F402220

General Info

Members Datasets Scaffolds Average Seq Length
313 232 305 317

Family's Representative Sequence

Representative Sequence 3300025949|Ga0207667_10359510|Ga0207667_103595101
Length 355
Sequence MSAVLKNPPPARPQESPGLWTLAWRRLRQDRVGMVSLAIVAFFLAMMVASYAGLIASDWSKEKGVSYANPSFLAGAENLEAKAMAEKQAAKAPTVDLSDIDPLAPRYKEWAERAAKIAVTETKRSETLPLGGDKWGRDVLQKVIKGSEVSIFVGLTGAMLAMLIGTVFGALAGYFGGRVNDFFEWFYNIFTSIPYILLILAFAAVATSTGKFGKGIVPIVLVLSLTGWTGIYRLIRAEYIKHGNREYVKAAQAIGASNASRMFRHILPNVSHVALVQLSQNTVQFIKAEVILSFLGFGVPVDMVSWGTMLAEAQNELVIGKWWQLAAAGAAMAILVTAFSILTDSLRDALDPKLK

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221585 Pelomonas sp. Root662 Isolate Unclassified
3 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
4 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
5 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
6 2643221656 Pelomonas sp. Root405 Isolate Unclassified
7 2738541337 Pelomonas sp. BT06 Isolate Unclassified
8 2831864461 Roseateles noduli HZ7 Isolate Nodule
9 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
132 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
162 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
163 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
164 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
165 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
166 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
167 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
168 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
169 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
170 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
216 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
231 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.82
Nodule 1.6
Rhizoplane 0.96
Rhizosphere 77.64
Stem 0
Stem Tuber 0
Unclassified 7.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001326 3300003316 Bacteria 4455
2 rootH1_10049452 3300003316 Bacteria 1679
3 rootH2_10018883 3300003320 Bacteria 12281
4 rootL2_10000355 3300003322 Bacteria 68136
5 rootL2_10090363 3300003322 Bacteria 3413
6 rootH1_10026255 3300003323 Bacteria 4005
7 rootH1_10041325 3300003323 Bacteria 4054
8 rootH1_10075429 3300003316 Bacteria 2683
9 rootH1_10075429 3300003323 Bacteria 1366
10 rootH1_10239664 3300003323 Bacteria 2989
11 Ga0055525_1000036 3300003759 Bacteria 298878
12 Ga0055526_1000803 3300003771 Bacteria 23406
13 Ga0055524_1000204 3300003775 Bacteria 64269
14 Ga0055528_1026996 3300003790 Bacteria 1631
15 Ga0055530_10001169 3300003791 Bacteria 20307
16 Ga0055540_1000026 3300003792 Bacteria 189071
17 Ga0055540_1000042 3300003792 Bacteria 156410
18 Ga0055531_10000022 3300003794 Bacteria 166362
19 Ga0055531_10008200 3300003794 Bacteria 5560
20 Ga0055543_1015102 3300004625 Bacteria 1492
21 Ga0065165_1000079 3300005262 Bacteria 162095
22 Ga0065165_1000697 3300005262 Bacteria 48010
23 Ga0065712_10075797 3300005290 Bacteria 3788
24 Ga0065707_10084095 3300005295 Bacteria 7704
25 Ga0070658_10098975 3300005327 Bacteria 2409
26 Ga0070658_10169213 3300005327 Bacteria 1835
27 Ga0070676_10256265 3300005328 Bacteria 1170
28 Ga0070677_10022117 3300005333 Bacteria 2338
29 Ga0068869_100117305 3300005334 Bacteria 2032
30 Ga0068869_100330927 3300005334 Bacteria 1238
31 Ga0068868_100017071 3300005338 Bacteria 5401
32 Ga0070689_100052549 3300005340 Bacteria 3152
33 Ga0070689_100115222 3300005340 Bacteria 2142
34 Ga0070689_100241461 3300005340 Bacteria 1488
35 Ga0070669_100070234 3300005353 Bacteria 2588
36 Ga0070669_100363318 3300005353 Bacteria 1178
37 Ga0070675_100012296 3300005354 Bacteria 6709
38 Ga0070675_100086668 3300005354 Bacteria 2617
39 Ga0070673_100103240 3300005364 Bacteria 2352
40 Ga0070673_100159504 3300005364 Bacteria 1917
41 Ga0070688_100007892 3300005365 Bacteria 5754
42 Ga0070659_100000802 3300005366 Bacteria 22909
43 Ga0070659_100187187 3300005366 Bacteria 1700
44 Ga0070714_100039357 3300005435 Bacteria 3980
45 Ga0070701_10006973 3300005438 Bacteria 4792
46 Ga0070678_100017082 3300005456 Bacteria 4661
47 Ga0070678_100147842 3300005456 Bacteria 1889
48 Ga0070678_100324934 3300005456 Bacteria 1315
49 Ga0070662_100192761 3300005457 Bacteria 1613
50 Ga0070681_10001079 3300005458 Bacteria 23263
51 Ga0068867_100239211 3300005459 Bacteria 1471
52 Ga0070685_10028384 3300005466 Bacteria 3099
53 Ga0070679_100455481 3300005530 Bacteria 1224
54 Ga0068853_100185545 3300005539 Bacteria 1888
