Ga0207643_10000893 3300025908 Bacteria 17914
116 Ga0207684_10145798 3300025910 Bacteria 2036
117 Ga0207707_10181923 3300025912 Bacteria 1835
118 Ga0207695_10361258 3300025913 Bacteria 1339
119 Ga0207671_10054339 3300025914 Bacteria 2967
120 Ga0207693_10064583 3300025915 Bacteria 2867
121 Ga0207663_10217536 3300025916 Bacteria 1388
122 Ga0207660_10045512 3300025917 Bacteria 3091
123 Ga0207657_10102709 3300025919 Bacteria 2371
124 Ga0207652_10059093 3300025921 Bacteria 3305
125 Ga0207646_10149596 3300025922 Bacteria 2105
126 Ga0207681_10025876 3300025923 Bacteria 3780
127 Ga0207650_10002585 3300025925 Bacteria 12522
128 Ga0207650_10061448 3300025925 Bacteria 2805
129 Ga0207659_10003220 3300025926 Bacteria 9762
130 Ga0207687_10038084 3300025927 Bacteria 3284
131 Ga0207700_10061101 3300025928 Bacteria 2857
132 Ga0207664_10223047 3300025929 Bacteria 1636
133 Ga0207690_10189260 3300025932 Bacteria 1555
134 Ga0207690_10311389 3300025932 Bacteria 1235
135 Ga0207706_10018621 3300025933 Bacteria 6247
136 Ga0207686_10017859 3300025934 Bacteria 4005
137 Ga0207709_10006860 3300025935 Bacteria 6376
138 Ga0207670_10004807 3300025936 Bacteria 7335
139 Ga0207669_10001139 3300025937 Bacteria 11356
140 Ga0207669_10110891 3300025937 Bacteria 1838
141 Ga0207665_10005390 3300025939 Bacteria 8541
142 Ga0207691_10000541 3300025940 Bacteria 37850
143 Ga0207711_10013527 3300025941 Bacteria 6775
144 Ga0207689_10010565 3300025942 Bacteria 7948
145 Ga0207712_10006453 3300025961 Bacteria 7394
146 Ga0207658_10008528 3300025986 Bacteria 6971
147 Ga0207677_10000901 3300026023 Bacteria 16657
148 Ga0207678_10008278 3300026067 Bacteria 9161
149 Ga0207708_10005850 3300026075 Bacteria 9099
150 Ga0207702_10133924 3300026078 Bacteria 2233
151 Ga0207641_10002939 3300026088 Bacteria 15412
152 Ga0207648_10003256 3300026089 Bacteria 17079
153 Ga0207674_10045543 3300026116 Bacteria 4511
154 Ga0207675_100006307 3300026118 Bacteria 11253
155 Ga0207683_10009366 3300026121 Bacteria 8341
156 Ga0207698_10009136 3300026142 Bacteria 6301
157 Ga0268266_10121747 3300028379 Bacteria 2322
158 Ga0268265_10101434 3300028380 Bacteria 2325
159 Ga0265332_10050016 3300031238 Bacteria 1797
160 Ga0265327_10033634 3300031251 Bacteria 2854
161 Ga0373923_0020398 3300035111 Bacteria 2575
162 Ga0373923_0079004 3300035111 Bacteria 1425
163 Ga0373936_0060412 3300035113 Bacteria 1546
164 Ga0373945_0002273 3300035116 Bacteria 6013
165 Ga0373956_0070869 3300035119 Bacteria 1590
166 Ga0373943_0001769 3300035170 Bacteria 9776
167 Ga0373946_0002933 3300035171 Bacteria 6047
168 Ga0373955_0000969 3300035172 Bacteria 12182
169 Ga0373955_0200891 3300035172 Bacteria 1187
170 Ga0373935_0004469 3300035692 Bacteria 8211
171 Ga0373935_0007619 3300035692 Bacteria 6485
172 Ga0373927_0029547 3300035695 Bacteria 3573
173 Ga0373933_0001057 3300035724 Bacteria 16621
174 Ga0373937_0065204 3300036401 Bacteria 3352
175 Ga0373937_0137086 3300036401 Bacteria 2288
176 Ga0373937_0264585 3300036401 Bacteria 1622
177 Ga0373925_0089981 3300037068 Bacteria 2345
178 Ga0395898_0153921 3300037466 Bacteria 2200
179 Ga0395905_0044173 3300037471 Bacteria 4181
