F402081

General Info

Members Datasets Scaffolds Average Seq Length
313 216 305 322

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100069754|Ga0070706_1000697543
Length 311
Sequence MTNVFGATSTTNEVLSGVNLQGKRILVTGVSAGIGVETARSLSAHGASVVGAVRDLAKAKAATTQVQRDAEENGGSFELVELDLANLKSVRACADQLIAKGEPFDLVIANAGVMATPFGHTADGFETQFGTNHLGHFVLVNRIVSLLRAGSVDLDDPNFERTPYEPFVAYGRSKTANILFAVAFDQRHRQRGVRAAAVHPGGIHTELARHLDPARIQALIDQMNQQLAKEGKPPFQWKTIPQGAATSVWAGVVAPADEIGGKYCENCHVGHVVADDVIISAISEGVRGYALDSTNAAALWKKSEEMVGEFF

Samples

Sample ID Description Type Environment
1 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
2 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
3 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
4 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
5 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
6 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
205 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
206 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
207 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
210 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
211 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
215 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
216 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0.32
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.82
Nodule 0
Rhizoplane 9.58
Rhizosphere 65.81
Stem 0
Stem Tuber 0
Unclassified 12.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003504 3300001979 Bacteria 6877
2 JGI24739J22299_10013088 3300001989 Bacteria 3034
3 JGI24735J21928_10001033 3300002067 Bacteria 9972
4 JGI24738J21930_10000060 3300002075 Bacteria 22592
5 JGI24742J22300_10020669 3300002244 Bacteria 1122
6 JGI25156J39149_1000578 3300002705 Bacteria 20951
7 JGI25165J46597_1000396 3300003214 Bacteria 46036
8 rootH2_10008213 3300003320 Bacteria 20096
9 JGI25160J50197_1000127 3300003354 Bacteria 68166
10 Ga0055533_1000070 3300003756 Bacteria 153414
11 Ga0055532_1000011 3300003758 Bacteria 385294
12 Ga0055527_1000009 3300003760 Bacteria 385294
13 Ga0055535_1000008 3300003761 Bacteria 385294
14 Ga0055542_1000014 3300003762 Bacteria 385294
15 Ga0055529_1000010 3300003763 Bacteria 385294
16 Ga0055531_10028653 3300003794 Bacteria 1914
17 Ga0065165_1000419 3300005262 Bacteria 67371
18 Ga0070690_100029459 3300005330 Bacteria 3405
19 Ga0070690_100187220 3300005330 Unclassified 1433
20 Ga0070666_10015132 3300005335 Bacteria 4919
21 Ga0070668_100204355 3300005347 Bacteria 1623
22 Ga0070674_100002420 3300005356 Bacteria 10314
23 Ga0070673_100047828 3300005364 Bacteria 3331
24 Ga0070673_100256543 3300005364 Bacteria 1526
25 Ga0070659_100049973 3300005366 Bacteria 3289
26 Ga0070667_100028557 3300005367 Bacteria 4645
27 Ga0070709_10122452 3300005434 Bacteria 1765
28 Ga0070713_100243461 3300005436 Bacteria 1638
29 Ga0070710_10003149 3300005437 Bacteria 7824
30 Ga0070711_100041551 3300005439 Bacteria 3106
31 Ga0070711_100074137 3300005439 Bacteria 2406
32 Ga0070705_100015157 3300005440 Bacteria 3979
33 Ga0070678_100001482 3300005456 Bacteria 12531
34 Ga0070678_100066610 3300005456 Bacteria 2677
35 Ga0070678_100175315 3300005456 Bacteria 1750
36 Ga0070706_100045672 3300005467 Bacteria 4045
37 Ga0070706_100069754 3300005467 Bacteria 3251
38 Ga0070698_100148821 3300005471 Bacteria 2290
39 Ga0070686_100124388 3300005544 Bacteria 1775
40 Ga0070665_100090596 3300005548 Bacteria 3064
41 Ga0070665_100557487 3300005548 Bacteria 1158
42 Ga0068856_100019031 3300005614 Bacteria 6663
43 Ga0068866_10023326 3300005718 Bacteria 2877
44 Ga0081539_10018549 3300005985 Bacteria 4822
45 Ga0070715_10005050 3300006163 Bacteria 4376
46 Ga0070712_100034457 3300006175 Bacteria 3431
47 Ga0099794_10010112 3300007265 Bacteria 3997
48 Ga0105240_10023272 3300009093 Bacteria 8199
49 Ga0105240_10129746 3300009093 Bacteria 3025
50 Ga0105243_10020276 3300009148 Bacteria 5041
51 Ga0105241_10018699 3300009174 Bacteria 5101
52 Ga0105248_10034525 3300009177 Bacteria 5657
53 Ga0105248_10039849 3300009177 Bacteria 5265
54 Ga0105237_10022702 3300009545 Bacteria 6438
55 Ga0105237_10193327 3300009545 Bacteria 2034
56 Ga0105239_10031358 3300010375 Bacteria 5847
57 Ga0105239_10307042 3300010375 Bacteria 1787
58 Ga0105246_10073669 3300011119 Bacteria 2411
59 Ga0157369_10024043 3300013105 Bacteria 6780
60 Ga0157369_10097099 3300013105 Bacteria 3143
61 Ga0157375_10094506 3300013308 Bacteria 3058
62 Ga0163163_10237606 3300014325 Unclassified 1872
63 Ga0157376_10032374 3300014969 Bacteria 4198
64 Ga0157376_10081917 3300014969 Bacteria 2772
65 Ga0213872_10015133 3300021361 Bacteria 3588