55 Ga0070672_100037815 3300005543 Bacteria 3684
56 Ga0070696_100022654 3300005546 Bacteria 4269
57 Ga0070696_100091602 3300005546 Bacteria 2165
58 Ga0070693_100010597 3300005547 Bacteria 4621
59 Ga0070704_100077066 3300005549 Bacteria 2441
60 Ga0068855_100005941 3300005563 Bacteria 14884
61 Ga0068855_100035317 3300005563 Bacteria 5954
62 Ga0068855_100185793 3300005563 Bacteria 2347
63 Ga0070664_100047176 3300005564 Bacteria 3639
64 Ga0068857_100016274 3300005577 Bacteria 6516
65 Ga0068852_100041921 3300005616 Bacteria 3872
66 Ga0068852_100197612 3300005616 Bacteria 1901
67 Ga0068852_100442927 3300005616 Bacteria 1285
68 Ga0068859_100004913 3300005617 Bacteria 13610
69 Ga0068851_10000875 3300005834 Bacteria 12984
70 Ga0068870_10147206 3300005840 Bacteria 1384
71 Ga0068863_100172669 3300005841 Bacteria 2074
72 Ga0068858_100001225 3300005842 Bacteria 26559
73 Ga0068858_100042273 3300005842 Bacteria 4225
74 Ga0068860_100001205 3300005843 Bacteria 28228
75 Ga0068862_100009836 3300005844 Bacteria 7898
76 Ga0068862_100326568 3300005844 Bacteria 1417
77 Ga0075366_10041860 3300006195 Bacteria 2712
78 Ga0075366_10170466 3300006195 Bacteria 1320
79 Ga0097621_100009123 3300006237 Bacteria 7189
80 Ga0097621_100090876 3300006237 Bacteria 2555
81 Ga0075370_10007734 3300006353 Bacteria 5487
82 Ga0075370_10014317 3300006353 Bacteria 4231
83 Ga0068871_100005840 3300006358 Bacteria 8652
84 Ga0068871_100034591 3300006358 Bacteria 4010
85 Ga0068871_100126165 3300006358 Bacteria 2166
86 Ga0075428_100045395 3300006844 Bacteria 4828
87 Ga0075433_10053408 3300006852 Bacteria 3523
88 Ga0075436_100002852 3300006914 Bacteria 11836
89 Ga0097620_100004913 3300006931 Bacteria 13610
90 Ga0099823_1000002 3300006944 Bacteria 212272
91 Ga0079104_1000012 3300006946 Bacteria 355143
92 Ga0075435_100073104 3300007076 Bacteria 2802
93 Ga0105250_10000149 3300009092 Bacteria 61585
94 Ga0105240_10348805 3300009093 Bacteria 1680
95 Ga0111539_10000744 3300009094 Bacteria 42281
96 Ga0105245_10089110 3300009098 Bacteria 2836
97 Ga0114129_10065389 3300009147 Bacteria 5075
98 Ga0105241_10028972 3300009174 Bacteria 4127
99 Ga0105242_10056104 3300009176 Bacteria 3223
100 Ga0105242_10260092 3300009176 Bacteria 1567
101 Ga0105248_10044898 3300009177 Bacteria 4956
102 Ga0105238_10061296 3300009551 Bacteria 3765
103 Ga0105238_10196239 3300009551 Bacteria 1994
104 Ga0105249_10242942 3300009553 Bacteria 1781
105 Ga0157319_1000007 3300012497 Bacteria 318528
106 Ga0157370_10017216 3300013104 Bacteria 7294
107 Ga0157374_10116169 3300013296 Bacteria 2578
108 Ga0163162_10029221 3300013306 Bacteria 5455
109 Ga0163162_10072127 3300013306 Bacteria 3508
110 Ga0157372_10063212 3300013307 Bacteria 4150
111 Ga0157375_10095644 3300013308 Bacteria 3042
112 Ga0157380_10023495 3300014326 Bacteria 4650
113 Ga0157379_10001105 3300014968 Bacteria 22052
114 Ga0157379_10001550 3300014968 Bacteria 18907
115 Ga0213872_10000170 3300021361 Bacteria 58410
116 Ga0213872_10000701 3300021361 Bacteria 25195
117 Ga0213872_10001858 3300021361 Bacteria 13053
118 Ga0209563_100014 3300025230 Bacteria 940582
119 Ga0209673_1022163 3300025273 Bacteria 2199
120 Ga0209673_1033202 3300025273 Bacteria 1578
121 Ga0209564_1000030 3300025295 Bacteria 503296
122 Ga0209050_1000556 3300025298 Bacteria 61372
123 Ga0209050_1006408 3300025298 Bacteria 6975
124 Ga0209256_1000030 3300025299 Bacteria 414828
125 Ga0209256_1000154 3300025299 Bacteria 144509
126 Ga0209051_1000004 3300025303 Bacteria 1155596
127 Ga0209051_1011545 3300025303 Bacteria 4352
128 Ga0209257_1000061 3300025304 Bacteria 367698
129 Ga0209257_1000063 3300025304 Bacteria 359089
130 Ga0209257_1001576 3300025304 Bacteria 26301
131 Ga0209257_1001940 3300025304 Bacteria 22328
132 Ga0209257_1018327 3300025304 Bacteria 2700
133 Ga0207656_10020402 3300025321 Bacteria 2634
134 Ga0207696_1000153 3300025711 Bacteria 119213
135 Ga0207682_10006971 3300025893 Bacteria 4530
136 Ga0207682_10057614 3300025893 Bacteria 1620
137 Ga0207688_10166602 3300025901 Bacteria 1309
138 Ga0207645_10073639 3300025907 Bacteria 2186
139 Ga0207705_10031842 3300025909 Bacteria 3767
140 Ga0207654_10172133 3300025911 Bacteria 1407
141 Ga0207707_10006964 3300025912 Bacteria 9858
142 Ga0207695_10108638 3300025913 Bacteria 2758
143 Ga0207695_10300237 3300025913 Bacteria 1497
144 Ga0207660_10088254 3300025917 Bacteria 2293
145 Ga0207657_10272225 3300025919 Bacteria 1346
146 Ga0207652_10325763 3300025921 Bacteria 1387
