F402252

General Info

Members Datasets Scaffolds Average Seq Length
313 194 626 265

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10097587|Ga0307406_100975872
Length 290
Sequence VPGFRAVCSRDREWGTVTRREVYSRAFMSTTIAVLSQKGGTGKTTTVRTLTDVYRRIGLDVLAVDLDPQGNLSDYFDIPADADPTVADVLAGQAKAVDAIHGDVLPANLGLAESELVLSGKMGREMTLKRALREPKRRYDLILIDCPPALGLLTVNAVVAADYALLSTEAQYFSLQGVEQALEIIELAKESLHPDLEWLGVVLNIADLRTIHSREALVQLRERFGEKVFNSVIRSSIRYAESAERGVSIVDFRPELGADYLALAEEVLDRVGLGEESARVAELRAELVPA

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
94 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
98 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 9.58
Rhizosphere 87.86
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10097587 3300031901 Bacteria 1993
2 JGI25407J50210_10000510 3300003373 Bacteria 7811
3 JGI25407J50210_10006679 3300003373 Bacteria 2880
4 JGI25407J50210_10017158 3300003373 Bacteria 1878
5 Ga0070658_10126565 3300005327 Bacteria 2127
6 Ga0070683_100000749 3300005329 Bacteria 23796
7 Ga0070683_100013546 3300005329 Bacteria 7116
8 Ga0070680_100000589 3300005336 Bacteria 25078
9 Ga0070682_100091810 3300005337 Bacteria 1988
10 Ga0070660_100001954 3300005339 Bacteria 14205
11 Ga0070660_100004800 3300005339 Bacteria 9349
12 Ga0070660_100254736 3300005339 Bacteria 1432
13 Ga0070661_100015100 3300005344 Bacteria 5448
14 Ga0070692_10201604 3300005345 Bacteria 1166
15 Ga0070668_100057337 3300005347 Bacteria 3009
16 Ga0070668_100190959 3300005347 Bacteria 1677
17 Ga0070659_100003515 3300005366 Bacteria 11160
18 Ga0070714_100379158 3300005435 Bacteria 1333
19 Ga0070713_100024016 3300005436 Bacteria 4741
20 Ga0070711_100008619 3300005439 Bacteria 6255
21 Ga0070711_100027746 3300005439 Bacteria 3719
22 Ga0070694_100289816 3300005444 Bacteria 1251
23 Ga0070662_100045240 3300005457 Bacteria 3157
24 Ga0070681_10014774 3300005458 Bacteria 7763
25 Ga0070681_10291879 3300005458 Bacteria 1541
26 Ga0068867_100145534 3300005459 Bacteria 1857
27 Ga0070707_100227750 3300005468 Bacteria 1815
28 Ga0070679_100047261 3300005530 Bacteria 4290
29 Ga0070684_100014417 3300005535 Bacteria 6404
30 Ga0070684_100024508 3300005535 Bacteria 5062
31 Ga0070684_100167388 3300005535 Bacteria 1995
32 Ga0068853_100199710 3300005539 Bacteria 1820
33 Ga0070693_100043140 3300005547 Bacteria 2546
34 Ga0070704_100270449 3300005549 Bacteria 1404
35 Ga0068854_100017796 3300005578 Bacteria 4761
36 Ga0068856_100034390 3300005614 Bacteria 4964
37 Ga0068856_100230915 3300005614 Bacteria 1865
38 Ga0068852_100002338 3300005616 Bacteria 13045
39 Ga0068852_100099500 3300005616 Bacteria 2621
40 Ga0081455_10010330 3300005937 Bacteria 9490
41 Ga0081455_10010781 3300005937 Bacteria 9235
42 Ga0081538_10000098 3300005981 Bacteria 84863
43 Ga0081538_10000517 3300005981 Bacteria 43195
44 Ga0081538_10000624 3300005981 Bacteria 39292
45 Ga0081538_10000827 3300005981 Bacteria 33540
46 Ga0081538_10000953 3300005981 Bacteria 31063
47 Ga0081538_10001326 3300005981 Bacteria 25535
48 Ga0081538_10003404 3300005981 Bacteria 15057
49 Ga0081538_10005575 3300005981 Bacteria 11302
50 Ga0081538_10009322 3300005981 Bacteria 8209
51 Ga0081538_10025394 3300005981 Bacteria 4179
52 Ga0081538_10025663 3300005981 Bacteria 4146
53 Ga0081538_10042274 3300005981 Bacteria 2879