66 Ga0213872_10051307 3300021361 Bacteria 1872
67 Ga0209566_104232 3300025225 Bacteria 1994
68 Ga0209674_100011 3300025226 Bacteria 997175
69 Ga0209672_100002 3300025228 Bacteria 1733325
70 Ga0209147_100003 3300025229 Bacteria 1733325
71 Ga0209563_100267 3300025230 Bacteria 22683
72 Ga0207427_100540 3300025231 Bacteria 19616
73 Ga0209258_100005 3300025242 Bacteria 1087938
74 Ga0209646_1010177 3300025246 Bacteria 1478
75 Ga0209148_1000006 3300025254 Bacteria 1733325
76 Ga0209759_1000006 3300025256 Bacteria 492407
77 Ga0209233_1000018 3300025261 Bacteria 886857
78 Ga0209233_1004512 3300025261 Bacteria 4722
79 Ga0209455_1000003 3300025272 Bacteria 1471893
80 Ga0207426_1000018 3300025302 Bacteria 566740
81 Ga0209051_1040229 3300025303 Bacteria 1678
82 Ga0209257_1000339 3300025304 Bacteria 97703
83 Ga0207692_10013309 3300025898 Bacteria 3565
84 Ga0207680_10020438 3300025903 Bacteria 3563
85 Ga0207647_10063144 3300025904 Bacteria 2254
86 Ga0207685_10018057 3300025905 Bacteria 2295
87 Ga0207685_10123354 3300025905 Bacteria 1140
88 Ga0207699_10197616 3300025906 Bacteria 1361
89 Ga0207684_10005531 3300025910 Bacteria 11638
90 Ga0207695_10098062 3300025913 Bacteria 2930
91 Ga0207695_10227619 3300025913 Bacteria 1770
92 Ga0207693_10001714 3300025915 Bacteria 19288
93 Ga0207693_10056911 3300025915 Bacteria 3065
94 Ga0207663_10114237 3300025916 Bacteria 1837
95 Ga0207687_10354676 3300025927 Bacteria 1196
96 Ga0207700_10365299 3300025928 Bacteria 1259
97 Ga0207686_10081914 3300025934 Bacteria 2108
98 Ga0207709_10000059 3300025935 Bacteria 211914
99 Ga0207709_10166623 3300025935 Bacteria 1542
100 Ga0207669_10000341 3300025937 Bacteria 21234
101 Ga0207665_10021863 3300025939 Unclassified 4206
102 Ga0207651_10025891 3300025960 Bacteria 3654
103 Ga0207651_10087147 3300025960 Bacteria 2272
104 Ga0207668_10305204 3300025972 Bacteria 1315
105 Ga0207658_10039555 3300025986 Bacteria 3402
106 Ga0207648_10039322 3300026089 Bacteria 4159
107 Ga0207683_10002724 3300026121 Bacteria 15430
108 Ga0207683_10027275 3300026121 Bacteria 4935
109 Ga0207683_10069373 3300026121 Bacteria 3113
110 Ga0209588_1027050 3300027671 Bacteria 1824
111 Ga0268266_10004152 3300028379 Bacteria 13975
112 Ga0268266_10209174 3300028379 Bacteria 1788
113 Ga0268266_10231990 3300028379 Bacteria 1700
114 Ga0268266_10576722 3300028379 Bacteria 1079
115 Ga0268264_10092537 3300028381 Bacteria 2610
116 Ga0268264_10445165 3300028381 Bacteria 1254
117 Ga0307517_10041430 3300028786 Bacteria 4974
118 Ga0307511_10012511 3300030521 Bacteria 8324
119 Ga0307511_10038207 3300030521 Bacteria 4128
120 Ga0265760_10006449 3300031090 Bacteria 3355
121 Ga0307513_10091105 3300031456 Bacteria 3108
122 Ga0307406_10185923 3300031901 Bacteria 1517
123 Ga0307412_10000015 3300031911 Bacteria 333589
124 Ga0307412_10024851 3300031911 Bacteria 3703
125 Ga0307510_10053259 3300033180 Bacteria 4256
126 Ga0373945_0018644 3300035116 Bacteria 2362
127 Ga0373946_0036904 3300035171 Bacteria 1985
128 Ga0373927_0029109 3300035695 Bacteria 3599
129 Ga0373937_0026872 3300036401 Bacteria 5203
130 Ga0373925_0059810 3300037068 Bacteria 2859
131 Ga0395905_0000029 3300037471 Bacteria 293016
132 Ga0436364_0757138 3300037853 Unclassified 1070
133 Ga0436361_0812365 3300039447 Bacteria 7758
134 Ga0436361_0825148 3300039447 Unclassified 1694
135 Ga0436361_0971483 3300039447 Bacteria 1573
136 Ga0436361_0991207 3300039447 Bacteria 2292
137 Ga0453683_0142456 3300044673 Unclassified 1513
138 Ga0495603_0003865 3300046455 Bacteria 8916
139 Ga0495590_0022850 3300046457 Bacteria 2210
140 Ga0495629_0000042 3300046459 Bacteria 112605
141 Ga0495629_0011519 3300046459 Bacteria 6423
142 Ga0495638_0024063 3300046460 Bacteria 3975
143 Ga0495651_0049982 3300046462 Bacteria 3227
144 Ga0495653_0000227 3300046463 Bacteria 45855
145 Ga0495650_0000006 3300046471 Bacteria 721347
146 Ga0495650_0000440 3300046471 Bacteria 66809
147 Ga0495650_0006862 3300046471 Bacteria 7003
148 Ga0495650_0040184 3300046471 Bacteria 2011
149 Ga0495580_0000404 3300046472 Bacteria 35481
150 Ga0495580_0063504 3300046472 Bacteria 2589
151 Ga0495582_0035468 3300046473 Bacteria 2743
152 Ga0495605_0015852 3300046474 Bacteria 4092
153 Ga0495605_0060381 3300046474 Bacteria 1817
154 Ga0495664_0007438 3300046477 Bacteria 6083
155 Ga0495664_0091431 3300046477 Bacteria 1829
156 Ga0495664_0169012 3300046477 Bacteria 1327
157 Ga0495664_0257774 3300046477 Bacteria 1054
158 Ga0495585_0078459 3300046492 Bacteria 1791
159 Ga0495585_0106934 3300046492 Bacteria 1491
160 Ga0495594_0008639 3300046499 Bacteria 5248
161 Ga0495596_0008200 3300046500 Bacteria 4660