147 Ga0207681_10034158 3300025923 Bacteria 3341
148 Ga0207694_10005062 3300025924 Bacteria 10193
149 Ga0207694_10049121 3300025924 Bacteria 3265
150 Ga0207694_10235719 3300025924 Bacteria 1495
151 Ga0207650_10117229 3300025925 Bacteria 2069
152 Ga0207659_10017861 3300025926 Bacteria 4641
153 Ga0207659_10150244 3300025926 Bacteria 1818
154 Ga0207664_10042422 3300025929 Bacteria 3551
155 Ga0207690_10001084 3300025932 Bacteria 17396
156 Ga0207686_10004981 3300025934 Bacteria 7151
157 Ga0207686_10026927 3300025934 Bacteria 3360
158 Ga0207670_10101550 3300025936 Bacteria 2055
159 Ga0207670_10103821 3300025936 Bacteria 2034
160 Ga0207704_10082436 3300025938 Bacteria 2084
161 Ga0207691_10032334 3300025940 Bacteria 4878
162 Ga0207691_10039839 3300025940 Bacteria 4346
163 Ga0207691_10052312 3300025940 Bacteria 3730
164 Ga0207711_10056192 3300025941 Bacteria 3382
165 Ga0207711_10222085 3300025941 Bacteria 1728
166 Ga0207689_10102140 3300025942 Bacteria 2355
167 Ga0207667_10011054 3300025949 Bacteria 10516
168 Ga0207667_10023336 3300025949 Bacteria 6813
169 Ga0207667_10040293 3300025949 Bacteria 4974
170 Ga0207667_10359510 3300025949 Bacteria 1485
171 Ga0207651_10090707 3300025960 Bacteria 2235
172 Ga0207651_10231927 3300025960 Bacteria 1499
173 Ga0207658_10099935 3300025986 Bacteria 2270
174 Ga0207703_10007051 3300026035 Bacteria 8940
175 Ga0207639_10198004 3300026041 Bacteria 1721
176 Ga0207648_10183657 3300026089 Bacteria 1852
177 Ga0207648_10249884 3300026089 Bacteria 1581
178 Ga0207676_10150444 3300026095 Bacteria 2004
179 Ga0207674_10096972 3300026116 Bacteria 2933
180 Ga0207683_10032064 3300026121 Bacteria 4563
181 Ga0207698_10013378 3300026142 Bacteria 5412
182 Ga0209281_1000039 3300027111 Bacteria 355150
183 Ga0209389_1000304 3300027296 Bacteria 30705
184 Ga0207428_10011069 3300027907 Bacteria 8015
185 Ga0268265_10090819 3300028380 Bacteria 2440
186 Ga0307515_10000548 3300028794 Bacteria 88685
187 Ga0307515_10005718 3300028794 Bacteria 25111
188 Ga0307515_10081013 3300028794 Bacteria 4223
189 Ga0307515_10230530 3300028794 Bacteria 1645
190 Ga0265331_10003625 3300031250 Bacteria 9872
191 Ga0265327_10000086 3300031251 Bacteria 202345
192 Ga0307408_100000006 3300031548 Bacteria 472824
193 Ga0307408_100084203 3300031548 Bacteria 2385
194 Ga0307408_100092666 3300031548 Bacteria 2284
195 Ga0307408_100315624 3300031548 Bacteria 1315
196 Ga0265314_10073855 3300031711 Bacteria 2273
197 Ga0307516_10005378 3300031730 Bacteria 15384
198 Ga0307516_10012098 3300031730 Bacteria 9324
199 Ga0307407_10195787 3300031903 Bacteria 1351
200 Ga0307416_100428527 3300032002 Bacteria 1369
201 Ga0307414_10008389 3300032004 Bacteria 5856
202 Ga0307411_10000167 3300032005 Bacteria 21174
203 Ga0307510_10003036 3300033180 Bacteria 19364
204 Ga0373958_0011175 3300034819 Bacteria 1513
205 Ga0373939_0000068 3300035114 Bacteria 33492
206 Ga0373960_0000211 3300035121 Bacteria 10656
207 Ga0373955_0028194 3300035172 Bacteria 2910
208 Ga0373961_0020571 3300035241 Bacteria 1747
209 Ga0373962_0008307 3300035242 Bacteria 2553
210 Ga0373931_0000548 3300035691 Bacteria 15445
211 Ga0373935_0208841 3300035692 Bacteria 1352
212 Ga0373927_0046557 3300035695 Bacteria 2806
213 Ga0373937_0016171 3300036401 Bacteria 6619
214 Ga0373925_0042700 3300037068 Bacteria 3364
215 Ga0395899_0072816 3300037312 Bacteria 2514
216 Ga0395905_0003279 3300037471 Bacteria 17376
217 Ga0395905_0025244 3300037471 Bacteria 5605
218 Ga0395905_0057106 3300037471 Bacteria 3651
219 Ga0395905_0070367 3300037471 Bacteria 3278
220 Ga0395905_0123696 3300037471 Bacteria 2432
221 Ga0436365_0035607 3300039437 Bacteria 2159
222 Ga0436361_0259649 3300039447 Bacteria 33673
223 Ga0436361_0331226 3300039447 Bacteria 9939
224 Ga0436361_0354255 3300039447 Bacteria 247479
225 Ga0439433_0012785 3300041999 Bacteria 1842
226 Ga0439437_000766 3300042000 Bacteria 3272
227 Ga0450917_001064 3300042120 Bacteria 2016
228 Ga0450920_009655 3300042122 Bacteria 1778
229 Ga0450888_000186 3300042126 Bacteria 5482
230 Ga0450890_000502 3300042127 Bacteria 5749
231 Ga0450891_000521 3300042129 Bacteria 4039
232 Ga0450892_000673 3300042130 Bacteria 3851
233 Ga0450916_001916 3300042530 Bacteria 2140
234 Ga0450918_000113 3300042531 Bacteria 17235
235 Ga0451577_0010360 3300042876 Bacteria 8919
236 Ga0466963_0136791 3300044694 Bacteria 1696
237 Ga0466960_0013587 3300044901 Bacteria 3463
238 Ga0451576_0225140 3300045051 Bacteria 1958
239 Ga0451576_0233190 3300045051 Bacteria 1922