54 Ga0081538_10087693 3300005981 Bacteria 1623
55 Ga0081538_10158440 3300005981 Unclassified 1011
56 Ga0081539_10002969 3300005985 Bacteria 22267
57 Ga0081539_10005333 3300005985 Bacteria 13197
58 Ga0081539_10093452 3300005985 Bacteria 1549
59 Ga0070717_10205823 3300006028 Bacteria 1725
60 Ga0075365_10060574 3300006038 Bacteria 2526
61 Ga0075365_10142010 3300006038 Bacteria 1667
62 Ga0070712_100003760 3300006175 Bacteria 9350
63 Ga0075428_100018024 3300006844 Bacteria 7802
64 Ga0075428_100049473 3300006844 Bacteria 4612
65 Ga0075428_100119067 3300006844 Bacteria 2875
66 Ga0075428_100318690 3300006844 Bacteria 1671
67 Ga0075428_100610629 3300006844 Bacteria 1164
68 Ga0075430_100003555 3300006846 Bacteria 13056
69 Ga0075430_100010168 3300006846 Bacteria 7966
70 Ga0075431_100013250 3300006847 Bacteria 8328
71 Ga0075431_100193761 3300006847 Bacteria 2082
72 Ga0075433_10156473 3300006852 Bacteria 2028
73 Ga0075429_100022936 3300006880 Bacteria 5411
74 Ga0075429_100267578 3300006880 Bacteria 1497
75 Ga0105240_10023107 3300009093 Bacteria 8233
76 Ga0111539_10248830 3300009094 Bacteria 2070
77 Ga0111539_10594465 3300009094 Bacteria 1289
78 Ga0105245_10004006 3300009098 Bacteria 13092
79 Ga0105245_10616239 3300009098 Bacteria 1113
80 Ga0114129_10014113 3300009147 Bacteria 11382
81 Ga0114129_10075962 3300009147 Bacteria 4678
82 Ga0114129_10725181 3300009147 Bacteria 1275
83 Ga0114129_11437920 3300009147 Bacteria 849
84 Ga0105243_10288987 3300009148 Bacteria 1480
85 Ga0105237_10053577 3300009545 Bacteria 4046
86 Ga0105238_10154595 3300009551 Bacteria 2269
87 Ga0157371_10238724 3300013102 Bacteria 1307
88 Ga0157371_10270240 3300013102 Bacteria 1227
89 Ga0157370_10003619 3300013104 Bacteria 18081
90 Ga0157369_10001972 3300013105 Bacteria 24756
91 Ga0157369_10133735 3300013105 Bacteria 2627
92 Ga0157369_10681913 3300013105 Bacteria 1059
93 Ga0157372_10011588 3300013307 Bacteria 9383
94 Ga0157372_10470444 3300013307 Bacteria 1465
95 Ga0157380_10057796 3300014326 Bacteria 3090
96 Ga0157376_10025716 3300014969 Bacteria 4639
97 Ga0163161_10258788 3300017792 Bacteria 1359
98 Ga0206356_10560592 3300020070 Bacteria 2012
99 Ga0206354_10088142 3300020081 Bacteria 1278
100 Ga0206353_11121934 3300020082 Bacteria 15638
101 Ga0207692_10015901 3300025898 Bacteria 3320
102 Ga0207692_10028496 3300025898 Bacteria 2642
103 Ga0207688_10003367 3300025901 Bacteria 8728
104 Ga0207643_10265347 3300025908 Bacteria 1061
105 Ga0207705_10074590 3300025909 Bacteria 2463
106 Ga0207707_10012182 3300025912 Bacteria 7476
107 Ga0207707_10230086 3300025912 Bacteria 1613
108 Ga0207695_10062868 3300025913 Bacteria 3829
109 Ga0207671_10041081 3300025914 Bacteria 3423
110 Ga0207693_10010715 3300025915 Bacteria 7440
111 Ga0207663_10064172 3300025916 Bacteria 2342
112 Ga0207660_10001493 3300025917 Bacteria 15750
113 Ga0207660_10553717 3300025917 Bacteria 935
114 Ga0207657_10006347 3300025919 Bacteria 12278
115 Ga0207657_10052831 3300025919 Bacteria 3524
116 Ga0207657_10062073 3300025919 Bacteria 3201
117 Ga0207657_10202209 3300025919 Bacteria 1597
118 Ga0207649_10056282 3300025920 Bacteria 2455
119 Ga0207652_10012226 3300025921 Bacteria 6935
120 Ga0207652_10029201 3300025921 Bacteria 4608
121 Ga0207652_10267373 3300025921 Bacteria 1542
122 Ga0207664_10409424 3300025929 Bacteria 1207
