F401689

General Info

Members Datasets Scaffolds Average Seq Length
312 161 624 273

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10515720|Ga0105237_105157201
Length 319
Sequence MPLSLDYFNKFKSLLQYTDKIIHYYTTFFIFFRGPVKLFLIVNQFNMTTTVSNLPGLNDLKATSAENIQEFAEKGHTLVRNILSPEEIAVYRPVIVDAAERYNTEKRKMQDRDTYGKAFLQIMNLWRVDEAVKRFVMSKRLGKIAADLLGVENVRIYHDQALFKEAGGGPTPWHQDQYYWPIDTNNTITMWMPLVDIDVDMGMLTFASGSYDKGSIFDYEISDESESAFDDYVRDNKFPISRATTMKAGDATFHRGFTIHNAPGNNSDKMREVMTIIYLADGARVSEPKNEWQKNDLAKWMMSKPVGELIDSELNPKVL

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
98 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
99 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
144 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
145 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
146 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
147 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
151 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
152 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
153 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
154 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
155 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
156 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
157 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
158 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
159 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
160 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
161 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 0
Isolates 3.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.09
Nodule 0
Rhizoplane 0.32
Rhizosphere 86.22
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10515720 3300009545 Bacteria 1202
2 JGI24741J21665_1012409 3300001915 Bacteria 1465
3 JGI24740J21852_10005935 3300001979 Bacteria 5114
4 JGI24737J22298_10000628 3300001990 Bacteria 12434
5 JGI24735J21928_10000031 3300002067 Bacteria 75354
6 rootH1_10030138 3300003316 Bacteria 9704
7 rootH2_10007197 3300003320 Bacteria 152995
8 rootH2_10084556 3300003320 Bacteria 3312
9 rootH2_10095015 3300003320 Bacteria 5078
10 rootH2_10098509 3300003320 Bacteria 1791
11 rootH2_10098510 3300003320 Bacteria 1797
12 rootL2_10114256 3300003322 Bacteria 4261
13 rootL2_10121379 3300003322 Bacteria 3433
14 rootL2_10188514 3300003322 Bacteria 3352
15 rootH1_10048873 3300003323 Bacteria 5046
16 rootH1_10069140 3300003323 Bacteria 4938
17 rootH1_10114082 3300003323 Bacteria 3445
18 rootH1_10117575 3300003323 Bacteria 8177
19 JGI25160J50197_1001449 3300003354 Bacteria 11859
20 Ga0055531_10000061 3300003794 Bacteria 120535
21 Ga0065714_10086018 3300005288 Bacteria 2120
22 Ga0065704_10002530 3300005289 Bacteria 5199
23 Ga0065704_10003015 3300005289 Bacteria 4454
24 Ga0070658_10000340 3300005327 Bacteria 40349
25 Ga0070658_10025860 3300005327 Bacteria 4707
26 Ga0070658_10093217 3300005327 Bacteria 2484
27 Ga0070658_10133009 3300005327 Bacteria 2074
28 Ga0070676_10000474 3300005328 Bacteria 19238
29 Ga0070680_100009468 3300005336 Bacteria 7484