240 Ga0451576_0264526 3300045051 Bacteria 1798
241 Ga0495592_0023525 3300046454 Bacteria 4686
242 Ga0495590_0000583 3300046457 Bacteria 17230
243 Ga0495653_0028734 3300046463 Bacteria 4445
244 Ga0495653_0173444 3300046463 Bacteria 1486
245 Ga0495580_0105249 3300046472 Bacteria 1960
246 Ga0495582_0008115 3300046473 Bacteria 5798
247 Ga0495664_0090118 3300046477 Bacteria 1844
248 Ga0495594_0011846 3300046499 Bacteria 4536
249 Ga0495608_0009483 3300046511 Bacteria 6801
250 Ga0495628_0176275 3300046516 Bacteria 1619
251 Ga0495630_0148323 3300046517 Bacteria 1784
252 Ga0495632_0053644 3300046519 Bacteria 1979
253 Ga0495666_0002742 3300046526 Bacteria 8801
254 Ga0495666_0024452 3300046526 Bacteria 2984
255 Ga0495666_0070148 3300046526 Bacteria 1666
256 Ga0495652_0009442 3300046529 Bacteria 8862
257 Ga0495665_0056052 3300046531 Bacteria 2080
258 Ga0495586_0009199 3300046535 Bacteria 5252
259 Ga0495587_0015705 3300046536 Bacteria 4723
260 Ga0495587_0034294 3300046536 Bacteria 3061
261 Ga0495621_0000585 3300046539 Bacteria 9094
262 Ga0495634_0031761 3300046642 Bacteria 3635
263 Ga0495625_0010833 3300046660 Bacteria 7500
264 Ga0495599_0021001 3300046678 Bacteria 4071
265 Ga0495623_0010130 3300046679 Bacteria 6102
266 Ga0495623_0040382 3300046679 Bacteria 2979
267 Ga0495646_0109377 3300046680 Bacteria 1575
268 Ga0495624_0041778 3300046690 Bacteria 2932
269 Ga0495600_0099060 3300046809 Bacteria 1900
270 Ga0495604_0135682 3300047317 Bacteria 1763
271 Ga0495676_0026171 3300047321 Bacteria 5026
272 Ga0495680_0169672 3300047322 Bacteria 1580
273 Ga0495675_0001035 3300047444 Bacteria 16891
274 Ga0495593_0078260 3300047673 Bacteria 1713
275 Ga0495602_0051378 3300048088 Bacteria 3671
276 Ga0495602_0078812 3300048088 Bacteria 2781
277 Ga0495626_0000418 3300048091 Bacteria 43563
278 Ga0496104_0013991 3300048907 Bacteria 7239
279 Ga0496105_0132844 3300048908 Bacteria 2051
280 Ga0496114_0007577 3300048917 Bacteria 8584
281 Ga0496124_0002695 3300048927 Bacteria 22714
282 Ga0501047_0067666 3300049581 Bacteria 3441
283 Ga0501069_0003678 3300049585 Bacteria 7893
284 Ga0501070_0008953 3300049586 Bacteria 8465
285 Ga0501073_0000206 3300049589 Bacteria 38869
286 Ga0501074_0018842 3300049590 Bacteria 5013
287 Ga0501211_001584 3300049658 Bacteria 2435
288 Ga0501233_001200 3300049668 Bacteria 4410
289 Ga0501079_0015426 3300049741 Bacteria 5830
290 Ga0501080_0036584 3300049742 Bacteria 4581
291 Ga0501083_0003335 3300049744 Bacteria 11229
292 Ga0501272_000192 3300049769 Bacteria 5041
293 Ga0501035_0316033 3300049822 Bacteria 1313
294 Ga0501044_0295251 3300049823 Bacteria 1551
295 nmdc:mga0k408_29022_c1 3300050493 Bacteria 3147
296 nmdc:mga0k408_5896_c1 3300050493 Bacteria 6533
297 nmdc:mga07m45_55775_c1 3300050496 Bacteria 2234
298 nmdc:mga08y16_1819_c1 3300050511 Bacteria 21630
299 nmdc:mga08x19_16476_c1 3300050514 Bacteria 4508
300 Ga0495601_0071912 3300053077 Bacteria 2209
301 Ga0495619_0068617 3300053085 Bacteria 2369
302 Ga0500578_0065802 3300053086 Bacteria 2312
303 Ga0500618_000710 3300053125 Bacteria 19287
304 Ga0500587_003665 3300053739 Bacteria 2134
305 Ga0501084_0111836 3300054114 Bacteria 2295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009092 Ga0105250_10000149 Ga0105250_100001492 253
2 3300014968 Ga0157379_10001550 Ga0157379_1000155020 253
3 3300053125 Ga0500618_000710 Ga0500618_000710_3417_4505 268
4 3300005340 Ga0070689_100115222 Ga0070689_1001152222 269
5 3300025936 Ga0207670_10103821 Ga0207670_101038212 269
6 3300046680 Ga0495646_0109377 Ga0495646_0109377_52_1074 270
7 3300047322 Ga0495680_0169672 Ga0495680_0169672_46_1068 270
8 3300031711 Ga0265314_10073855 Ga0265314_100738552 272
9 3300009177 Ga0105248_10044898 Ga0105248_100448982 273
10 3300013308 Ga0157375_10095644 Ga0157375_100956443 273
11 3300014968 Ga0157379_10001105 Ga0157379_100011052 273
12 3300045051 Ga0451576_0225140 Ga0451576_0225140_737_1693 273
13 3300005290 Ga0065712_10075797 Ga0065712_100757972 275
14 3300005456 Ga0070678_100324934 Ga0070678_1003249342 275
15 3300006844 Ga0075428_100045395 Ga0075428_1000453953 275
16 3300009094 Ga0111539_10000744 Ga0111539_1000074431 275
17 3300027907 Ga0207428_10011069 Ga0207428_100110692 275
18 3300050511 nmdc:mga08y16_1819_c1 nmdc:mga08y16_1819_c1_9982_11052 275
19 3300005353 Ga0070669_100363318 Ga0070669_1003633181 276
20 3300009093 Ga0105240_10348805 Ga0105240_103488052 277
21 3300048091 Ga0495626_0000418 Ga0495626_0000418_10054_11091 278