123 Ga0207690_10036959 3300025932 Bacteria 3167
124 Ga0207690_10497425 3300025932 Bacteria 986
125 Ga0207706_10001700 3300025933 Bacteria 21687
126 Ga0207669_10105472 3300025937 Bacteria 1875
127 Ga0207665_10054937 3300025939 Bacteria 2686
128 Ga0207661_10005281 3300025944 Bacteria 9092
129 Ga0207661_10038240 3300025944 Bacteria 3759
130 Ga0207661_10309596 3300025944 Bacteria 1418
131 Ga0207712_10181723 3300025961 Bacteria 1653
132 Ga0207668_10009830 3300025972 Bacteria 5749
133 Ga0207640_10178741 3300025981 Bacteria 1589
134 Ga0207708_10029277 3300026075 Bacteria 4173
135 Ga0207674_10058054 3300026116 Bacteria 3922
136 Ga0207674_10611921 3300026116 Bacteria 1052
137 Ga0207675_100090959 3300026118 Bacteria 2869
138 Ga0207675_100148649 3300026118 Bacteria 2229
139 Ga0207698_10101453 3300026142 Bacteria 2386
140 Ga0207698_10723554 3300026142 Bacteria 992
141 Ga0207428_10018595 3300027907 Bacteria 5932
142 Ga0268266_10004424 3300028379 Bacteria 13457
143 Ga0307408_100170555 3300031548 Bacteria 1737
144 Ga0307408_100226901 3300031548 Bacteria 1527
145 Ga0307405_10034810 3300031731 Bacteria 3001
146 Ga0307405_10097389 3300031731 Bacteria 1964
147 Ga0307410_10019736 3300031852 Bacteria 4107
148 Ga0307406_10059706 3300031901 Bacteria 2456
149 Ga0307407_10396735 3300031903 Bacteria 989
150 Ga0307409_100010968 3300031995 Bacteria 5677
151 Ga0307409_100037357 3300031995 Bacteria 3580
152 Ga0307409_100137815 3300031995 Bacteria 2097
153 Ga0307409_100757157 3300031995 Bacteria 975
154 Ga0307416_100004077 3300032002 Bacteria 8734
155 Ga0307416_100006776 3300032002 Bacteria 7203
156 Ga0307416_100043995 3300032002 Bacteria 3502
157 Ga0307416_100208637 3300032002 Bacteria 1861
158 Ga0307416_100531959 3300032002 Bacteria 1246
159 Ga0307414_10004031 3300032004 Bacteria 7928
160 Ga0307411_10028838 3300032005 Bacteria 3380
161 Ga0307415_100005821 3300032126 Bacteria 6588
162 Ga0307415_100007543 3300032126 Bacteria 5956
163 Ga0307415_100323642 3300032126 Bacteria 1287
164 Ga0307415_100445451 3300032126 Bacteria 1118
165 Ga0373938_0029670 3300034957 Bacteria 1163
166 Ga0373944_0052536 3300035089 Bacteria 1288
167 Ga0373941_0135298 3300035115 Bacteria 891
168 Ga0373954_0032214 3300035118 Bacteria 2423
169 Ga0373957_0025662 3300035120 Bacteria 2126
170 Ga0373960_0034003 3300035121 Bacteria 1440
171 Ga0373931_0073284 3300035691 Bacteria 1874
172 Ga0373927_0120938 3300035695 Bacteria 1709
173 Ga0373937_0006516 3300036401 Bacteria 10078
174 Ga0373925_0187474 3300037068 Bacteria 1640
175 Ga0395900_0073567 3300037418 Bacteria 3514
176 Ga0395898_0074432 3300037466 Bacteria 3280
177 Ga0395898_0113092 3300037466 Bacteria 2602
178 Ga0436364_1039016 3300037853 Bacteria 1076
179 Ga0436364_1142787 3300037853 Bacteria 6981
180 Ga0395901_0013346 3300038443 Bacteria 8347
181 Ga0395901_0040852 3300038443 Bacteria 4805
182 Ga0395901_0140427 3300038443 Bacteria 2539
183 Ga0395901_0230472 3300038443 Bacteria 1934
184 Ga0436365_1566637 3300039437 Bacteria 7320
185 Ga0436365_1705079 3300039437 Bacteria 5435
186 Ga0436362_1020308 3300039453 Bacteria 3528
187 Ga0451833_1415542 3300041491 Bacteria 1183
188 Ga0451853_1087449 3300041512 Bacteria 1080
189 Ga0439448_0020330 3300042005 Bacteria 2053
190 Ga0466969_0139511 3300044656 Bacteria 1120