180 Ga0436364_0113170 3300037853 Bacteria 3564
181 Ga0436364_0908953 3300037853 Bacteria 3016
182 Ga0395901_0307295 3300038443 Bacteria 1643
183 Ga0436361_0837667 3300039447 Bacteria 2109
184 Ga0451577_0258596 3300042876 Bacteria 1576
185 Ga0466963_0036089 3300044694 Bacteria 3223
186 Ga0466964_0033003 3300044706 Bacteria 2060
187 Ga0453684_0370787 3300044712 Bacteria 1609
188 Ga0466957_0259964 3300044842 Bacteria 1156
189 Ga0451576_0267736 3300045051 Bacteria 1786
190 Ga0451576_0982871 3300045051 Bacteria 885
191 Ga0466967_0012666 3300045976 Bacteria 6469
192 Ga0495627_041946 3300046453 Bacteria 1404
193 Ga0495603_0001954 3300046455 Bacteria 12167
194 Ga0495629_0039954 3300046459 Bacteria 3301
195 Ga0495641_0019960 3300046461 Bacteria 3414
196 Ga0495580_0039397 3300046472 Bacteria 3380
197 Ga0495582_0007547 3300046473 Bacteria 6016
198 Ga0495639_0028409 3300046475 Bacteria 2478
199 Ga0495584_0008541 3300046491 Bacteria 5303
200 Ga0495585_0165254 3300046492 Bacteria 1146
201 Ga0495594_0012177 3300046499 Bacteria 4478
202 Ga0495618_0041315 3300046514 Bacteria 2904
203 Ga0495630_0028190 3300046517 Bacteria 4172
204 Ga0495632_0123265 3300046519 Bacteria 1210
205 Ga0495637_0066847 3300046520 Bacteria 1460
206 Ga0495642_0069109 3300046528 Bacteria 1475
207 Ga0495652_0087208 3300046529 Bacteria 2560
208 Ga0495640_0052897 3300046533 Bacteria 2786
209 Ga0495598_0000752 3300046537 Bacteria 6180
210 Ga0495621_0026492 3300046539 Unclassified 1957
211 Ga0495633_0047614 3300046558 Bacteria 2026
212 Ga0495667_0008371 3300046559 Bacteria 7018
213 Ga0495656_0003908 3300046615 Bacteria 5069
214 Ga0495656_0018861 3300046615 Bacteria 2655
215 Ga0495668_0122983 3300046616 Bacteria 1420
216 Ga0495658_0002702 3300046683 Bacteria 8936
217 Ga0495613_0092096 3300046689 Bacteria 2195
218 Ga0495624_0010623 3300046690 Bacteria 6340
219 Ga0495589_0131934 3300046794 Bacteria 1199
220 Ga0495680_0001465 3300047322 Bacteria 25478
221 Ga0495675_0024933 3300047444 Bacteria 3815
222 Ga0495679_022294 3300047446 Unclassified 2170
223 Ga0495684_0067060 3300047471 Bacteria 2729
224 Ga0495593_0060545 3300047673 Bacteria 1982
225 Ga0495614_0019621 3300048089 Bacteria 2926
226 Ga0495615_0026231 3300048090 Bacteria 1359
227 Ga0496100_0002561 3300048903 Bacteria 9261
228 Ga0496101_0001803 3300048904 Bacteria 12890
229 Ga0496101_0219760 3300048904 Bacteria 1474
230 Ga0496102_0002443 3300048905 Bacteria 15846
231 Ga0496102_0114888 3300048905 Bacteria 2512
232 Ga0496103_0001070 3300048906 Bacteria 19125
233 Ga0496104_0001147 3300048907 Bacteria 22680
234 Ga0496104_0004676 3300048907 Bacteria 11913
235 Ga0496105_0000724 3300048908 Bacteria 22375
236 Ga0496105_0018707 3300048908 Bacteria 5577
237 Ga0496105_0061858 3300048908 Bacteria 3089
238 Ga0496106_0003810 3300048909 Bacteria 11238
239 Ga0496107_0039000 3300048910 Bacteria 3407
240 Ga0496107_0117398 3300048910 Bacteria 1959
241 Ga0496108_0000476 3300048911 Bacteria 32131
242 Ga0496108_0005742 3300048911 Bacteria 10049
243 Ga0496109_0001615 3300048912 Bacteria 18832
244 Ga0496109_0003379 3300048912 Bacteria 13352