22 3300046526 Ga0495666_0024452 Ga0495666_0024452_1093_2115 279
23 3300046457 Ga0495590_0000583 Ga0495590_0000583_8040_9056 280
24 3300046463 Ga0495653_0028734 Ga0495653_0028734_1499_2515 280
25 3300046472 Ga0495580_0105249 Ga0495580_0105249_383_1399 280
26 3300046473 Ga0495582_0008115 Ga0495582_0008115_3199_4215 280
27 3300046499 Ga0495594_0011846 Ga0495594_0011846_1858_2874 280
28 3300046517 Ga0495630_0148323 Ga0495630_0148323_561_1577 280
29 3300046526 Ga0495666_0070148 Ga0495666_0070148_274_1290 280
30 3300046529 Ga0495652_0009442 Ga0495652_0009442_1830_2846 280
31 3300046531 Ga0495665_0056052 Ga0495665_0056052_903_1919 280
32 3300046535 Ga0495586_0009199 Ga0495586_0009199_192_1208 280
33 3300046536 Ga0495587_0015705 Ga0495587_0015705_3100_4116 280
34 3300046642 Ga0495634_0031761 Ga0495634_0031761_526_1542 280
35 3300046679 Ga0495623_0010130 Ga0495623_0010130_3361_4377 280
36 3300046809 Ga0495600_0099060 Ga0495600_0099060_137_1153 280
37 3300047317 Ga0495604_0135682 Ga0495604_0135682_694_1710 280
38 3300047444 Ga0495675_0001035 Ga0495675_0001035_2118_3134 280
39 3300048088 Ga0495602_0078812 Ga0495602_0078812_1160_2176 280
40 3300025711 Ga0207696_1000153 Ga0207696_100015374 281
41 3300046526 Ga0495666_0002742 Ga0495666_0002742_1803_2810 281
42 3300005438 Ga0070701_10006973 Ga0070701_100069732 282
43 3300005549 Ga0070704_100077066 Ga0070704_1000770662 282
44 3300005617 Ga0068859_100004913 Ga0068859_1000049132 282
45 3300006931 Ga0097620_100004913 Ga0097620_1000049132 282
46 3300035695 Ga0373927_0046557 Ga0373927_0046557_280_1392 282
47 3300037068 Ga0373925_0042700 Ga0373925_0042700_514_1626 283
48 3300046539 Ga0495621_0000585 Ga0495621_0000585_1094_2164 283
49 3300031548 Ga0307408_100084203 Ga0307408_1000842032 285
50 3300005459 Ga0068867_100239211 Ga0068867_1002392111 286
51 3300005842 Ga0068858_100042273 Ga0068858_1000422733 286
52 3300009176 Ga0105242_10056104 Ga0105242_100561043 286
53 3300013296 Ga0157374_10116169 Ga0157374_101161691 286
54 3300013306 Ga0163162_10029221 Ga0163162_100292212 286
55 3300025924 Ga0207694_10049121 Ga0207694_100491211 286
56 3300025934 Ga0207686_10004981 Ga0207686_100049815 286
57 3300031903 Ga0307407_10195787 Ga0307407_101957872 286
58 3300034819 Ga0373958_0011175 Ga0373958_0011175_274_1341 287
59 3300014326 Ga0157380_10023495 Ga0157380_100234952 288
60 3300026095 Ga0207676_10150444 Ga0207676_101504442 288
61 3300003323 rootH1_10239664 rootH1_102396643 294
62 3300026089 Ga0207648_10183657 Ga0207648_101836572 294
63 3300005340 Ga0070689_100241461 Ga0070689_1002414612 295
64 3300049668 Ga0501233_001200 Ga0501233_001200_3115_4140 296
65 3300005327 Ga0070658_10169213 Ga0070658_101692132 297
66 3300005616 Ga0068852_100041921 Ga0068852_1000419212 297
67 3300005843 Ga0068860_100001205 Ga0068860_10000120521 297
68 3300025925 Ga0207650_10117229 Ga0207650_101172292 297
69 3300026142 Ga0207698_10013378 Ga0207698_100133786 297
70 3300049658 Ga0501211_001584 Ga0501211_001584_294_1319 298
71 3300049769 Ga0501272_000192 Ga0501272_000192_186_1211 298
72 3300021361 Ga0213872_10001858 Ga0213872_100018583 301
73 3300039447 Ga0436361_0331226 Ga0436361_0331226_1868_2914 301
74 3300021361 Ga0213872_10000701 Ga0213872_1000070113 302
75 3300039447 Ga0436361_0259649 Ga0436361_0259649_9957_11000 302
76 3300005366 Ga0070659_100187187 Ga0070659_1001871872 304
77 3300005539 Ga0068853_100185545 Ga0068853_1001855452 304
78 3300005842 Ga0068858_100001225 Ga0068858_1000012258 304
79 3300013306 Ga0163162_10072127 Ga0163162_100721272 304
80 3300025940 Ga0207691_10032334 Ga0207691_100323342 304
81 3300025986 Ga0207658_10099935 Ga0207658_100999352 304
82 3300026035 Ga0207703_10007051 Ga0207703_100070516 304
83 3300026041 Ga0207639_10198004 Ga0207639_101980042 304
84 3300050493 nmdc:mga0k408_5896_c1 nmdc:mga0k408_5896_c1_759_1793 304
85 3300005295 Ga0065707_10084095 Ga0065707_100840955 305
86 3300005334 Ga0068869_100117305 Ga0068869_1001173052 305
87 3300005546 Ga0070696_100091602 Ga0070696_1000916022 305
88 3300005547 Ga0070693_100010597 Ga0070693_1000105972 305
89 3300005616 Ga0068852_100442927 Ga0068852_1004429272 305
90 3300006237 Ga0097621_100090876 Ga0097621_1000908762 305
91 3300006358 Ga0068871_100005840 Ga0068871_1000058402 305
92 3300006358 Ga0068871_100034591 Ga0068871_1000345912 305
93 3300009098 Ga0105245_10089110 Ga0105245_100891101 305
94 3300009176 Ga0105242_10260092 Ga0105242_102600922 305