191 Ga0466961_0046761 3300044693 Bacteria 2767
192 Ga0466961_0276323 3300044693 Bacteria 1028
193 Ga0466963_0142213 3300044694 Bacteria 1663
194 Ga0466964_0070485 3300044706 Bacteria 1477
195 Ga0466971_0010365 3300044719 Bacteria 4072
196 Ga0466968_0039588 3300044735 Bacteria 1985
197 Ga0466957_0087817 3300044842 Bacteria 1945
198 Ga0466957_0408254 3300044842 Bacteria 930
199 Ga0466960_0174728 3300044901 Bacteria 1161
200 Ga0466960_0183832 3300044901 Bacteria 1134
201 Ga0466959_0014530 3300045049 Bacteria 5726
202 Ga0466958_0119484 3300045836 Bacteria 1649
203 Ga0466958_0235082 3300045836 Bacteria 1171
204 Ga0466967_0125939 3300045976 Bacteria 2373
205 Ga0466967_0361688 3300045976 Bacteria 1406
206 Ga0466967_0600579 3300045976 Bacteria 1086
207 Ga0495592_0070591 3300046454 Bacteria 2544
208 Ga0495641_0024028 3300046461 Bacteria 3015
209 Ga0495651_0006035 3300046462 Bacteria 9249
210 Ga0495653_0014641 3300046463 Bacteria 6399
211 Ga0495584_0075587 3300046491 Bacteria 1694
212 Ga0495584_0200630 3300046491 Bacteria 1014
213 Ga0495585_0109804 3300046492 Bacteria 1468
214 Ga0495596_0025025 3300046500 Bacteria 2415
215 Ga0495608_0005776 3300046511 Bacteria 8813
216 Ga0495616_0144438 3300046513 Bacteria 1081
217 Ga0495618_0030096 3300046514 Bacteria 3389
218 Ga0495652_0174950 3300046529 Bacteria 1653
219 Ga0495652_0226233 3300046529 Bacteria 1402
220 Ga0495640_0014093 3300046533 Bacteria 6061
221 Ga0495587_0043741 3300046536 Bacteria 2666
222 Ga0495597_0180656 3300046542 Bacteria 853
223 Ga0495645_0000071 3300046543 Bacteria 71392
224 Ga0495645_0000183 3300046543 Bacteria 44390
225 Ga0495667_0007367 3300046559 Bacteria 7462
226 Ga0495656_0006425 3300046615 Bacteria 4125
227 Ga0495656_0160041 3300046615 Bacteria 1094
228 Ga0495635_0007467 3300046663 Bacteria 7631
229 Ga0495657_0002620 3300046675 Bacteria 15053
230 Ga0495646_0050035 3300046680 Bacteria 2534
231 Ga0495671_0240384 3300046692 Bacteria 875
232 Ga0495600_0034864 3300046809 Bacteria 3267
233 Ga0495604_0037728 3300047317 Bacteria 3804
234 Ga0495674_0030799 3300047319 Bacteria 4876
235 Ga0495674_0152699 3300047319 Bacteria 1936
236 Ga0495680_0030777 3300047322 Bacteria 4376
237 Ga0495684_0084327 3300047471 Bacteria 2410
238 Ga0495602_0035913 3300048088 Bacteria 4617
239 Ga0496100_0008057 3300048903 Bacteria 5856
240 Ga0496100_0035577 3300048903 Bacteria 3134
241 Ga0496101_0050374 3300048904 Bacteria 2997
242 Ga0496101_0348013 3300048904 Bacteria 1164
243 Ga0496101_0517583 3300048904 Bacteria 943
244 Ga0496102_0252575 3300048905 Bacteria 1663
245 Ga0496104_0016491 3300048907 Bacteria 6712
246 Ga0496104_0082692 3300048907 Bacteria 3062
247 Ga0496105_0061573 3300048908 Bacteria 3097
248 Ga0496105_0139308 3300048908 Bacteria 1997
249 Ga0496105_0308692 3300048908 Bacteria 1270
250 Ga0496106_0124490 3300048909 Bacteria 2017
251 Ga0496106_0270476 3300048909 Bacteria 1360
252 Ga0496106_0495224 3300048909 Bacteria 982
253 Ga0496107_0002379 3300048910 Bacteria 12168
254 Ga0496107_0292376 3300048910 Bacteria 1213
255 Ga0496108_0013995 3300048911 Bacteria 6545
256 Ga0496109_0052228 3300048912 Bacteria 3725
257 Ga0496109_0084226 3300048912 Bacteria 2933
258 Ga0496109_0463984 3300048912 Bacteria 1196
259 Ga0496109_0635248 3300048912 Bacteria 1004
260 Ga0496110_0055124 3300048913 Bacteria 3497