162 Ga0495596_0062494 3300046500 Bacteria 1449
163 Ga0495583_0000680 3300046506 Bacteria 44152
164 Ga0495583_0005191 3300046506 Bacteria 8965
165 Ga0495583_0030882 3300046506 Bacteria 2603
166 Ga0495583_0033542 3300046506 Bacteria 2469
167 Ga0495606_0079116 3300046507 Bacteria 2048
168 Ga0495606_0087078 3300046507 Bacteria 1929
169 Ga0495606_0118554 3300046507 Bacteria 1587
170 Ga0495608_0054819 3300046511 Bacteria 2635
171 Ga0495628_0007086 3300046516 Bacteria 9711
172 Ga0495630_0004054 3300046517 Bacteria 10260
173 Ga0495630_0065558 3300046517 Bacteria 2729
174 Ga0495631_0084103 3300046518 Bacteria 1371
175 Ga0495632_0106399 3300046519 Bacteria 1320
176 Ga0495644_0000059 3300046523 Bacteria 53320
177 Ga0495648_0019968 3300046524 Bacteria 4688
178 Ga0495648_0116265 3300046524 Bacteria 1445
179 Ga0495663_0029754 3300046525 Bacteria 1614
180 Ga0495666_0004296 3300046526 Bacteria 7191
181 Ga0495666_0058944 3300046526 Bacteria 1836
182 Ga0495642_0003785 3300046528 Bacteria 5923
183 Ga0495652_0015165 3300046529 Bacteria 6901
184 Ga0495665_0026209 3300046531 Bacteria 3131
185 Ga0495640_0002713 3300046533 Bacteria 14237
186 Ga0495640_0039812 3300046533 Bacteria 3296
187 Ga0495586_0098331 3300046535 Bacteria 1622
188 Ga0495609_0019945 3300046538 Bacteria 3100
189 Ga0495645_0033429 3300046543 Bacteria 3752
190 Ga0495645_0149370 3300046543 Bacteria 1625
191 Ga0495645_0172875 3300046543 Bacteria 1486
192 Ga0495622_0046725 3300046557 Bacteria 2011
193 Ga0495622_0071521 3300046557 Bacteria 1601
194 Ga0495633_0000391 3300046558 Bacteria 46143
195 Ga0495667_0110933 3300046559 Bacteria 1772
196 Ga0495668_0011625 3300046616 Bacteria 5264
197 Ga0495625_0020899 3300046660 Bacteria 5047
198 Ga0495625_0031368 3300046660 Bacteria 3954
199 Ga0495625_0364394 3300046660 Bacteria 910
200 Ga0495635_0010347 3300046663 Bacteria 6523
201 Ga0495661_0016478 3300046665 Bacteria 4897
202 Ga0495661_0028248 3300046665 Bacteria 3594
203 Ga0495588_0139557 3300046674 Bacteria 1280
204 Ga0495599_0024924 3300046678 Bacteria 3741
205 Ga0495623_0089960 3300046679 Bacteria 1885
206 Ga0495646_0003586 3300046680 Bacteria 9685
207 Ga0495646_0071066 3300046680 Bacteria 2048
208 Ga0495669_0014333 3300046684 Bacteria 3389
209 Ga0495613_0337268 3300046689 Bacteria 1038
210 Ga0495624_0000075 3300046690 Bacteria 64684
211 Ga0495589_0107898 3300046794 Bacteria 1345
212 Ga0495600_0014630 3300046809 Bacteria 4946
213 Ga0495600_0048566 3300046809 Bacteria 2768
214 Ga0495581_0007582 3300047315 Bacteria 6273
215 Ga0495604_0060604 3300047317 Bacteria 2897
216 Ga0495674_0000817 3300047319 Bacteria 29701
217 Ga0495674_0002973 3300047319 Bacteria 16495
218 Ga0495674_0030157 3300047319 Bacteria 4934
219 Ga0495674_0092235 3300047319 Bacteria 2586
220 Ga0495672_0076063 3300047320 Bacteria 1886
221 Ga0495683_0006880 3300047323 Bacteria 6181
222 Ga0495683_0026843 3300047323 Bacteria 2947
223 Ga0495683_0033292 3300047323 Bacteria 2623
224 Ga0495687_000563 3300047443 Bacteria 43682
225 Ga0495687_001807 3300047443 Bacteria 18813
226 Ga0495687_016803 3300047443 Bacteria 3670
227 Ga0495675_0006764 3300047444 Bacteria 7032
228 Ga0495677_0025271 3300047445 Bacteria 2155
229 Ga0495679_000023 3300047446 Bacteria 209366
230 Ga0495673_0105065 3300047469 Bacteria 1136
231 Ga0495681_0005777 3300047470 Bacteria 8224
232 Ga0495684_0008008 3300047471 Bacteria 8170
233 Ga0495686_0000178 3300047472 Bacteria 121468
234 Ga0495686_0000950 3300047472 Bacteria 35845
235 Ga0495593_0000779 3300047673 Bacteria 18532
236 Ga0495614_0020833 3300048089 Bacteria 2834
237 Ga0495626_0009119 3300048091 Bacteria 5378
238 Ga0495626_0035121 3300048091 Bacteria 2394
239 Ga0496100_0058239 3300048903 Bacteria 2534
240 Ga0496100_0080897 3300048903 Bacteria 2193
241 Ga0496101_0032788 3300048904 Bacteria 3659
242 Ga0496102_0015149 3300048905 Bacteria 6713
243 Ga0496102_0142852 3300048905 Bacteria 2245
244 Ga0496102_0206858 3300048905 Bacteria 1850
245 Ga0496103_0001865 3300048906 Bacteria 13700
246 Ga0496104_0025311 3300048907 Bacteria 5470
247 Ga0496104_0206001 3300048907 Bacteria 1878
248 Ga0496104_0272997 3300048907 Bacteria 1604
249 Ga0496105_0037854 3300048908 Bacteria 3973
250 Ga0496105_0099349 3300048908 Bacteria 2403
251 Ga0496106_0086367 3300048909 Bacteria 2416
252 Ga0496106_0322830 3300048909 Bacteria 1239
253 Ga0496106_0328424 3300048909 Bacteria 1228
254 Ga0496107_0039058 3300048910 Bacteria 3405
255 Ga0496107_0123255 3300048910 Bacteria 1910
256 Ga0496108_0124650 3300048911 Bacteria 2211
257 Ga0496110_0088870 3300048913 Bacteria 2760
258 Ga0496110_0394917 3300048913 Bacteria 1261
259 Ga0496111_0033356 3300048914 Bacteria 3671