95 3300009553 Ga0105249_10242942 Ga0105249_102429422 305
96 3300025934 Ga0207686_10026927 Ga0207686_100269273 305
97 3300025938 Ga0207704_10082436 Ga0207704_100824362 305
98 3300025941 Ga0207711_10222085 Ga0207711_102220852 305
99 3300035172 Ga0373955_0028194 Ga0373955_0028194_371_1441 305
100 3300035692 Ga0373935_0208841 Ga0373935_0208841_113_1183 305
101 3300036401 Ga0373937_0016171 Ga0373937_0016171_645_1715 305
102 3300046454 Ga0495592_0023525 Ga0495592_0023525_2164_3234 305
103 3300046463 Ga0495653_0173444 Ga0495653_0173444_310_1380 305
104 3300046477 Ga0495664_0090118 Ga0495664_0090118_367_1437 305
105 3300046511 Ga0495608_0009483 Ga0495608_0009483_4469_5539 305
106 3300046516 Ga0495628_0176275 Ga0495628_0176275_194_1264 305
107 3300046536 Ga0495587_0034294 Ga0495587_0034294_1278_2348 305
108 3300046678 Ga0495599_0021001 Ga0495599_0021001_1739_2809 305
109 3300046679 Ga0495623_0040382 Ga0495623_0040382_251_1321 305
110 3300048088 Ga0495602_0051378 Ga0495602_0051378_2321_3391 305
111 3300053077 Ga0495601_0071912 Ga0495601_0071912_673_1743 305
112 3300053085 Ga0495619_0068617 Ga0495619_0068617_1043_2113 305
113 3300037471 Ga0395905_0123696 Ga0395905_0123696_931_1992 306
114 3300049581 Ga0501047_0067666 Ga0501047_0067666_1305_2375 306
115 3300049585 Ga0501069_0003678 Ga0501069_0003678_5777_6847 306
116 3300049586 Ga0501070_0008953 Ga0501070_0008953_1629_2699 306
117 3300049589 Ga0501073_0000206 Ga0501073_0000206_7689_8759 306
118 3300049590 Ga0501074_0018842 Ga0501074_0018842_1485_2555 306
119 3300049741 Ga0501079_0015426 Ga0501079_0015426_552_1622 306
120 3300049742 Ga0501080_0036584 Ga0501080_0036584_1883_2953 306
121 3300049744 Ga0501083_0003335 Ga0501083_0003335_5763_6833 306
122 3300049822 Ga0501035_0316033 Ga0501035_0316033_163_1233 306
123 3300049823 Ga0501044_0295251 Ga0501044_0295251_257_1327 306
124 3300054114 Ga0501084_0111836 Ga0501084_0111836_303_1373 306
125 iso_pu_bacteria 2643221644 2644245929 306
126 3300005328 Ga0070676_10256265 Ga0070676_102562651 307
127 3300005334 Ga0068869_100330927 Ga0068869_1003309271 307
128 3300005340 Ga0070689_100052549 Ga0070689_1000525492 307
129 3300005354 Ga0070675_100086668 Ga0070675_1000866683 307
130 3300005365 Ga0070688_100007892 Ga0070688_1000078923 307
131 3300005466 Ga0070685_10028384 Ga0070685_100283842 307
132 3300005577 Ga0068857_100016274 Ga0068857_1000162742 307
133 3300025901 Ga0207688_10166602 Ga0207688_101666021 307
134 3300025907 Ga0207645_10073639 Ga0207645_100736392 307
135 3300025926 Ga0207659_10150244 Ga0207659_101502442 307
136 3300025936 Ga0207670_10101550 Ga0207670_101015502 307
137 3300025940 Ga0207691_10039839 Ga0207691_100398392 307
138 3300025942 Ga0207689_10102140 Ga0207689_101021402 307
139 3300025960 Ga0207651_10090707 Ga0207651_100907071 307
140 3300026116 Ga0207674_10096972 Ga0207674_100969722 307
141 3300044694 Ga0466963_0136791 Ga0466963_0136791_252_1304 307
142 3300005366 Ga0070659_100000802 Ga0070659_10000080221 308
143 3300005563 Ga0068855_100005941 Ga0068855_1000059418 308
144 3300005564 Ga0070664_100047176 Ga0070664_1000471763 308
145 3300025913 Ga0207695_10300237 Ga0207695_103002372 308
146 3300025932 Ga0207690_10001084 Ga0207690_100010848 308
147 3300025949 Ga0207667_10040293 Ga0207667_100402932 308
148 3300032002 Ga0307416_100428527 Ga0307416_1004285271 308
149 3300041999 Ga0439433_0012785 Ga0439433_0012785_667_1758 308
150 3300042122 Ga0450920_009655 Ga0450920_009655_376_1392 308
151 3300042531 Ga0450918_000113 Ga0450918_000113_4638_5654 308
152 3300045051 Ga0451576_0233190 Ga0451576_0233190_768_1778 308
153 3300025893 Ga0207682_10057614 Ga0207682_100576142 309
154 3300025960 Ga0207651_10231927 Ga0207651_102319272 309
155 3300026089 Ga0207648_10249884 Ga0207648_102498842 309
156 3300026121 Ga0207683_10032064 Ga0207683_100320642 309
157 3300031730 Ga0307516_10012098 Ga0307516_100120989 309
158 3300039437 Ga0436365_0035607 Ga0436365_0035607_895_1962 309
159 iso_pu_bacteria 2643221544 2643744363 309
160 iso_pu_bacteria 2643221585 2643934317 309
161 iso_pu_bacteria 2643221656 2644315804 309
162 iso_pu_bacteria 2738541337 2739054351 309
163 3300003775 Ga0055524_1000204 Ga0055524_100020413 310
164 3300003791 Ga0055530_10001169 Ga0055530_1000116913 310
165 3300003792 Ga0055540_1000026 Ga0055540_1000026138 310
166 3300003792 Ga0055540_1000042 Ga0055540_100004226 310
167 3300006946 Ga0079104_1000012 Ga0079104_100001246 310
168 3300025298 Ga0209050_1000556 Ga0209050_100055618 310