261 Ga0496111_0022016 3300048914 Bacteria 4457
262 Ga0496111_0035821 3300048914 Bacteria 3548
263 Ga0496112_0007418 3300048915 Bacteria 9735
264 Ga0496112_0018506 3300048915 Bacteria 6559
265 Ga0496113_0022203 3300048916 Bacteria 4485
266 Ga0496115_0000306 3300048918 Bacteria 41705
267 Ga0496115_0030884 3300048918 Bacteria 4218
268 Ga0496115_0188317 3300048918 Bacteria 1705
269 Ga0501031_0115225 3300049568 Bacteria 1756
270 Ga0501034_0006344 3300049571 Bacteria 12740
271 Ga0501034_0046943 3300049571 Bacteria 4363
272 Ga0501034_0192018 3300049571 Bacteria 2004
273 Ga0501036_0845518 3300049572 Bacteria 752
274 Ga0501040_0010851 3300049576 Bacteria 5956
275 Ga0501040_0229677 3300049576 Bacteria 1321
276 Ga0501047_0467269 3300049581 Bacteria 1090
277 Ga0501048_0021563 3300049582 Bacteria 4717
278 Ga0501067_0132081 3300049583 Bacteria 1390
279 Ga0501071_0069907 3300049587 Bacteria 2557
280 Ga0501072_0112857 3300049588 Bacteria 2164
281 Ga0501075_0039446 3300049591 Bacteria 3535
282 Ga0501076_0083008 3300049592 Bacteria 2573
283 Ga0501076_0778625 3300049592 Bacteria 789
284 Ga0501249_038296 3300049679 Bacteria 1083
285 Ga0501079_0056962 3300049741 Bacteria 3016
286 Ga0501079_0232280 3300049741 Bacteria 1441
287 Ga0501079_0479727 3300049741 Bacteria 977
288 Ga0501080_0374211 3300049742 Bacteria 1284
289 Ga0501081_0207175 3300049743 Bacteria 1423
290 Ga0501035_0139568 3300049822 Unclassified 2108
291 Ga0501044_0204582 3300049823 Bacteria 1931
292 Ga0501045_0154848 3300049824 Bacteria 1705
293 Ga0501045_0180064 3300049824 Bacteria 1575
294 nmdc:mga05p37_26088_c1 3300050507 Bacteria 7106
295 nmdc:mga05p37_488160_c1 3300050507 Bacteria 1417
296 nmdc:mga09592_38200_c1 3300050508 Bacteria 4029
297 nmdc:mga0qj67_2929_c1 3300050509 Bacteria 12245
298 nmdc:mga0qj67_71324_c1 3300050509 Bacteria 2772
299 nmdc:mga06r32_268108_c1 3300050510 Bacteria 1695
300 nmdc:mga06r32_63590_c1 3300050510 Bacteria 3557
301 nmdc:mga06r32_80835_c1 3300050510 Bacteria 3164
302 nmdc:mga08y16_182314_c1 3300050511 Bacteria 2180
303 nmdc:mga08y16_387702_c1 3300050511 Bacteria 1431
304 nmdc:mga0a205_223296_c1 3300050515 Bacteria 1769
305 Ga0495601_0003679 3300053077 Bacteria 8818
306 Ga0495612_0000059 3300053078 Bacteria 49421
307 Ga0495595_0003402 3300053084 Bacteria 6323
308 Ga0501084_0135552 3300054114 Bacteria 2073
309 Ga0501084_0355700 3300054114 Bacteria 1237
310 Ga0590075_043215 3300059424 Bacteria 1153
311 Ga0466962_0146071 3300061719 Bacteria 1147
312 Ga0530510_0018446 3300061734 Bacteria 4948
313 Ga0530510_0020628 3300061734 Bacteria 4686
314 Ga0307406_10097587
315 JGI25407J50210_10000510
316 JGI25407J50210_10006679
317 JGI25407J50210_10017158
318 Ga0070658_10126565
319 Ga0070683_100000749
320 Ga0070683_100013546
321 Ga0070680_100000589
322 Ga0070682_100091810
323 Ga0070660_100001954
324 Ga0070660_100004800
325 Ga0070660_100254736
326 Ga0070661_100015100
327 Ga0070692_10201604
328 Ga0070668_100057337
329 Ga0070668_100190959
330 Ga0070659_100003515
331 Ga0070714_100379158
332 Ga0070713_100024016
333 Ga0070711_100008619
334 Ga0070711_100027746
335 Ga0070694_100289816
336 Ga0070662_100045240
337 Ga0070681_10014774
338 Ga0070681_10291879
339 Ga0068867_100145534
340 Ga0070707_100227750
341 Ga0070679_100047261
342 Ga0070684_100014417