260 Ga0496112_0009576 3300048915 Bacteria 8738
261 Ga0496112_0044713 3300048915 Bacteria 4340
262 Ga0496112_0204817 3300048915 Bacteria 1931
263 Ga0496113_0004047 3300048916 Bacteria 8929
264 Ga0496114_0005048 3300048917 Bacteria 10292
265 Ga0496114_0021281 3300048917 Bacteria 5274
266 Ga0496114_0444069 3300048917 Bacteria 1149
267 Ga0496115_0000269 3300048918 Bacteria 45856
268 Ga0496115_0062589 3300048918 Bacteria 3002
269 Ga0496116_0006881 3300048919 Bacteria 10210
270 Ga0496117_0000887 3300048920 Bacteria 46091
271 Ga0496117_0086785 3300048920 Bacteria 2032
272 Ga0496117_0120029 3300048920 Bacteria 1617
273 Ga0496118_0002789 3300048921 Bacteria 22872
274 Ga0496118_0005843 3300048921 Bacteria 13797
275 Ga0496118_0008183 3300048921 Bacteria 10880
276 Ga0496119_0013385 3300048922 Bacteria 6544
277 Ga0496120_0025108 3300048923 Bacteria 3703
278 Ga0496121_0004850 3300048924 Bacteria 17692
279 Ga0496121_0007032 3300048924 Bacteria 13665
280 Ga0496121_0010111 3300048924 Bacteria 10696
281 Ga0496122_0034075 3300048925 Bacteria 4174
282 Ga0496123_0071388 3300048926 Bacteria 2166
283 Ga0496124_0000960 3300048927 Bacteria 45969
284 Ga0496125_0000956 3300048928 Bacteria 45452
285 Ga0496125_0189858 3300048928 Bacteria 1358
286 Ga0496126_0000031 3300048929 Bacteria 373371
287 Ga0496126_0000095 3300048929 Bacteria 207654
288 Ga0496126_0000321 3300048929 Bacteria 102445
289 Ga0496126_0005395 3300048929 Bacteria 14598
290 Ga0496126_0125014 3300048929 Bacteria 2227
291 Ga0496126_0134361 3300048929 Bacteria 2135
292 Ga0496126_0368491 3300048929 Bacteria 1172
293 Ga0500643_012001 3300053087 Bacteria 3124
294 Ga0500647_0121253 3300053091 Bacteria 1238
295 Ga0500583_0026206 3300053092 Bacteria 2500
296 Ga0500641_0004704 3300053096 Bacteria 4825
297 Ga0500555_000212 3300053103 Bacteria 27048
298 Ga0500595_002002 3300053119 Bacteria 10440
299 Ga0500607_116189 3300053121 Bacteria 1303
300 Ga0500642_0003133 3300053130 Bacteria 4962
301 Ga0500655_025633 3300053133 Bacteria 1119
302 Ga0500568_0000872 3300053139 Bacteria 21157
303 Ga0500616_0000483 3300053153 Bacteria 51655
304 Ga0500616_0001877 3300053153 Bacteria 18928
305 Ga0500645_014885 3300053730 Bacteria 2473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046526 Ga0495666_0058944 Ga0495666_0058944_842_1819 290
2 3300048091 Ga0495626_0035121 Ga0495626_0035121_240_1259 290
3 3300046660 Ga0495625_0364394 Ga0495625_0364394_12_890 292
4 3300046455 Ga0495603_0003865 Ga0495603_0003865_1268_2287 293
5 3300046457 Ga0495590_0022850 Ga0495590_0022850_721_1740 293
6 3300046472 Ga0495580_0063504 Ga0495580_0063504_947_1966 293
7 3300046506 Ga0495583_0030882 Ga0495583_0030882_1336_2355 293
8 3300046557 Ga0495622_0071521 Ga0495622_0071521_550_1569 293
9 3300046558 Ga0495633_0000391 Ga0495633_0000391_11323_12294 293
10 3300047443 Ga0495687_016803 Ga0495687_016803_2068_3087 293
11 3300048907 Ga0496104_0025311 Ga0496104_0025311_1781_2800 293
12 3300046518 Ga0495631_0084103 Ga0495631_0084103_75_1046 294
13 3300046524 Ga0495648_0019968 Ga0495648_0019968_377_1396 294
14 3300046535 Ga0495586_0098331 Ga0495586_0098331_702_1586 294
15 3300047319 Ga0495674_0002973 Ga0495674_0002973_15005_16024 294
16 3300047445 Ga0495677_0025271 Ga0495677_0025271_102_1121 294
17 3300048903 Ga0496100_0080897 Ga0496100_0080897_701_1720 294
18 3300048904 Ga0496101_0032788 Ga0496101_0032788_1719_2738 294
19 3300048905 Ga0496102_0015149 Ga0496102_0015149_1174_2145 294
20 3300048906 Ga0496103_0001865 Ga0496103_0001865_11578_12549 294
21 3300048907 Ga0496104_0206001 Ga0496104_0206001_842_1813 294
22 3300048908 Ga0496105_0099349 Ga0496105_0099349_276_1247 294
23 3300048909 Ga0496106_0086367 Ga0496106_0086367_915_1934 294
24 3300048914 Ga0496111_0033356 Ga0496111_0033356_1709_2680 294
25 3300048915 Ga0496112_0204817 Ga0496112_0204817_741_1712 294
26 3300048917 Ga0496114_0005048 Ga0496114_0005048_825_1796 294
27 3300048918 Ga0496115_0000269 Ga0496115_0000269_43735_44706 294
28 3300048918 Ga0496115_0062589 Ga0496115_0062589_745_1764 294
29 3300048919 Ga0496116_0006881 Ga0496116_0006881_8075_9046 294
30 3300048920 Ga0496117_0000887 Ga0496117_0000887_43966_44937 294
31 3300048921 Ga0496118_0005843 Ga0496118_0005843_1157_2128 294
32 3300048922 Ga0496119_0013385 Ga0496119_0013385_1139_2110 294
33 3300048923 Ga0496120_0025108 Ga0496120_0025108_2079_3050 294
34 3300048924 Ga0496121_0004850 Ga0496121_0004850_1149_2120 294
35 3300048924 Ga0496121_0010111 Ga0496121_0010111_7817_8836 294
36 3300048925 Ga0496122_0034075 Ga0496122_0034075_1111_2082 294
37 3300048926 Ga0496123_0071388 Ga0496123_0071388_86_1057 294