30 Ga0068868_100041639 3300005338 Bacteria 3579
31 Ga0068868_100043049 3300005338 Bacteria 3527
32 Ga0068868_100049543 3300005338 Bacteria 3296
33 Ga0070660_100009269 3300005339 Bacteria 6918
34 Ga0070660_100011814 3300005339 Bacteria 6221
35 Ga0070660_100152718 3300005339 Bacteria 1857
36 Ga0070671_100011572 3300005355 Bacteria 7097
37 Ga0070673_100000361 3300005364 Bacteria 23757
38 Ga0070659_100068344 3300005366 Bacteria 2818
39 Ga0070659_100235840 3300005366 Bacteria 1512
40 Ga0070667_100646310 3300005367 Unclassified 976
41 Ga0070678_100003672 3300005456 Bacteria 8577
42 Ga0070662_100000046 3300005457 Bacteria 67592
43 Ga0070681_10042192 3300005458 Bacteria 4572
44 Ga0068867_100001280 3300005459 Bacteria 17355
45 Ga0070679_100000435 3300005530 Bacteria 35484
46 Ga0070679_100038423 3300005530 Bacteria 4759
47 Ga0070679_100041864 3300005530 Bacteria 4560
48 Ga0070679_100144895 3300005530 Unclassified 2353
49 Ga0068853_100041626 3300005539 Bacteria 3926
50 Ga0070665_100000012 3300005548 Bacteria 508937
51 Ga0070665_100000196 3300005548 Bacteria 106415
52 Ga0068855_100009280 3300005563 Bacteria 11882
53 Ga0068855_100056007 3300005563 Bacteria 4628
54 Ga0068855_100417458 3300005563 Bacteria 1468
55 Ga0068855_100478162 3300005563 Bacteria 1356
56 Ga0068857_100204073 3300005577 Unclassified 1802
57 Ga0068854_100056046 3300005578 Bacteria 2840
58 Ga0068856_100000825 3300005614 Bacteria 33467
59 Ga0068856_100198623 3300005614 Bacteria 2020
60 Ga0068852_100009682 3300005616 Bacteria 7160
61 Ga0068852_100013027 3300005616 Bacteria 6347
62 Ga0068852_100142961 3300005616 Bacteria 2216
63 Ga0068851_10216608 3300005834 Bacteria 1074
64 Ga0068870_10013922 3300005840 Bacteria 3789
65 Ga0068863_100481638 3300005841 Bacteria 1220
66 Ga0068860_100000004 3300005843 Bacteria 506126
67 Ga0075366_10000117 3300006195 Bacteria 32747
68 Ga0097621_100002108 3300006237 Bacteria 13634
69 Ga0068871_100002497 3300006358 Bacteria 12550
70 Ga0068871_100151477 3300006358 Unclassified 1978
71 Ga0068865_100000025 3300006881 Bacteria 94590
72 Ga0105240_10000128 3300009093 Bacteria 156107
73 Ga0105240_10001775 3300009093 Bacteria 36392
74 Ga0105240_10035160 3300009093 Bacteria 6459
75 Ga0105240_10067252 3300009093 Bacteria 4442
76 Ga0105240_10261854 3300009093 Bacteria 1994
77 Ga0105240_10323102 3300009093 Bacteria 1758
78 Ga0105240_10538929 3300009093 Bacteria 1293
79 Ga0105240_10555124 3300009093 Bacteria 1270
80 Ga0105240_10584577 3300009093 Bacteria 1231
81 Ga0105243_10063626 3300009148 Bacteria 2956
82 Ga0105241_10000358 3300009174 Bacteria 34691
83 Ga0105241_10002717 3300009174 Bacteria 13249
84 Ga0105241_10017668 3300009174 Bacteria 5244
85 Ga0105237_10003841 3300009545 Bacteria 17658
86 Ga0105237_10008328 3300009545 Bacteria 11252
87 Ga0105237_10018298 3300009545 Bacteria 7251
88 Ga0105237_10074909 3300009545 Bacteria 3376
89 Ga0105237_10074931 3300009545 Bacteria 3376
90 Ga0105237_10139517 3300009545 Bacteria 2418
91 Ga0105238_10002223 3300009551 Bacteria 19586
92 Ga0105238_10004370 3300009551 Bacteria 14022