245 Ga0496110_0001055 3300048913 Bacteria 19438
246 Ga0496110_0025216 3300048913 Bacteria 5078
247 Ga0496110_0089507 3300048913 Bacteria 2751
248 Ga0496111_0000710 3300048914 Bacteria 17662
249 Ga0496112_0001944 3300048915 Bacteria 16322
250 Ga0496113_0003847 3300048916 Bacteria 9083
251 Ga0496113_0039055 3300048916 Bacteria 3492
252 Ga0496113_0244713 3300048916 Bacteria 1431
253 Ga0496114_0125342 3300048917 Bacteria 2213
254 Ga0496115_0054208 3300048918 Bacteria 3219
255 Ga0496115_0062945 3300048918 Bacteria 2993
256 Ga0496115_0102162 3300048918 Bacteria 2351
257 Ga0501032_0197032 3300049569 Bacteria 1315
258 Ga0501033_0110152 3300049570 Bacteria 2004
259 Ga0501036_0000244 3300049572 Bacteria 36661
260 Ga0501037_0002554 3300049573 Bacteria 13160
261 Ga0501038_0000368 3300049574 Bacteria 39009
262 Ga0501039_0001872 3300049575 Bacteria 15555
263 Ga0501040_0000290 3300049576 Bacteria 29326
264 Ga0501041_0002205 3300049577 Bacteria 11003
265 Ga0501042_0001912 3300049578 Bacteria 12522
266 Ga0501046_0001501 3300049580 Bacteria 22294
267 Ga0501047_0057823 3300049581 Bacteria 3749
268 Ga0501048_0000485 3300049582 Bacteria 27770
269 Ga0501072_0000928 3300049588 Bacteria 21567
270 Ga0501074_0003865 3300049590 Bacteria 10668
271 Ga0501075_0002601 3300049591 Bacteria 12056
272 Ga0501076_0436017 3300049592 Bacteria 1078
273 Ga0501077_0007111 3300049593 Bacteria 6900
274 Ga0501077_0025469 3300049593 Bacteria 3758
275 Ga0501079_0016783 3300049741 Bacteria 5591
276 Ga0501081_0000895 3300049743 Bacteria 17656
277 Ga0501081_0122643 3300049743 Bacteria 1852
278 Ga0501035_0012032 3300049822 Bacteria 8005
279 Ga0501044_0041904 3300049823 Bacteria 4766
280 Ga0501045_0000136 3300049824 Bacteria 38497
281 nmdc:mga00v17_45830_c1 3300050491 Bacteria 2643
282 nmdc:mga0yw44_10079_c1 3300050492 Bacteria 4811
283 nmdc:mga0yw44_12045_c1 3300050492 Bacteria 4493
284 nmdc:mga0yw44_91954_c1 3300050492 Unclassified 1919
285 nmdc:mga0k408_1451_c1 3300050493 Bacteria 12813
286 nmdc:mga0k408_74397_c1 3300050493 Bacteria 1985
287 nmdc:mga06z11_113538_c1 3300050494 Bacteria 1503
288 nmdc:mga05p37_10583_c1 3300050507 Bacteria 10940
289 nmdc:mga05p37_26391_c1 3300050507 Bacteria 7064
290 nmdc:mga05p37_9305_c1 3300050507 Bacteria 11620
291 nmdc:mga09592_325217_c1 3300050508 Bacteria 1332
292 nmdc:mga0qj67_90713_c1 3300050509 Bacteria 2455
293 nmdc:mga06r32_334909_c1 3300050510 Bacteria 1498
294 nmdc:mga08y16_130854_c1 3300050511 Bacteria 2609
295 nmdc:mga08y16_154932_c1 3300050511 Bacteria 2381
296 nmdc:mga0n895_163081_c1 3300050512 Bacteria 2260
297 nmdc:mga0n895_49260_c1 3300050512 Bacteria 4126
298 nmdc:mga0n895_534699_c1 3300050512 Bacteria 1179
299 nmdc:mga0a205_123891_c1 3300050515 Bacteria 2484
300 nmdc:mga0a205_402550_c1 3300050515 Unclassified 1232
301 Ga0495601_0003682 3300053077 Bacteria 8816
302 Ga0495655_0013870 3300053083 Unclassified 1677
303 Ga0495595_0000514 3300053084 Bacteria 14736
304 Ga0495595_0044743 3300053084 Bacteria 2034
305 Ga0495619_0108544 3300053085 Bacteria 1894
306 Ga0495619_0180145 3300053085 Bacteria 1462