38 3300048927 Ga0496124_0000960 Ga0496124_0000960_1162_2133 294
39 3300048928 Ga0496125_0000956 Ga0496125_0000956_1151_2122 294
40 3300048929 Ga0496126_0000321 Ga0496126_0000321_57581_58552 294
41 3300025904 Ga0207647_10063144 Ga0207647_100631442 295
42 3300003354 JGI25160J50197_1000127 JGI25160J50197_100012746 296
43 3300005262 Ga0065165_1000419 Ga0065165_100041916 296
44 3300025302 Ga0207426_1000018 Ga0207426_1000018425 296
45 3300046492 Ga0495585_0106934 Ga0495585_0106934_398_1366 297
46 3300046660 Ga0495625_0031368 Ga0495625_0031368_1256_2224 298
47 3300047470 Ga0495681_0005777 Ga0495681_0005777_3964_4935 303
48 3300046471 Ga0495650_0006862 Ga0495650_0006862_3934_4911 305
49 3300005347 Ga0070668_100204355 Ga0070668_1002043551 309
50 3300005366 Ga0070659_100049973 Ga0070659_1000499731 309
51 3300025972 Ga0207668_10305204 Ga0207668_103052041 309
52 3300053130 Ga0500642_0003133 Ga0500642_0003133_37_1008 309
53 3300005467 Ga0070706_100069754 Ga0070706_1000697543 311
54 3300005471 Ga0070698_100148821 Ga0070698_1001488213 311
55 3300025910 Ga0207684_10005531 Ga0207684_100055313 311
56 3300028379 Ga0268266_10209174 Ga0268266_102091742 311
57 3300046794 Ga0495589_0107898 Ga0495589_0107898_23_961 312
58 3300025261 Ga0209233_1004512 Ga0209233_10045122 313
59 3300025913 Ga0207695_10098062 Ga0207695_100980622 313
60 3300031911 Ga0307412_10024851 Ga0307412_100248514 313
61 3300048928 Ga0496125_0189858 Ga0496125_0189858_358_1335 313
62 3300053153 Ga0500616_0000483 Ga0500616_0000483_36285_37289 317
63 3300046616 Ga0495668_0011625 Ga0495668_0011625_522_1577 318
64 3300046684 Ga0495669_0014333 Ga0495669_0014333_808_1863 318
65 3300048913 Ga0496110_0394917 Ga0496110_0394917_12_1031 318
66 3300048915 Ga0496112_0009576 Ga0496112_0009576_4338_5357 318
67 3300048916 Ga0496113_0004047 Ga0496113_0004047_3679_4698 318
68 3300048917 Ga0496114_0444069 Ga0496114_0444069_157_1134 318
69 3300005985 Ga0081539_10018549 Ga0081539_100185495 320
70 3300031901 Ga0307406_10185923 Ga0307406_101859232 320
71 3300053139 Ga0500568_0000872 Ga0500568_0000872_19439_20401 320
72 3300002244 JGI24742J22300_10020669 JGI24742J22300_100206691 321
73 3300003756 Ga0055533_1000070 Ga0055533_100007052 321
74 3300003758 Ga0055532_1000011 Ga0055532_1000011317 321
75 3300003760 Ga0055527_1000009 Ga0055527_1000009316 321
76 3300003761 Ga0055535_1000008 Ga0055535_100000851 321
77 3300003762 Ga0055542_1000014 Ga0055542_100001451 321
78 3300003763 Ga0055529_1000010 Ga0055529_100001051 321
79 3300005356 Ga0070674_100002420 Ga0070674_1000024206 321
80 3300005364 Ga0070673_100256543 Ga0070673_1002565431 321
81 3300005456 Ga0070678_100001482 Ga0070678_10000148213 321
82 3300005456 Ga0070678_100175315 Ga0070678_1001753152 321
83 3300011119 Ga0105246_10073669 Ga0105246_100736693 321
84 3300025225 Ga0209566_104232 Ga0209566_1042322 321
85 3300025226 Ga0209674_100011 Ga0209674_100011597 321
86 3300025228 Ga0209672_100002 Ga0209672_100002593 321
87 3300025229 Ga0209147_100003 Ga0209147_100003593 321
88 3300025230 Ga0209563_100267 Ga0209563_1002674 321
89 3300025242 Ga0209258_100005 Ga0209258_100005234 321
90 3300025254 Ga0209148_1000006 Ga0209148_1000006593 321
91 3300025272 Ga0209455_1000003 Ga0209455_1000003593 321
92 3300025935 Ga0207709_10000059 Ga0207709_1000005975 321
93 3300025937 Ga0207669_10000341 Ga0207669_1000034122 321
94 3300025960 Ga0207651_10025891 Ga0207651_100258912 321
95 3300025986 Ga0207658_10039555 Ga0207658_100395554 321
96 3300026089 Ga0207648_10039322 Ga0207648_100393221 321
97 3300026121 Ga0207683_10002724 Ga0207683_100027246 321
98 3300026121 Ga0207683_10069373 Ga0207683_100693732 321
99 3300028381 Ga0268264_10092537 Ga0268264_100925373 321
100 3300028786 Ga0307517_10041430 Ga0307517_100414302 321
101 3300031456 Ga0307513_10091105 Ga0307513_100911052 321
102 3300046471 Ga0495650_0000440 Ga0495650_0000440_24630_25595 321
103 3300046506 Ga0495583_0000680 Ga0495583_0000680_1668_2633 321
104 3300046524 Ga0495648_0116265 Ga0495648_0116265_136_1107 321
105 3300046557 Ga0495622_0046725 Ga0495622_0046725_895_1860 321
106 3300046809 Ga0495600_0048566 Ga0495600_0048566_1591_2556 321
107 3300047443 Ga0495687_000563 Ga0495687_000563_1315_2286 321
108 3300053091 Ga0500647_0121253 Ga0500647_0121253_146_1111 321
109 3300053119 Ga0500595_002002 Ga0500595_002002_8342_9307 321
110 3300053121 Ga0500607_116189 Ga0500607_116189_24_989 321
111 3300053133 Ga0500655_025633 Ga0500655_025633_110_1075 321
112 3300053730 Ga0500645_014885 Ga0500645_014885_1439_2404 321
113 iso_pu_bacteria 2562617112 2563056655 321
114 iso_pu_bacteria 2711768613 2713481336 321
115 iso_pu_bacteria 2909399089 2909399101 322