93 Ga0105238_10051522 3300009551 Bacteria 4140
94 Ga0105238_10199255 3300009551 Bacteria 1977
95 Ga0105239_10000068 3300010375 Bacteria 144666
96 Ga0105239_10001575 3300010375 Bacteria 30140
97 Ga0105239_10003355 3300010375 Bacteria 19676
98 Ga0105239_10021062 3300010375 Bacteria 7194
99 Ga0105239_10040807 3300010375 Bacteria 5086
100 Ga0105239_10057611 3300010375 Bacteria 4262
101 Ga0105239_10166374 3300010375 Bacteria 2466
102 Ga0105239_10211493 3300010375 Bacteria 2174
103 Ga0157373_10000484 3300013100 Bacteria 31505
104 Ga0157373_10011192 3300013100 Bacteria 6602
105 Ga0157373_10051236 3300013100 Bacteria 2941
106 Ga0157373_10140032 3300013100 Bacteria 1701
107 Ga0157371_10001698 3300013102 Bacteria 22431
108 Ga0157371_10002289 3300013102 Bacteria 18458
109 Ga0157371_10008361 3300013102 Bacteria 8254
110 Ga0157371_10008463 3300013102 Bacteria 8189
111 Ga0157371_10040374 3300013102 Bacteria 3333
112 Ga0157371_10307110 3300013102 Bacteria 1149
113 Ga0157370_10000418 3300013104 Bacteria 53630
114 Ga0157370_10002309 3300013104 Bacteria 23081
115 Ga0157370_10006566 3300013104 Bacteria 12811
116 Ga0157370_10031639 3300013104 Bacteria 5174
117 Ga0157370_10177059 3300013104 Bacteria 1982
118 Ga0157370_10224014 3300013104 Bacteria 1741
119 Ga0157369_10032521 3300013105 Bacteria 5736
120 Ga0157369_10137382 3300013105 Bacteria 2587
121 Ga0157369_10378763 3300013105 Bacteria 1469
122 Ga0157374_10000147 3300013296 Bacteria 63762
123 Ga0157374_10003698 3300013296 Bacteria 12864
124 Ga0157378_10024426 3300013297 Bacteria 5318
125 Ga0163162_10000044 3300013306 Bacteria 128200
126 Ga0163162_10001391 3300013306 Bacteria 22512
127 Ga0163162_10008179 3300013306 Bacteria 10204
128 Ga0163162_10034880 3300013306 Bacteria 5009
129 Ga0163162_10088180 3300013306 Bacteria 3182
130 Ga0157372_10000077 3300013307 Bacteria 102192
131 Ga0157372_10002608 3300013307 Bacteria 19498
132 Ga0157372_10004188 3300013307 Bacteria 15435
133 Ga0157372_10006526 3300013307 Bacteria 12417
134 Ga0157372_10010718 3300013307 Bacteria 9757
135 Ga0157372_10136351 3300013307 Bacteria 2826
136 Ga0157372_10243234 3300013307 Bacteria 2088
137 Ga0157372_10393586 3300013307 Bacteria 1615
138 Ga0157375_10003196 3300013308 Bacteria 14219
139 Ga0157375_10147056 3300013308 Bacteria 2488
140 Ga0182008_10000006 3300014497 Bacteria 378521
141 Ga0157377_10001533 3300014745 Bacteria 10032
142 Ga0182006_1001205 3300015261 Bacteria 16160
143 Ga0163161_10072095 3300017792 Bacteria 2529
144 Ga0209437_100030 3300025233 Bacteria 532466
145 Ga0209129_1008918 3300025258 Bacteria 2714
146 Ga0209233_1012923 3300025261 Bacteria 2403
147 Ga0207426_1000002 3300025302 Bacteria 1249660
148 Ga0209257_1000006 3300025304 Bacteria 1570111
149 Ga0207647_10000027 3300025904 Bacteria 109872
150 Ga0207647_10143242 3300025904 Bacteria 1400
151 Ga0207645_10000300 3300025907 Bacteria 41495
152 Ga0207643_10016223 3300025908 Bacteria 4062
153 Ga0207705_10000111 3300025909 Bacteria 92842
154 Ga0207705_10036227 3300025909 Bacteria 3531