343 Ga0070684_100024508
344 Ga0070684_100167388
345 Ga0068853_100199710
346 Ga0070693_100043140
347 Ga0070704_100270449
348 Ga0068854_100017796
349 Ga0068856_100034390
350 Ga0068856_100230915
351 Ga0068852_100002338
352 Ga0068852_100099500
353 Ga0081455_10010330
354 Ga0081455_10010781
355 Ga0081538_10000098
356 Ga0081538_10000517
357 Ga0081538_10000624
358 Ga0081538_10000827
359 Ga0081538_10000953
360 Ga0081538_10001326
361 Ga0081538_10003404
362 Ga0081538_10005575
363 Ga0081538_10009322
364 Ga0081538_10025394
365 Ga0081538_10025663
366 Ga0081538_10042274
367 Ga0081538_10087693
368 Ga0081538_10158440
369 Ga0081539_10002969
370 Ga0081539_10005333
371 Ga0081539_10093452
372 Ga0070717_10205823
373 Ga0075365_10060574
374 Ga0075365_10142010
375 Ga0070712_100003760
376 Ga0075428_100018024
377 Ga0075428_100049473
378 Ga0075428_100119067
379 Ga0075428_100318690
380 Ga0075428_100610629
381 Ga0075430_100003555
382 Ga0075430_100010168
383 Ga0075431_100013250
384 Ga0075431_100193761
385 Ga0075433_10156473
386 Ga0075429_100022936
387 Ga0075429_100267578
388 Ga0105240_10023107
389 Ga0111539_10248830
390 Ga0111539_10594465
391 Ga0105245_10004006
392 Ga0105245_10616239
393 Ga0114129_10014113
394 Ga0114129_10075962
395 Ga0114129_10725181
396 Ga0114129_11437920
397 Ga0105243_10288987
398 Ga0105237_10053577
399 Ga0105238_10154595
400 Ga0157371_10238724
401 Ga0157371_10270240
402 Ga0157370_10003619
403 Ga0157369_10001972
404 Ga0157369_10133735
405 Ga0157369_10681913
406 Ga0157372_10011588
407 Ga0157372_10470444
408 Ga0157380_10057796
409 Ga0157376_10025716
410 Ga0163161_10258788
411 Ga0206356_10560592
412 Ga0206354_10088142
413 Ga0206353_11121934
414 Ga0207692_10015901
415 Ga0207692_10028496
416 Ga0207688_10003367
417 Ga0207643_10265347
418 Ga0207705_10074590
419 Ga0207707_10012182
420 Ga0207707_10230086
421 Ga0207695_10062868
422 Ga0207671_10041081
423 Ga0207693_10010715
424 Ga0207663_10064172
425 Ga0207660_10001493
426 Ga0207660_10553717
427 Ga0207657_10006347
428 Ga0207657_10052831
429 Ga0207657_10062073
430 Ga0207657_10202209
431 Ga0207649_10056282
432 Ga0207652_10012226
433 Ga0207652_10029201
434 Ga0207652_10267373
435 Ga0207664_10409424
436 Ga0207690_10036959
437 Ga0207690_10497425
438 Ga0207706_10001700
439 Ga0207669_10105472
440 Ga0207665_10054937
441 Ga0207661_10005281
442 Ga0207661_10038240
443 Ga0207661_10309596
444 Ga0207712_10181723
445 Ga0207668_10009830
446 Ga0207640_10178741
447 Ga0207708_10029277
448 Ga0207674_10058054
449 Ga0207674_10611921
450 Ga0207675_100090959
451 Ga0207675_100148649
452 Ga0207698_10101453
453 Ga0207698_10723554
454 Ga0207428_10018595
455 Ga0268266_10004424
456 Ga0307408_100170555
457 Ga0307408_100226901
458 Ga0307405_10034810
459 Ga0307405_10097389
460 Ga0307410_10019736
461 Ga0307406_10059706
462 Ga0307407_10396735
463 Ga0307409_100010968
464 Ga0307409_100037357
465 Ga0307409_100137815
466 Ga0307409_100757157
467 Ga0307416_100004077
468 Ga0307416_100006776
469 Ga0307416_100043995
470 Ga0307416_100208637
471 Ga0307416_100531959
472 Ga0307414_10004031
473 Ga0307411_10028838
474 Ga0307415_100005821
475 Ga0307415_100007543
476 Ga0307415_100323642
477 Ga0307415_100445451
478 Ga0373938_0029670
479 Ga0373944_0052536
480 Ga0373941_0135298
481 Ga0373954_0032214
482 Ga0373957_0025662
483 Ga0373960_0034003