307 Ga0495619_0195362 3300053085 Unclassified 1401
308 Ga0500593_082050 3300053117 Bacteria 1379
309 Ga0501084_0026815 3300054114 Bacteria 4812
310 Ga0501082_0002798 3300060353 Bacteria 15222
311 Ga0530510_0000301 3300061734 Bacteria 31442
312 Ga0530510_0034314 3300061734 Bacteria 3654
313 Ga0530510_0475634 3300061734 Bacteria 946
314 Ga0373926_0015616
315 JGI24747J21853_1003309
316 JGI24742J22300_10003488
317 JGI25153J46596_10010475
318 Ga0070683_100012603
319 Ga0070690_100018003
320 Ga0070670_100003319
321 Ga0070670_100024732
322 Ga0068869_100012929
323 Ga0070666_10068597
324 Ga0070680_100154112
325 Ga0068868_100000347
326 Ga0070689_100067516
327 Ga0070687_100163478
328 Ga0070692_10023703
329 Ga0070668_100141945
330 Ga0070669_100029223
331 Ga0070671_100021663
332 Ga0070674_100011260
333 Ga0070674_100163973
334 Ga0070673_100046101
335 Ga0070688_100028988
336 Ga0070659_100149158
337 Ga0070714_100130934
338 Ga0070714_100264841
339 Ga0070713_100022531
340 Ga0070713_100290218
341 Ga0070701_10002458
342 Ga0070711_100028336
343 Ga0070711_100067786
344 Ga0070705_100061906
345 Ga0070662_100099023
346 Ga0070681_10216483
347 Ga0070681_10485736
348 Ga0068867_100008904
349 Ga0070685_10005125
350 Ga0070699_100007469
351 Ga0070699_100136807
352 Ga0070679_100009660
353 Ga0070679_100079349
354 Ga0070686_100044145
355 Ga0070696_100152614
356 Ga0070665_100024817
357 Ga0070664_100026768
358 Ga0070664_100316204
359 Ga0068857_100200712
360 Ga0068856_100396593
361 Ga0070702_100000703
362 Ga0068859_100086772
363 Ga0068864_100000490
364 Ga0068870_10001007
365 Ga0068863_100003597
366 Ga0068858_100011147
367 Ga0068860_100015358
368 Ga0081455_10017936
369 Ga0081455_10046989
370 Ga0081455_10056850
371 Ga0081455_10059258
372 Ga0081538_10006306
373 Ga0081538_10014013
374 Ga0081538_10066729
375 Ga0081540_1000273
376 Ga0081539_10011719
377 Ga0070717_10195522
378 Ga0075365_10056815
379 Ga0075365_10083789
380 Ga0075365_10093963
381 Ga0075365_10131184
382 Ga0070715_10028996
383 Ga0070712_100037815
384 Ga0075367_10048248
385 Ga0075366_10001178
386 Ga0075366_10033154
387 Ga0068871_100018459
388 Ga0075428_100021266
389 Ga0075428_100235622
390 Ga0075428_100311786
391 Ga0075430_100000975
392 Ga0075431_100017917
393 Ga0075433_10393561
394 Ga0075434_100023338
395 Ga0075434_100171422
396 Ga0068865_100041896
397 Ga0097620_100086775
398 Ga0099794_10033069
399 Ga0105240_10012818
400 Ga0111539_10108792
401 Ga0105245_10022905
402 Ga0105247_10003061
403 Ga0114129_10035252
404 Ga0114129_10050883
405 Ga0114129_10183442
406 Ga0114129_10199015
407 Ga0105243_10150123
408 Ga0105242_10136732
409 Ga0105248_10013997
410 Ga0105237_10382966
411 Ga0105238_10089298
412 Ga0105249_10088652
413 Ga0105239_10156136
414 Ga0105239_10312777
415 Ga0163162_10234604
416 Ga0163162_10367046
417 Ga0163163_10007671
418 Ga0163163_10023569
419 Ga0157377_10030816
420 Ga0157376_10085780
421 Ga0224572_1001502
422 Ga0209758_1000364
423 Ga0207426_1025606
424 Ga0207642_10031090
425 Ga0207688_10025574
426 Ga0207647_10029144
427 Ga0207685_10015086
428 Ga0207643_10000893
429 Ga0207684_10145798
430 Ga0207707_10181923
431 Ga0207695_10361258