155 Ga0207705_10131860 3300025909 Bacteria 1860
156 Ga0207654_10000894 3300025911 Bacteria 16515
157 Ga0207654_10017508 3300025911 Bacteria 3748
158 Ga0207654_10024016 3300025911 Bacteria 3272
159 Ga0207707_10042027 3300025912 Bacteria 3992
160 Ga0207695_10000179 3300025913 Bacteria 185564
161 Ga0207695_10000892 3300025913 Bacteria 54116
162 Ga0207695_10007613 3300025913 Bacteria 13724
163 Ga0207695_10013006 3300025913 Bacteria 9942
164 Ga0207695_10207948 3300025913 Bacteria 1869
165 Ga0207695_10234659 3300025913 Bacteria 1737
166 Ga0207695_10285826 3300025913 Bacteria 1542
167 Ga0207695_10343084 3300025913 Bacteria 1381
168 Ga0207671_10000112 3300025914 Bacteria 125310
169 Ga0207671_10000478 3300025914 Bacteria 54326
170 Ga0207671_10000634 3300025914 Bacteria 46044
171 Ga0207671_10003656 3300025914 Bacteria 15184
172 Ga0207671_10022338 3300025914 Bacteria 4785
173 Ga0207671_10023527 3300025914 Bacteria 4646
174 Ga0207671_10081234 3300025914 Bacteria 2431
175 Ga0207657_10012609 3300025919 Bacteria 8332
176 Ga0207657_10023493 3300025919 Bacteria 5740
177 Ga0207657_10047843 3300025919 Bacteria 3737
178 Ga0207657_10324303 3300025919 Bacteria 1217
179 Ga0207652_10000606 3300025921 Bacteria 35687
180 Ga0207652_10021943 3300025921 Bacteria 5275
181 Ga0207694_10054542 3300025924 Bacteria 3102
182 Ga0207694_10219697 3300025924 Bacteria 1550
183 Ga0207644_10043318 3300025931 Bacteria 3193
184 Ga0207706_10000010 3300025933 Bacteria 200039
185 Ga0207706_10122591 3300025933 Bacteria 2286
186 Ga0207709_10041451 3300025935 Bacteria 2762
187 Ga0207704_10000016 3300025938 Bacteria 158362
188 Ga0207691_10274394 3300025940 Unclassified 1451
189 Ga0207667_10056180 3300025949 Bacteria 4136
190 Ga0207667_10084882 3300025949 Bacteria 3278
191 Ga0207651_10003516 3300025960 Bacteria 7700
192 Ga0207640_10039764 3300025981 Bacteria 2979
193 Ga0207640_10476953 3300025981 Unclassified 1034
194 Ga0207677_10029581 3300026023 Bacteria 3483
195 Ga0207639_10048326 3300026041 Bacteria 3220
196 Ga0207639_10260764 3300026041 Bacteria 1516
197 Ga0207678_10090010 3300026067 Bacteria 2623
198 Ga0207702_10002499 3300026078 Bacteria 17358
199 Ga0207702_10304271 3300026078 Bacteria 1514
200 Ga0207702_10397385 3300026078 Bacteria 1329
201 Ga0207648_10003384 3300026089 Bacteria 16755
202 Ga0207674_10164322 3300026116 Bacteria 2174
203 Ga0207683_10007636 3300026121 Bacteria 9262
204 Ga0207698_10013311 3300026142 Bacteria 5424
205 Ga0207698_10015612 3300026142 Bacteria 5091
206 Ga0207698_10025243 3300026142 Bacteria 4183
207 Ga0207698_10370179 3300026142 Bacteria 1360
208 Ga0268266_10000080 3300028379 Bacteria 210179
209 Ga0268266_10000327 3300028379 Bacteria 74821
210 Ga0268264_10000011 3300028381 Bacteria 580884
211 Ga0307515_10000299 3300028794 Bacteria 122087
212 Ga0307515_10000712 3300028794 Bacteria 76634
213 Ga0265338_10037321 3300028800 Bacteria 4628
214 Ga0316176_1200406 3300030732 Bacteria 7468
215 Ga0316183_1033841 3300030742 Bacteria 14926
216 Ga0316181_1119930 3300030744 Bacteria 21111
217 Ga0265327_10034506 3300031251 Bacteria 2807