484 Ga0373931_0073284
485 Ga0373927_0120938
486 Ga0373937_0006516
487 Ga0373925_0187474
488 Ga0395900_0073567
489 Ga0395898_0074432
490 Ga0395898_0113092
491 Ga0436364_1039016
492 Ga0436364_1142787
493 Ga0395901_0013346
494 Ga0395901_0040852
495 Ga0395901_0140427
496 Ga0395901_0230472
497 Ga0436365_1566637
498 Ga0436365_1705079
499 Ga0436362_1020308
500 Ga0451833_1415542
501 Ga0451853_1087449
502 Ga0439448_0020330
503 Ga0466969_0139511
504 Ga0466961_0046761
505 Ga0466961_0276323
506 Ga0466963_0142213
507 Ga0466964_0070485
508 Ga0466971_0010365
509 Ga0466968_0039588
510 Ga0466957_0087817
511 Ga0466957_0408254
512 Ga0466960_0174728
513 Ga0466960_0183832
514 Ga0466959_0014530
515 Ga0466958_0119484
516 Ga0466958_0235082
517 Ga0466967_0125939
518 Ga0466967_0361688
519 Ga0466967_0600579
520 Ga0495592_0070591
521 Ga0495641_0024028
522 Ga0495651_0006035
523 Ga0495653_0014641
524 Ga0495584_0075587
525 Ga0495584_0200630
526 Ga0495585_0109804
527 Ga0495596_0025025
528 Ga0495608_0005776
529 Ga0495616_0144438
530 Ga0495618_0030096
531 Ga0495652_0174950
532 Ga0495652_0226233
533 Ga0495640_0014093
534 Ga0495587_0043741
535 Ga0495597_0180656
536 Ga0495645_0000071
537 Ga0495645_0000183
538 Ga0495667_0007367
539 Ga0495656_0006425
540 Ga0495656_0160041
541 Ga0495635_0007467
542 Ga0495657_0002620
543 Ga0495646_0050035
544 Ga0495671_0240384
545 Ga0495600_0034864
546 Ga0495604_0037728
547 Ga0495674_0030799
548 Ga0495674_0152699
549 Ga0495680_0030777
550 Ga0495684_0084327
551 Ga0495602_0035913
552 Ga0496100_0008057
553 Ga0496100_0035577
554 Ga0496101_0050374
555 Ga0496101_0348013
556 Ga0496101_0517583
557 Ga0496102_0252575
558 Ga0496104_0016491
559 Ga0496104_0082692
560 Ga0496105_0061573
561 Ga0496105_0139308
562 Ga0496105_0308692
563 Ga0496106_0124490
564 Ga0496106_0270476
565 Ga0496106_0495224
566 Ga0496107_0002379
567 Ga0496107_0292376
568 Ga0496108_0013995
569 Ga0496109_0052228
570 Ga0496109_0084226
571 Ga0496109_0463984
572 Ga0496109_0635248
573 Ga0496110_0055124
574 Ga0496111_0022016
575 Ga0496111_0035821
576 Ga0496112_0007418
577 Ga0496112_0018506
578 Ga0496113_0022203
579 Ga0496115_0000306
580 Ga0496115_0030884
581 Ga0496115_0188317
582 Ga0501031_0115225
583 Ga0501034_0006344
584 Ga0501034_0046943
585 Ga0501034_0192018
586 Ga0501036_0845518
587 Ga0501040_0010851
588 Ga0501040_0229677
589 Ga0501047_0467269
590 Ga0501048_0021563
591 Ga0501067_0132081
592 Ga0501071_0069907
593 Ga0501072_0112857
594 Ga0501075_0039446
595 Ga0501076_0083008
596 Ga0501076_0778625
597 Ga0501249_038296
598 Ga0501079_0056962
599 Ga0501079_0232280
600 Ga0501079_0479727
601 Ga0501080_0374211
602 Ga0501081_0207175
603 Ga0501035_0139568
604 Ga0501044_0204582
605 Ga0501045_0154848
606 Ga0501045_0180064
607 nmdc:mga05p37_26088_c1
608 nmdc:mga05p37_488160_c1
609 nmdc:mga09592_38200_c1
610 nmdc:mga0qj67_2929_c1
611 nmdc:mga0qj67_71324_c1
612 nmdc:mga06r32_268108_c1
613 nmdc:mga06r32_63590_c1
614 nmdc:mga06r32_80835_c1
615 nmdc:mga08y16_182314_c1
616 nmdc:mga08y16_387702_c1
617 nmdc:mga0a205_223296_c1
618 Ga0495601_0003679
619 Ga0495612_0000059
620 Ga0495595_0003402
621 Ga0501084_0135552
622 Ga0501084_0355700
623 Ga0590075_043215
624 Ga0466962_0146071
625 Ga0530510_0018446
626 Ga0530510_0020628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13614