432 Ga0207671_10054339
433 Ga0207693_10064583
434 Ga0207663_10217536
435 Ga0207660_10045512
436 Ga0207657_10102709
437 Ga0207652_10059093
438 Ga0207646_10149596
439 Ga0207681_10025876
440 Ga0207650_10002585
441 Ga0207650_10061448
442 Ga0207659_10003220
443 Ga0207687_10038084
444 Ga0207700_10061101
445 Ga0207664_10223047
446 Ga0207690_10189260
447 Ga0207690_10311389
448 Ga0207706_10018621
449 Ga0207686_10017859
450 Ga0207709_10006860
451 Ga0207670_10004807
452 Ga0207669_10001139
453 Ga0207669_10110891
454 Ga0207665_10005390
455 Ga0207691_10000541
456 Ga0207711_10013527
457 Ga0207689_10010565
458 Ga0207712_10006453
459 Ga0207658_10008528
460 Ga0207677_10000901
461 Ga0207678_10008278
462 Ga0207708_10005850
463 Ga0207702_10133924
464 Ga0207641_10002939
465 Ga0207648_10003256
466 Ga0207674_10045543
467 Ga0207675_100006307
468 Ga0207683_10009366
469 Ga0207698_10009136
470 Ga0268266_10121747
471 Ga0268265_10101434
472 Ga0265332_10050016
473 Ga0265327_10033634
474 Ga0373923_0020398
475 Ga0373923_0079004
476 Ga0373936_0060412
477 Ga0373945_0002273
478 Ga0373956_0070869
479 Ga0373943_0001769
480 Ga0373946_0002933
481 Ga0373955_0000969
482 Ga0373955_0200891
483 Ga0373935_0004469
484 Ga0373935_0007619
485 Ga0373927_0029547
486 Ga0373933_0001057
487 Ga0373937_0065204
488 Ga0373937_0137086
489 Ga0373937_0264585
490 Ga0373925_0089981
491 Ga0395898_0153921
492 Ga0395905_0044173
493 Ga0436364_0113170
494 Ga0436364_0908953
495 Ga0395901_0307295
496 Ga0436361_0837667
497 Ga0451577_0258596
498 Ga0466963_0036089
499 Ga0466964_0033003
500 Ga0453684_0370787
501 Ga0466957_0259964
502 Ga0451576_0267736
503 Ga0451576_0982871
504 Ga0466967_0012666
505 Ga0495627_041946
506 Ga0495603_0001954
507 Ga0495629_0039954
508 Ga0495641_0019960
509 Ga0495580_0039397
510 Ga0495582_0007547
511 Ga0495639_0028409
512 Ga0495584_0008541
513 Ga0495585_0165254
514 Ga0495594_0012177
515 Ga0495618_0041315
516 Ga0495630_0028190
517 Ga0495632_0123265
518 Ga0495637_0066847
519 Ga0495642_0069109
520 Ga0495652_0087208
521 Ga0495640_0052897
522 Ga0495598_0000752
523 Ga0495621_0026492
524 Ga0495633_0047614
525 Ga0495667_0008371
526 Ga0495656_0003908
527 Ga0495656_0018861
528 Ga0495668_0122983
529 Ga0495658_0002702
530 Ga0495613_0092096
531 Ga0495624_0010623
532 Ga0495589_0131934
533 Ga0495680_0001465
534 Ga0495675_0024933
535 Ga0495679_022294
536 Ga0495684_0067060
537 Ga0495593_0060545
538 Ga0495614_0019621
539 Ga0495615_0026231
540 Ga0496100_0002561
541 Ga0496101_0001803
542 Ga0496101_0219760
543 Ga0496102_0002443
544 Ga0496102_0114888
545 Ga0496103_0001070
546 Ga0496104_0001147
547 Ga0496104_0004676
548 Ga0496105_0000724
549 Ga0496105_0018707
550 Ga0496105_0061858
551 Ga0496106_0003810
552 Ga0496107_0039000
553 Ga0496107_0117398
554 Ga0496108_0000476
555 Ga0496108_0005742
556 Ga0496109_0001615
557 Ga0496109_0003379
558 Ga0496110_0001055
559 Ga0496110_0025216
560 Ga0496110_0089507
561 Ga0496111_0000710
562 Ga0496112_0001944
563 Ga0496113_0003847
564 Ga0496113_0039055
565 Ga0496113_0244713
566 Ga0496114_0125342
567 Ga0496115_0054208
568 Ga0496115_0062945
569 Ga0496115_0102162
570 Ga0501032_0197032