218 Ga0265327_10039453 3300031251 Bacteria 2565
219 Ga0307516_10154680 3300031730 Bacteria 2050
220 Ga0307412_10000029 3300031911 Bacteria 209074
221 Ga0307414_10007194 3300032004 Bacteria 6246
222 Ga0307414_10083897 3300032004 Bacteria 2341
223 Ga0307507_10002432 3300033179 Bacteria 39062
224 Ga0307510_10003306 3300033180 Bacteria 18769
225 Ga0395899_0000011 3300037312 Bacteria 521331
226 Ga0395899_0000257 3300037312 Bacteria 69779
227 Ga0395899_0000534 3300037312 Bacteria 41504
228 Ga0395899_0000845 3300037312 Bacteria 29504
229 Ga0395899_0050528 3300037312 Bacteria 3086
230 Ga0395900_0000151 3300037418 Bacteria 116281
231 Ga0395900_0001520 3300037418 Bacteria 27545
232 Ga0395900_0001900 3300037418 Bacteria 23785
233 Ga0395900_0017305 3300037418 Bacteria 7357
234 Ga0395900_0086812 3300037418 Bacteria 3215
235 Ga0395900_0364371 3300037418 Bacteria 1416
236 Ga0395898_0000688 3300037466 Bacteria 60735
237 Ga0395898_0034902 3300037466 Bacteria 5005
238 Ga0395898_0055638 3300037466 Bacteria 3859
239 Ga0395898_0154191 3300037466 Bacteria 2197
240 Ga0395905_0000526 3300037471 Bacteria 52521
241 Ga0395905_0001935 3300037471 Bacteria 23767
242 Ga0395905_0025895 3300037471 Bacteria 5528
243 Ga0395901_0002093 3300038443 Bacteria 20486
244 Ga0395901_0003603 3300038443 Bacteria 15624
245 Ga0395901_0014688 3300038443 Bacteria 7958
246 Ga0436361_0460219 3300039447 Bacteria 10251
247 Ga0439431_0004264 3300041997 Bacteria 3138
248 Ga0439448_0021463 3300042005 Bacteria 2002
249 Ga0466966_0004915 3300044684 Bacteria 8788
250 Ga0466966_0142354 3300044684 Bacteria 1465
251 Ga0495650_0000098 3300046471 Bacteria 215716
252 Ga0495585_0000029 3300046492 Bacteria 145822
253 Ga0495585_0000092 3300046492 Bacteria 94819
254 Ga0495606_0000021 3300046507 Bacteria 271238
255 Ga0495606_0024362 3300046507 Bacteria 4362
256 Ga0495606_0243941 3300046507 Bacteria 1000
257 Ga0495610_0000347 3300046512 Bacteria 48803
258 Ga0495616_0001094 3300046513 Bacteria 19271
259 Ga0495616_0003779 3300046513 Bacteria 9656
260 Ga0495631_0077990 3300046518 Bacteria 1430
261 Ga0495637_0045251 3300046520 Bacteria 1869
262 Ga0495644_0020637 3300046523 Bacteria 2513
263 Ga0495648_0002147 3300046524 Bacteria 18589
264 Ga0495648_0010099 3300046524 Bacteria 7229
265 Ga0495652_0191184 3300046529 Bacteria 1562
266 Ga0495654_0011715 3300046530 Bacteria 4738
267 Ga0495609_0013260 3300046538 Bacteria 3897
268 Ga0495622_0061030 3300046557 Bacteria 1746
269 Ga0495633_0000004 3300046558 Bacteria 370781
270 Ga0495633_0001478 3300046558 Bacteria 18227
271 Ga0495668_0000058 3300046616 Bacteria 195501
272 Ga0495668_0029559 3300046616 Bacteria 3095
273 Ga0495668_0214380 3300046616 Unclassified 1054
274 Ga0495625_0000314 3300046660 Bacteria 74102
275 Ga0495625_0000649 3300046660 Bacteria 49932
276 Ga0495625_0008165 3300046660 Bacteria 8968
277 Ga0495625_0063679 3300046660 Bacteria 2603
278 Ga0495625_0075704 3300046660 Bacteria 2354
279 Ga0495661_0015546 3300046665 Bacteria 5078
280 Ga0495649_0000007 3300046694 Bacteria 518037
281 Ga0495660_0044085 3300046810 Bacteria 2456