116 iso_pu_bacteria 641228493 641336730 322
117 iso_pu_bacteria 643348555 643390571 322
118 3300003794 Ga0055531_10028653 Ga0055531_100286531 323
119 3300009177 Ga0105248_10034525 Ga0105248_100345255 323
120 3300025303 Ga0209051_1040229 Ga0209051_10402292 323
121 3300025304 Ga0209257_1000339 Ga0209257_100033967 323
122 3300028379 Ga0268266_10004152 Ga0268266_100041528 323
123 3300033180 Ga0307510_10053259 Ga0307510_100532593 323
124 3300046471 Ga0495650_0000006 Ga0495650_0000006_237838_238809 323
125 3300046665 Ga0495661_0028248 Ga0495661_0028248_1654_2625 323
126 3300048929 Ga0496126_0368491 Ga0496126_0368491_150_1121 323
127 3300053087 Ga0500643_012001 Ga0500643_012001_589_1560 323
128 3300005335 Ga0070666_10015132 Ga0070666_100151322 324
129 3300005544 Ga0070686_100124388 Ga0070686_1001243882 324
130 3300025903 Ga0207680_10020438 Ga0207680_100204382 324
131 3300046525 Ga0495663_0029754 Ga0495663_0029754_481_1461 324
132 3300047472 Ga0495686_0000178 Ga0495686_0000178_97670_98644 324
133 3300047472 Ga0495686_0000950 Ga0495686_0000950_32401_33375 324
134 3300048929 Ga0496126_0000095 Ga0496126_0000095_155504_156478 324
135 3300053096 Ga0500641_0004704 Ga0500641_0004704_2879_3868 324
136 3300053153 Ga0500616_0001877 Ga0500616_0001877_188_1177 324
137 3300003320 rootH2_10008213 rootH2_100082132 325
138 3300005330 Ga0070690_100029459 Ga0070690_1000294593 325
139 3300005330 Ga0070690_100187220 Ga0070690_1001872202 325
140 3300005364 Ga0070673_100047828 Ga0070673_1000478282 325
141 3300005367 Ga0070667_100028557 Ga0070667_1000285573 325
142 3300005434 Ga0070709_10122452 Ga0070709_101224522 325
143 3300005436 Ga0070713_100243461 Ga0070713_1002434611 325
144 3300005437 Ga0070710_10003149 Ga0070710_100031491 325
145 3300005439 Ga0070711_100041551 Ga0070711_1000415511 325
146 3300005439 Ga0070711_100074137 Ga0070711_1000741373 325
147 3300005440 Ga0070705_100015157 Ga0070705_1000151573 325
148 3300005456 Ga0070678_100066610 Ga0070678_1000666102 325
149 3300005467 Ga0070706_100045672 Ga0070706_1000456723 325
150 3300005614 Ga0068856_100019031 Ga0068856_1000190312 325
151 3300005718 Ga0068866_10023326 Ga0068866_100233262 325
152 3300006163 Ga0070715_10005050 Ga0070715_100050502 325
153 3300006175 Ga0070712_100034457 Ga0070712_1000344572 325
154 3300007265 Ga0099794_10010112 Ga0099794_100101123 325
155 3300009093 Ga0105240_10129746 Ga0105240_101297462 325
156 3300009148 Ga0105243_10020276 Ga0105243_100202761 325
157 3300009174 Ga0105241_10018699 Ga0105241_100186994 325
158 3300009177 Ga0105248_10039849 Ga0105248_100398493 325
159 3300009545 Ga0105237_10022702 Ga0105237_100227024 325
160 3300009545 Ga0105237_10193327 Ga0105237_101933273 325
161 3300010375 Ga0105239_10031358 Ga0105239_100313584 325
162 3300010375 Ga0105239_10307042 Ga0105239_103070422 325
163 3300013308 Ga0157375_10094506 Ga0157375_100945062 325
164 3300014325 Ga0163163_10237606 Ga0163163_102376062 325
165 3300014969 Ga0157376_10032374 Ga0157376_100323743 325
166 3300014969 Ga0157376_10081917 Ga0157376_100819172 325
167 3300021361 Ga0213872_10051307 Ga0213872_100513072 325
168 3300025898 Ga0207692_10013309 Ga0207692_100133092 325
169 3300025905 Ga0207685_10018057 Ga0207685_100180572 325
170 3300025905 Ga0207685_10123354 Ga0207685_101233541 325
171 3300025906 Ga0207699_10197616 Ga0207699_101976161 325
172 3300025913 Ga0207695_10227619 Ga0207695_102276192 325
173 3300025915 Ga0207693_10001714 Ga0207693_100017147 325
174 3300025915 Ga0207693_10056911 Ga0207693_100569113 325
175 3300025916 Ga0207663_10114237 Ga0207663_101142372 325
176 3300025927 Ga0207687_10354676 Ga0207687_103546761 325
177 3300025928 Ga0207700_10365299 Ga0207700_103652992 325
178 3300025934 Ga0207686_10081914 Ga0207686_100819142 325
179 3300025935 Ga0207709_10166623 Ga0207709_101666232 325
180 3300025939 Ga0207665_10021863 Ga0207665_100218633 325
181 3300025960 Ga0207651_10087147 Ga0207651_100871472 325
182 3300026121 Ga0207683_10027275 Ga0207683_100272752 325
183 3300027671 Ga0209588_1027050 Ga0209588_10270501 325
184 3300030521 Ga0307511_10012511 Ga0307511_100125114 325
185 3300031090 Ga0265760_10006449 Ga0265760_100064494 325
186 3300035116 Ga0373945_0018644 Ga0373945_0018644_414_1391 325
187 3300035171 Ga0373946_0036904 Ga0373946_0036904_722_1699 325
188 3300035695 Ga0373927_0029109 Ga0373927_0029109_2065_3042 325
189 3300036401 Ga0373937_0026872 Ga0373937_0026872_3843_4820 325
190 3300037068 Ga0373925_0059810 Ga0373925_0059810_856_1833 325
191 3300037471 Ga0395905_0000029 Ga0395905_0000029_83197_84174 325
192 3300037853 Ga0436364_0757138 Ga0436364_0757138_40_1017 325