169 3300025299 Ga0209256_1000030 Ga0209256_1000030198 310
170 3300025303 Ga0209051_1000004 Ga0209051_1000004618 310
171 3300025304 Ga0209257_1000063 Ga0209257_1000063104 310
172 3300027111 Ga0209281_1000039 Ga0209281_1000039280 310
173 3300048917 Ga0496114_0007577 Ga0496114_0007577_1303_2319 310
174 3300048927 Ga0496124_0002695 Ga0496124_0002695_9197_10249 310
175 3300004625 Ga0055543_1015102 Ga0055543_10151022 311
176 3300005262 Ga0065165_1000079 Ga0065165_100007996 311
177 3300031548 Ga0307408_100315624 Ga0307408_1003156241 311
178 3300033180 Ga0307510_10003036 Ga0307510_100030362 311
179 3300042876 Ga0451577_0010360 Ga0451577_0010360_7442_8491 311
180 3300053086 Ga0500578_0065802 Ga0500578_0065802_1188_2240 311
181 3300005338 Ga0068868_100017071 Ga0068868_1000170711 312
182 3300005616 Ga0068852_100197612 Ga0068852_1001976122 312
183 3300005834 Ga0068851_10000875 Ga0068851_1000087510 312
184 3300006237 Ga0097621_100009123 Ga0097621_1000091233 312
185 3300006358 Ga0068871_100126165 Ga0068871_1001261653 312
186 3300025321 Ga0207656_10020402 Ga0207656_100204023 312
187 3300025913 Ga0207695_10108638 Ga0207695_101086382 312
188 3300025919 Ga0207657_10272225 Ga0207657_102722252 312
189 3300025941 Ga0207711_10056192 Ga0207711_100561923 312
190 3300028794 Ga0307515_10230530 Ga0307515_102305302 312
191 3300048907 Ga0496104_0013991 Ga0496104_0013991_4303_5427 312
192 3300048908 Ga0496105_0132844 Ga0496105_0132844_915_2039 312
193 iso_pu_bacteria 2643221639 2644219465 312
194 iso_pu_bacteria 2643221646 2644255896 312
195 3300005327 Ga0070658_10098975 Ga0070658_100989752 313
196 3300005530 Ga0070679_100455481 Ga0070679_1004554811 313
197 3300025909 Ga0207705_10031842 Ga0207705_100318423 313
198 3300025921 Ga0207652_10325763 Ga0207652_103257632 313
199 3300031548 Ga0307408_100000006 Ga0307408_100000006142 313
200 3300032004 Ga0307414_10008389 Ga0307414_100083892 313
201 3300032005 Ga0307411_10000167 Ga0307411_100001673 313
202 3300035114 Ga0373939_0000068 Ga0373939_0000068_25195_26220 313
203 3300035121 Ga0373960_0000211 Ga0373960_0000211_6438_7463 313
204 3300035241 Ga0373961_0020571 Ga0373961_0020571_323_1348 313
205 3300035242 Ga0373962_0008307 Ga0373962_0008307_29_1054 313
206 3300035691 Ga0373931_0000548 Ga0373931_0000548_6185_7210 313
207 3300037471 Ga0395905_0003279 Ga0395905_0003279_10764_11789 313
208 3300042000 Ga0439437_000766 Ga0439437_000766_1338_2363 313
209 3300042120 Ga0450917_001064 Ga0450917_001064_409_1434 313
210 3300042126 Ga0450888_000186 Ga0450888_000186_177_1202 313
211 3300042127 Ga0450890_000502 Ga0450890_000502_1030_2055 313
212 3300042129 Ga0450891_000521 Ga0450891_000521_1676_2701 313
213 3300042130 Ga0450892_000673 Ga0450892_000673_45_1070 313
214 3300042530 Ga0450916_001916 Ga0450916_001916_160_1185 313
215 3300003316 rootH1_10049452 rootH1_100494522 314
216 3300003322 rootL2_10090363 rootL2_100903631 314
217 3300021361 Ga0213872_10000170 Ga0213872_1000017031 314
218 3300039447 Ga0436361_0354255 Ga0436361_0354255_67037_68065 314
219 iso_pu_bacteria 2831864461 2831865355 314
220 3300005333 Ga0070677_10022117 Ga0070677_100221171 315
221 3300005353 Ga0070669_100070234 Ga0070669_1000702343 315
222 3300005354 Ga0070675_100012296 Ga0070675_1000122964 315
223 3300005364 Ga0070673_100159504 Ga0070673_1001595041 315
224 3300005456 Ga0070678_100147842 Ga0070678_1001478421 315
225 3300005457 Ga0070662_100192761 Ga0070662_1001927611 315
226 3300005543 Ga0070672_100037815 Ga0070672_1000378153 315
227 3300005546 Ga0070696_100022654 Ga0070696_1000226543 315
228 3300005840 Ga0068870_10147206 Ga0068870_101472062 315
229 3300025893 Ga0207682_10006971 Ga0207682_100069712 315
230 3300025923 Ga0207681_10034158 Ga0207681_100341582 315
231 3300025924 Ga0207694_10235719 Ga0207694_102357192 315
232 3300025926 Ga0207659_10017861 Ga0207659_100178613 315
233 3300025940 Ga0207691_10052312 Ga0207691_100523122 315
234 3300025949 Ga0207667_10359510 Ga0207667_103595101 315
235 3300037312 Ga0395899_0072816 Ga0395899_0072816_1388_2455 315
236 3300037471 Ga0395905_0070367 Ga0395905_0070367_339_1406 315
237 3300050493 nmdc:mga0k408_29022_c1 nmdc:mga0k408_29022_c1_523_1590 315
238 3300003323 rootH1_10026255 rootH1_100262552 316
239 3300003323 rootH1_10041325 rootH1_100413255 316
240 3300003759 Ga0055525_1000036 Ga0055525_1000036102 316
241 3300003790 Ga0055528_1026996 Ga0055528_10269961 316
242 3300003794 Ga0055531_10000022 Ga0055531_1000002263 316