282 Ga0495687_000385 3300047443 Bacteria 54684
283 Ga0495687_002893 3300047443 Bacteria 13105
284 Ga0495673_0082304 3300047469 Bacteria 1331
285 Ga0496126_0383917 3300048929 Unclassified 1143
286 Ga0495678_002804 3300049459 Bacteria 11326
287 Ga0495682_0009861 3300049460 Bacteria 3718
288 Ga0501036_0689111 3300049572 Bacteria 845
289 Ga0501069_0132226 3300049585 Bacteria 1429
290 Ga0501241_009910 3300049758 Bacteria 1732
291 nmdc:mga0k408_49_c2 3300050493 Bacteria 55012
292 Ga0500583_0016614 3300053092 Bacteria 2942
293 Ga0500651_0000256 3300053093 Bacteria 32006
294 Ga0500608_000607 3300053122 Bacteria 13192
295 Ga0500608_007942 3300053122 Bacteria 4424
296 Ga0500618_000006 3300053125 Bacteria 239188
297 Ga0500618_020259 3300053125 Bacteria 1630
298 Ga0500642_0135724 3300053130 Bacteria 1153
299 Ga0500568_0010292 3300053139 Bacteria 4388
300 Ga0500622_0002737 3300053156 Bacteria 12445
301 Ga0500624_000262 3300053157 Bacteria 18417
302 2599481306 2599185184 Bacteria 6430550
303 2776612271 2775506987 Bacteria 5373360
304 2896089789 2896085136 Bacteria 6129793
305 2896111200 2896109856 Bacteria 7140722
306 2898714639 2898713307 Bacteria 4110805
307 2919188018 2919186247 Bacteria 6244071
308 2919439956 2919437846 Bacteria 6199444
309 2928081906 2928078545 Bacteria 6534839
310 2928151925 2928147474 Bacteria 6512076
311 2932088116 2932082852 Bacteria 6563563
312 2939664715 2939664404 Bacteria 6364494
313 Ga0105237_10515720
314 JGI24741J21665_1012409
315 JGI24740J21852_10005935
316 JGI24737J22298_10000628
317 JGI24735J21928_10000031
318 rootH1_10030138
319 rootH2_10007197
320 rootH2_10084556
321 rootH2_10095015
322 rootH2_10098509
323 rootH2_10098510
324 rootL2_10114256
325 rootL2_10121379
326 rootL2_10188514
327 rootH1_10048873
328 rootH1_10069140
329 rootH1_10114082
330 rootH1_10117575
331 JGI25160J50197_1001449
332 Ga0055531_10000061
333 Ga0065714_10086018
334 Ga0065704_10002530
335 Ga0065704_10003015
336 Ga0070658_10000340
337 Ga0070658_10025860
338 Ga0070658_10093217
339 Ga0070658_10133009
340 Ga0070676_10000474
341 Ga0070680_100009468
342 Ga0068868_100041639
343 Ga0068868_100043049
344 Ga0068868_100049543
345 Ga0070660_100009269
346 Ga0070660_100011814
347 Ga0070660_100152718
348 Ga0070671_100011572
349 Ga0070673_100000361
350 Ga0070659_100068344
351 Ga0070659_100235840
352 Ga0070667_100646310
353 Ga0070678_100003672
354 Ga0070662_100000046
355 Ga0070681_10042192
356 Ga0068867_100001280
357 Ga0070679_100000435
358 Ga0070679_100038423
359 Ga0070679_100041864
360 Ga0070679_100144895
361 Ga0068853_100041626
362 Ga0070665_100000012
363 Ga0070665_100000196
364 Ga0068855_100009280
365 Ga0068855_100056007
366 Ga0068855_100417458
367 Ga0068855_100478162
368 Ga0068857_100204073
369 Ga0068854_100056046
370 Ga0068856_100000825
371 Ga0068856_100198623
372 Ga0068852_100009682
373 Ga0068852_100013027
374 Ga0068852_100142961
375 Ga0068851_10216608
376 Ga0068870_10013922
377 Ga0068863_100481638
378 Ga0068860_100000004
379 Ga0075366_10000117
380 Ga0097621_100002108