AAA_31

AAA domain

29

198

0.98

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

32

249

0.94

PF02374

ArsA_ATPase

Anion-transporting ATPase

30

99

0.91

PF06564

CBP_BcsQ

Cellulose biosynthesis protein BcsQ

29

183

0.86

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

28

252

0.77

PF09140

MipZ

ATPase MipZ

30

175

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iud-assembly1.cif.gz_A structure of helicobacter pylori soj-adp complex bound to dna 0.955 1 242
2bej-assembly1.cif.gz_A structure of the bacterial chromosome segregation protein soj 0.9252 1 244
2bek-assembly2.cif.gz_D structure of the bacterial chromosome segregation protein soj 0.9154 1 245
5if9-assembly1.cif.gz_A crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound atp analog and magnesium 0.9137 1 246
2bek-assembly2.cif.gz_D structure of the bacterial chromosome segregation protein soj 0.9118 1 245
ID Description Score Start End Superfamily
af_P9WLT1_58_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9665 2 245 3.40.50.300
af_Q1LVD4_80_340_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9558 1 243 3.40.50.300
6iudB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9551 1 242 3.40.50.300
af_Q60283_1_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9387 3 242 3.40.50.300
2bekD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9154 1 245 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538LTG7-F1-model_v4 ParA family protein 0.9952 1 246
AF-A0A2H6B6D4-F1-model_v4 Sporulation initiation inhibitor protein Soj (EC 3.6.-.-) 0.9937 1 262 GO:0016787
AF-A0A7V9M5A4-F1-model_v4 ParA family protein 0.9907 1 193
AF-A0A640Y917-F1-model_v4 ParA family protein 0.9897 1 261
AF-A0A838PN84-F1-model_v4 ParA family protein 0.9886 1 227

Map