193 3300039447 Ga0436361_0825148 Ga0436361_0825148_554_1531 325
194 3300039447 Ga0436361_0971483 Ga0436361_0971483_496_1473 325
195 3300039447 Ga0436361_0991207 Ga0436361_0991207_1105_2082 325
196 3300046459 Ga0495629_0000042 Ga0495629_0000042_98185_99162 325
197 3300046460 Ga0495638_0024063 Ga0495638_0024063_2465_3442 325
198 3300046463 Ga0495653_0000227 Ga0495653_0000227_34799_35776 325
199 3300046471 Ga0495650_0040184 Ga0495650_0040184_182_1159 325
200 3300046474 Ga0495605_0060381 Ga0495605_0060381_736_1713 325
201 3300046477 Ga0495664_0169012 Ga0495664_0169012_107_1084 325
202 3300046477 Ga0495664_0257774 Ga0495664_0257774_10_987 325
203 3300046492 Ga0495585_0078459 Ga0495585_0078459_237_1256 325
204 3300046499 Ga0495594_0008639 Ga0495594_0008639_3597_4616 325
205 3300046500 Ga0495596_0062494 Ga0495596_0062494_136_1155 325
206 3300046506 Ga0495583_0005191 Ga0495583_0005191_7680_8657 325
207 3300046506 Ga0495583_0033542 Ga0495583_0033542_233_1252 325
208 3300046507 Ga0495606_0079116 Ga0495606_0079116_309_1286 325
209 3300046516 Ga0495628_0007086 Ga0495628_0007086_7552_8529 325
210 3300046517 Ga0495630_0004054 Ga0495630_0004054_947_1924 325
211 3300046519 Ga0495632_0106399 Ga0495632_0106399_232_1209 325
212 3300046523 Ga0495644_0000059 Ga0495644_0000059_25849_26868 325
213 3300046528 Ga0495642_0003785 Ga0495642_0003785_3685_4704 325
214 3300046533 Ga0495640_0039812 Ga0495640_0039812_1814_2791 325
215 3300046538 Ga0495609_0019945 Ga0495609_0019945_1284_2303 325
216 3300046543 Ga0495645_0172875 Ga0495645_0172875_183_1160 325
217 3300046660 Ga0495625_0020899 Ga0495625_0020899_685_1704 325
218 3300046665 Ga0495661_0016478 Ga0495661_0016478_3070_4047 325
219 3300046674 Ga0495588_0139557 Ga0495588_0139557_109_1086 325
220 3300046680 Ga0495646_0003586 Ga0495646_0003586_7883_8860 325
221 3300046690 Ga0495624_0000075 Ga0495624_0000075_49922_50899 325
222 3300047319 Ga0495674_0000817 Ga0495674_0000817_718_1695 325
223 3300047319 Ga0495674_0030157 Ga0495674_0030157_2771_3748 325
224 3300047320 Ga0495672_0076063 Ga0495672_0076063_791_1768 325
225 3300047323 Ga0495683_0026843 Ga0495683_0026843_373_1392 325
226 3300047323 Ga0495683_0033292 Ga0495683_0033292_125_1102 325
227 3300047446 Ga0495679_000023 Ga0495679_000023_114829_115806 325
228 3300047469 Ga0495673_0105065 Ga0495673_0105065_16_1035 325
229 3300047471 Ga0495684_0008008 Ga0495684_0008008_1304_2281 325
230 3300047673 Ga0495593_0000779 Ga0495593_0000779_534_1511 325
231 3300048089 Ga0495614_0020833 Ga0495614_0020833_107_1084 325
232 3300048903 Ga0496100_0058239 Ga0496100_0058239_870_1847 325
233 3300048905 Ga0496102_0142852 Ga0496102_0142852_32_1009 325
234 3300048905 Ga0496102_0206858 Ga0496102_0206858_389_1372 325
235 3300048907 Ga0496104_0272997 Ga0496104_0272997_540_1517 325
236 3300048908 Ga0496105_0037854 Ga0496105_0037854_2165_3142 325
237 3300048909 Ga0496106_0322830 Ga0496106_0322830_182_1159 325
238 3300048909 Ga0496106_0328424 Ga0496106_0328424_88_1071 325
239 3300048910 Ga0496107_0039058 Ga0496107_0039058_183_1160 325
240 3300048910 Ga0496107_0123255 Ga0496107_0123255_69_1052 325
241 3300048911 Ga0496108_0124650 Ga0496108_0124650_826_1803 325
242 3300048913 Ga0496110_0088870 Ga0496110_0088870_1703_2680 325
243 3300048915 Ga0496112_0044713 Ga0496112_0044713_1003_1980 325
244 3300048917 Ga0496114_0021281 Ga0496114_0021281_2544_3521 325
245 3300048920 Ga0496117_0120029 Ga0496117_0120029_121_1098 325
246 3300048921 Ga0496118_0002789 Ga0496118_0002789_17387_18364 325
247 3300048924 Ga0496121_0007032 Ga0496121_0007032_994_1971 325
248 3300048929 Ga0496126_0000031 Ga0496126_0000031_38259_39305 325
249 3300048929 Ga0496126_0005395 Ga0496126_0005395_9020_9997 325
250 3300048929 Ga0496126_0125014 Ga0496126_0125014_657_1634 325
251 3300048929 Ga0496126_0134361 Ga0496126_0134361_715_1701 325
252 3300053092 Ga0500583_0026206 Ga0500583_0026206_783_1760 325
253 3300053103 Ga0500555_000212 Ga0500555_000212_21107_22225 325
254 iso_pu_bacteria 2600255067 2600815317 325
255 iso_pu_bacteria 2904483920 2904486341 325
256 iso_pu_bacteria 2919527303 2919527686 325
257 3300005548 Ga0070665_100557487 Ga0070665_1005574871 326
258 3300028379 Ga0268266_10576722 Ga0268266_105767221 326
259 3300028381 Ga0268264_10445165 Ga0268264_104451651 326
260 3300030521 Ga0307511_10038207 Ga0307511_100382072 326
261 3300044673 Ga0453683_0142456 Ga0453683_0142456_176_1156 326
262 3300046472 Ga0495580_0000404 Ga0495580_0000404_8912_9937 326
263 3300021361 Ga0213872_10015133 Ga0213872_100151332 327
264 3300039447 Ga0436361_0812365 Ga0436361_0812365_4976_5959 327
265 3300001979 JGI24740J21852_10003504 JGI24740J21852_1000350410 329