381 Ga0068871_100002497
382 Ga0068871_100151477
383 Ga0068865_100000025
384 Ga0105240_10000128
385 Ga0105240_10001775
386 Ga0105240_10035160
387 Ga0105240_10067252
388 Ga0105240_10261854
389 Ga0105240_10323102
390 Ga0105240_10538929
391 Ga0105240_10555124
392 Ga0105240_10584577
393 Ga0105243_10063626
394 Ga0105241_10000358
395 Ga0105241_10002717
396 Ga0105241_10017668
397 Ga0105237_10003841
398 Ga0105237_10008328
399 Ga0105237_10018298
400 Ga0105237_10074909
401 Ga0105237_10074931
402 Ga0105237_10139517
403 Ga0105238_10002223
404 Ga0105238_10004370
405 Ga0105238_10051522
406 Ga0105238_10199255
407 Ga0105239_10000068
408 Ga0105239_10001575
409 Ga0105239_10003355
410 Ga0105239_10021062
411 Ga0105239_10040807
412 Ga0105239_10057611
413 Ga0105239_10166374
414 Ga0105239_10211493
415 Ga0157373_10000484
416 Ga0157373_10011192
417 Ga0157373_10051236
418 Ga0157373_10140032
419 Ga0157371_10001698
420 Ga0157371_10002289
421 Ga0157371_10008361
422 Ga0157371_10008463
423 Ga0157371_10040374
424 Ga0157371_10307110
425 Ga0157370_10000418
426 Ga0157370_10002309
427 Ga0157370_10006566
428 Ga0157370_10031639
429 Ga0157370_10177059
430 Ga0157370_10224014
431 Ga0157369_10032521
432 Ga0157369_10137382
433 Ga0157369_10378763
434 Ga0157374_10000147
435 Ga0157374_10003698
436 Ga0157378_10024426
437 Ga0163162_10000044
438 Ga0163162_10001391
439 Ga0163162_10008179
440 Ga0163162_10034880
441 Ga0163162_10088180
442 Ga0157372_10000077
443 Ga0157372_10002608
444 Ga0157372_10004188
445 Ga0157372_10006526
446 Ga0157372_10010718
447 Ga0157372_10136351
448 Ga0157372_10243234
449 Ga0157372_10393586
450 Ga0157375_10003196
451 Ga0157375_10147056
452 Ga0182008_10000006
453 Ga0157377_10001533
454 Ga0182006_1001205
455 Ga0163161_10072095
456 Ga0209437_100030
457 Ga0209129_1008918
458 Ga0209233_1012923
459 Ga0207426_1000002
460 Ga0209257_1000006
461 Ga0207647_10000027
462 Ga0207647_10143242
463 Ga0207645_10000300
464 Ga0207643_10016223
465 Ga0207705_10000111
466 Ga0207705_10036227
467 Ga0207705_10131860
468 Ga0207654_10000894
469 Ga0207654_10017508
470 Ga0207654_10024016
471 Ga0207707_10042027
472 Ga0207695_10000179
473 Ga0207695_10000892
474 Ga0207695_10007613
475 Ga0207695_10013006
476 Ga0207695_10207948
477 Ga0207695_10234659
478 Ga0207695_10285826
479 Ga0207695_10343084
480 Ga0207671_10000112
481 Ga0207671_10000478
482 Ga0207671_10000634
483 Ga0207671_10003656
484 Ga0207671_10022338
485 Ga0207671_10023527
486 Ga0207671_10081234
487 Ga0207657_10012609
488 Ga0207657_10023493
489 Ga0207657_10047843
490 Ga0207657_10324303
491 Ga0207652_10000606
492 Ga0207652_10021943
493 Ga0207694_10054542
494 Ga0207694_10219697
495 Ga0207644_10043318
496 Ga0207706_10000010
497 Ga0207706_10122591
498 Ga0207709_10041451
499 Ga0207704_10000016
500 Ga0207691_10274394
501 Ga0207667_10056180
502 Ga0207667_10084882
503 Ga0207651_10003516
504 Ga0207640_10039764
505 Ga0207640_10476953
506 Ga0207677_10029581
507 Ga0207639_10048326
508 Ga0207639_10260764
509 Ga0207678_10090010
510 Ga0207702_10002499
511 Ga0207702_10304271
512 Ga0207702_10397385
513 Ga0207648_10003384