243 3300003794 Ga0055531_10008200 Ga0055531_100082004 316
244 3300005435 Ga0070714_100039357 Ga0070714_1000393572 316
245 3300005458 Ga0070681_10001079 Ga0070681_1000107915 316
246 3300005563 Ga0068855_100035317 Ga0068855_1000353174 316
247 3300005563 Ga0068855_100185793 Ga0068855_1001857932 316
248 3300006195 Ga0075366_10041860 Ga0075366_100418602 316
249 3300006852 Ga0075433_10053408 Ga0075433_100534083 316
250 3300006914 Ga0075436_100002852 Ga0075436_1000028523 316
251 3300006944 Ga0099823_1000002 Ga0099823_100000243 316
252 3300007076 Ga0075435_100073104 Ga0075435_1000731042 316
253 3300009174 Ga0105241_10028972 Ga0105241_100289721 316
254 3300009551 Ga0105238_10061296 Ga0105238_100612963 316
255 3300013104 Ga0157370_10017216 Ga0157370_100172165 316
256 3300013307 Ga0157372_10063212 Ga0157372_100632123 316
257 3300025230 Ga0209563_100014 Ga0209563_100014486 316
258 3300025273 Ga0209673_1022163 Ga0209673_10221632 316
259 3300025298 Ga0209050_1006408 Ga0209050_10064082 316
260 3300025303 Ga0209051_1011545 Ga0209051_10115454 316
261 3300025304 Ga0209257_1000061 Ga0209257_1000061275 316
262 3300025304 Ga0209257_1001940 Ga0209257_10019405 316
263 3300025304 Ga0209257_1018327 Ga0209257_10183272 316
264 3300025911 Ga0207654_10172133 Ga0207654_101721331 316
265 3300025912 Ga0207707_10006964 Ga0207707_100069646 316
266 3300025917 Ga0207660_10088254 Ga0207660_100882541 316
267 3300025924 Ga0207694_10005062 Ga0207694_100050628 316
268 3300025929 Ga0207664_10042422 Ga0207664_100424222 316
269 3300025949 Ga0207667_10011054 Ga0207667_100110543 316
270 3300025949 Ga0207667_10023336 Ga0207667_100233363 316
271 3300027296 Ga0209389_1000304 Ga0209389_100030417 316
272 3300028794 Ga0307515_10081013 Ga0307515_100810133 316
273 3300037471 Ga0395905_0057106 Ga0395905_0057106_1543_2604 316
274 3300050514 nmdc:mga08x19_16476_c1 nmdc:mga08x19_16476_c1_1231_2301 316
275 3300005456 Ga0070678_100017082 Ga0070678_1000170822 318
276 3300005844 Ga0068862_100326568 Ga0068862_1003265681 318
277 3300031250 Ga0265331_10003625 Ga0265331_100036253 318
278 3300031251 Ga0265327_10000086 Ga0265327_1000008632 318
279 iso_pu_bacteria 2886848708 2886852474 318
280 3300005262 Ga0065165_1000697 Ga0065165_100069710 319
281 3300005364 Ga0070673_100103240 Ga0070673_1001032402 319
282 3300005841 Ga0068863_100172669 Ga0068863_1001726692 319
283 3300005844 Ga0068862_100009836 Ga0068862_1000098365 319
284 3300006353 Ga0075370_10007734 Ga0075370_100077344 319
285 3300009147 Ga0114129_10065389 Ga0114129_100653893 319
286 3300028380 Ga0268265_10090819 Ga0268265_100908193 319
287 3300044901 Ga0466960_0013587 Ga0466960_0013587_1956_3017 319
288 3300050496 nmdc:mga07m45_55775_c1 nmdc:mga07m45_55775_c1_1025_2080 319
289 3300006195 Ga0075366_10170466 Ga0075366_101704661 320
290 3300028794 Ga0307515_10000548 Ga0307515_1000054849 320
291 3300028794 Ga0307515_10005718 Ga0307515_100057182 320
292 3300031730 Ga0307516_10005378 Ga0307516_100053785 320
293 3300046519 Ga0495632_0053644 Ga0495632_0053644_887_1936 320
294 3300046660 Ga0495625_0010833 Ga0495625_0010833_955_2004 320
295 3300053739 Ga0500587_003665 Ga0500587_003665_228_1277 320
296 3300046690 Ga0495624_0041778 Ga0495624_0041778_1778_2830 321
297 3300003316 rootH1_10001326 rootH1_100013265 322
298 3300003320 rootH2_10018883 rootH2_1001888311 322
299 3300003322 rootL2_10000355 rootL2_1000035545 322
300 3300003323 rootH1_10075429 rootH1_100754292 322
301 3300003771 Ga0055526_1000803 Ga0055526_100080315 322
302 3300006353 Ga0075370_10014317 Ga0075370_100143172 322
303 3300009551 Ga0105238_10196239 Ga0105238_101962392 322
304 3300012497 Ga0157319_1000007 Ga0157319_1000007159 322
305 3300025273 Ga0209673_1033202 Ga0209673_10332022 322
306 3300025295 Ga0209564_1000030 Ga0209564_100003081 322
307 3300025299 Ga0209256_1000154 Ga0209256_100015449 322
308 3300025304 Ga0209257_1001576 Ga0209257_100157624 322
309 3300031548 Ga0307408_100092666 Ga0307408_1000926662 322
310 3300037471 Ga0395905_0025244 Ga0395905_0025244_3934_4995 322
311 3300045051 Ga0451576_0264526 Ga0451576_0264526_140_1192 322
312 3300047321 Ga0495676_0026171 Ga0495676_0026171_2399_3451 322
313 3300047673 Ga0495593_0078260 Ga0495593_0078260_29_1081 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

165

355

0.99

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

18

70

0.86

Feature Viewer

pLDDT pTM Quality
54.64 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map