266 3300001989 JGI24739J22299_10013088 JGI24739J22299_100130882 329
267 3300002067 JGI24735J21928_10001033 JGI24735J21928_100010339 329
268 3300002075 JGI24738J21930_10000060 JGI24738J21930_1000006010 329
269 3300002705 JGI25156J39149_1000578 JGI25156J39149_100057810 329
270 3300003214 JGI25165J46597_1000396 JGI25165J46597_100039638 329
271 3300005548 Ga0070665_100090596 Ga0070665_1000905962 329
272 3300009093 Ga0105240_10023272 Ga0105240_1002327211 329
273 3300013105 Ga0157369_10024043 Ga0157369_100240436 329
274 3300013105 Ga0157369_10097099 Ga0157369_100970994 329
275 3300025231 Ga0207427_100540 Ga0207427_1005408 329
276 3300025246 Ga0209646_1010177 Ga0209646_10101771 329
277 3300025256 Ga0209759_1000006 Ga0209759_1000006403 329
278 3300025261 Ga0209233_1000018 Ga0209233_1000018761 329
279 3300028379 Ga0268266_10231990 Ga0268266_102319902 329
280 3300031911 Ga0307412_10000015 Ga0307412_100000159 329
281 3300046459 Ga0495629_0011519 Ga0495629_0011519_4304_5293 329
282 3300046462 Ga0495651_0049982 Ga0495651_0049982_201_1190 329
283 3300046473 Ga0495582_0035468 Ga0495582_0035468_759_1748 329
284 3300046474 Ga0495605_0015852 Ga0495605_0015852_2228_3217 329
285 3300046477 Ga0495664_0007438 Ga0495664_0007438_1531_2520 329
286 3300046477 Ga0495664_0091431 Ga0495664_0091431_14_1003 329
287 3300046500 Ga0495596_0008200 Ga0495596_0008200_297_1286 329
288 3300046507 Ga0495606_0087078 Ga0495606_0087078_671_1660 329
289 3300046507 Ga0495606_0118554 Ga0495606_0118554_197_1186 329
290 3300046511 Ga0495608_0054819 Ga0495608_0054819_652_1641 329
291 3300046517 Ga0495630_0065558 Ga0495630_0065558_1727_2716 329
292 3300046526 Ga0495666_0004296 Ga0495666_0004296_3642_4631 329
293 3300046529 Ga0495652_0015165 Ga0495652_0015165_3648_4637 329
294 3300046531 Ga0495665_0026209 Ga0495665_0026209_525_1514 329
295 3300046533 Ga0495640_0002713 Ga0495640_0002713_9327_10316 329
296 3300046543 Ga0495645_0033429 Ga0495645_0033429_179_1168 329
297 3300046543 Ga0495645_0149370 Ga0495645_0149370_182_1171 329
298 3300046559 Ga0495667_0110933 Ga0495667_0110933_119_1108 329
299 3300046663 Ga0495635_0010347 Ga0495635_0010347_3110_4099 329
300 3300046678 Ga0495599_0024924 Ga0495599_0024924_391_1383 329
301 3300046679 Ga0495623_0089960 Ga0495623_0089960_13_1002 329
302 3300046680 Ga0495646_0071066 Ga0495646_0071066_387_1376 329
303 3300046689 Ga0495613_0337268 Ga0495613_0337268_29_1018 329
304 3300046809 Ga0495600_0014630 Ga0495600_0014630_3151_4140 329
305 3300047315 Ga0495581_0007582 Ga0495581_0007582_3377_4366 329
306 3300047317 Ga0495604_0060604 Ga0495604_0060604_1132_2124 329
307 3300047319 Ga0495674_0092235 Ga0495674_0092235_303_1292 329
308 3300047323 Ga0495683_0006880 Ga0495683_0006880_1944_2933 329
309 3300047443 Ga0495687_001807 Ga0495687_001807_3738_4727 329
310 3300047444 Ga0495675_0006764 Ga0495675_0006764_4119_5108 329
311 3300048091 Ga0495626_0009119 Ga0495626_0009119_3318_4307 329
312 3300048920 Ga0496117_0086785 Ga0496117_0086785_766_1755 329
313 3300048921 Ga0496118_0008183 Ga0496118_0008183_2738_3727 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

23

216

0.92

PF08659

KR

KR domain

24

131

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

233

0.82

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

25

241

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8671 8 326
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8578 8 326
4i5g-assembly1.cif.gz_C crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s, a86n, s88a 0.8551 19 279
1ahi-assembly1.cif.gz_A 7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid 0.8416 19 279
4i5f-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s 0.8333 19 279
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9546 23 54 3.50.50.60
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.938 22 54 3.50.50.60
af_Q95QH4_36_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9243 22 218 3.40.50.720
af_E9AH88_143_327_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9088 20 191 3.40.50.720
af_A8WG01_1_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9073 52 325 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W5HAD1-F1-model_v4 deleted 0.9587 8 153
AF-A0A485HJB4-F1-model_v4 deleted 0.9563 19 211
AF-A0A7K2YNL0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9537 6 179
AF-A0A1W1YL65-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9502 1 283
AF-A0A665WFJ7-F1-model_v4 Retinol dehydrogenase 12-like 0.9493 19 204 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.86 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map