571 Ga0501033_0110152
572 Ga0501036_0000244
573 Ga0501037_0002554
574 Ga0501038_0000368
575 Ga0501039_0001872
576 Ga0501040_0000290
577 Ga0501041_0002205
578 Ga0501042_0001912
579 Ga0501046_0001501
580 Ga0501047_0057823
581 Ga0501048_0000485
582 Ga0501072_0000928
583 Ga0501074_0003865
584 Ga0501075_0002601
585 Ga0501076_0436017
586 Ga0501077_0007111
587 Ga0501077_0025469
588 Ga0501079_0016783
589 Ga0501081_0000895
590 Ga0501081_0122643
591 Ga0501035_0012032
592 Ga0501044_0041904
593 Ga0501045_0000136
594 nmdc:mga00v17_45830_c1
595 nmdc:mga0yw44_10079_c1
596 nmdc:mga0yw44_12045_c1
597 nmdc:mga0yw44_91954_c1
598 nmdc:mga0k408_1451_c1
599 nmdc:mga0k408_74397_c1
600 nmdc:mga06z11_113538_c1
601 nmdc:mga05p37_10583_c1
602 nmdc:mga05p37_26391_c1
603 nmdc:mga05p37_9305_c1
604 nmdc:mga09592_325217_c1
605 nmdc:mga0qj67_90713_c1
606 nmdc:mga06r32_334909_c1
607 nmdc:mga08y16_130854_c1
608 nmdc:mga08y16_154932_c1
609 nmdc:mga0n895_163081_c1
610 nmdc:mga0n895_49260_c1
611 nmdc:mga0n895_534699_c1
612 nmdc:mga0a205_123891_c1
613 nmdc:mga0a205_402550_c1
614 Ga0495601_0003682
615 Ga0495655_0013870
616 Ga0495595_0000514
617 Ga0495595_0044743
618 Ga0495619_0108544
619 Ga0495619_0180145
620 Ga0495619_0195362
621 Ga0500593_082050
622 Ga0501084_0026815
623 Ga0501082_0002798
624 Ga0530510_0000301
625 Ga0530510_0034314
626 Ga0530510_0475634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

2

121

0.99

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

129

249

0.97

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

133

335

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3db2-assembly1.cif.gz_C-2 crystal structure of a putative nadph-dependent oxidoreductase (dhaf_2064) from desulfitobacterium hafniense dcb-2 at 1.70 a resolution 0.9052 2 333
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9039 2 327
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.9031 2 327
3db2-assembly2.cif.gz_B crystal structure of a putative nadph-dependent oxidoreductase (dhaf_2064) from desulfitobacterium hafniense dcb-2 at 1.70 a resolution 0.9019 2 333
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9005 2 327
ID Description Score Start End Superfamily
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9525 1 119 3.40.50.720
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9447 1 119 3.40.50.720
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9444 2 119 3.40.50.720
3e18B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9431 2 118 3.40.50.720
af_P39353_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9401 1 126 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X3RDH1-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9639 1 141 GO:0000166
AF-A0A538AFB7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9607 51 141 GO:0000166
GO:0016491
AF-A0A535DBZ8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9569 1 143 GO:0000166
GO:0003824
AF-A0A836SQT7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9547 2 144 GO:0000166
AF-A0A2V8W3V3-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9542 1 141 GO:0000166

Map