514 Ga0207674_10164322
515 Ga0207683_10007636
516 Ga0207698_10013311
517 Ga0207698_10015612
518 Ga0207698_10025243
519 Ga0207698_10370179
520 Ga0268266_10000080
521 Ga0268266_10000327
522 Ga0268264_10000011
523 Ga0307515_10000299
524 Ga0307515_10000712
525 Ga0265338_10037321
526 Ga0316176_1200406
527 Ga0316183_1033841
528 Ga0316181_1119930
529 Ga0265327_10034506
530 Ga0265327_10039453
531 Ga0307516_10154680
532 Ga0307412_10000029
533 Ga0307414_10007194
534 Ga0307414_10083897
535 Ga0307507_10002432
536 Ga0307510_10003306
537 Ga0395899_0000011
538 Ga0395899_0000257
539 Ga0395899_0000534
540 Ga0395899_0000845
541 Ga0395899_0050528
542 Ga0395900_0000151
543 Ga0395900_0001520
544 Ga0395900_0001900
545 Ga0395900_0017305
546 Ga0395900_0086812
547 Ga0395900_0364371
548 Ga0395898_0000688
549 Ga0395898_0034902
550 Ga0395898_0055638
551 Ga0395898_0154191
552 Ga0395905_0000526
553 Ga0395905_0001935
554 Ga0395905_0025895
555 Ga0395901_0002093
556 Ga0395901_0003603
557 Ga0395901_0014688
558 Ga0436361_0460219
559 Ga0439431_0004264
560 Ga0439448_0021463
561 Ga0466966_0004915
562 Ga0466966_0142354
563 Ga0495650_0000098
564 Ga0495585_0000029
565 Ga0495585_0000092
566 Ga0495606_0000021
567 Ga0495606_0024362
568 Ga0495606_0243941
569 Ga0495610_0000347
570 Ga0495616_0001094
571 Ga0495616_0003779
572 Ga0495631_0077990
573 Ga0495637_0045251
574 Ga0495644_0020637
575 Ga0495648_0002147
576 Ga0495648_0010099
577 Ga0495652_0191184
578 Ga0495654_0011715
579 Ga0495609_0013260
580 Ga0495622_0061030
581 Ga0495633_0000004
582 Ga0495633_0001478
583 Ga0495668_0000058
584 Ga0495668_0029559
585 Ga0495668_0214380
586 Ga0495625_0000314
587 Ga0495625_0000649
588 Ga0495625_0008165
589 Ga0495625_0063679
590 Ga0495625_0075704
591 Ga0495661_0015546
592 Ga0495649_0000007
593 Ga0495660_0044085
594 Ga0495687_000385
595 Ga0495687_002893
596 Ga0495673_0082304
597 Ga0496126_0383917
598 Ga0495678_002804
599 Ga0495682_0009861
600 Ga0501036_0689111
601 Ga0501069_0132226
602 Ga0501241_009910
603 nmdc:mga0k408_49_c2
604 Ga0500583_0016614
605 Ga0500651_0000256
606 Ga0500608_000607
607 Ga0500608_007942
608 Ga0500618_000006
609 Ga0500618_020259
610 Ga0500642_0135724
611 Ga0500568_0010292
612 Ga0500622_0002737
613 Ga0500624_000262
614 2599481306
615 2776612271
616 2896089789
617 2896111200
618 2898714639
619 2919188018
620 2919439956
621 2928081906
622 2928151925
623 2932088116
624 2939664715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

71

273

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ep9-assembly4.cif.gz_D crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.8529 19 272
5ep9-assembly4.cif.gz_D crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.8298 19 272
7dt0-assembly3.cif.gz_C proline hydroxylase h11-n101i mutant 0.826 15 233
5ep9-assembly3.cif.gz_C crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.8258 19 272
5epa-assembly6.cif.gz_F crystal structure of non-heme alpha ketoglutarate dependent carbocyclase snok from nogalamycin biosynthesis 0.8244 6 270
ID Description Score Start End Superfamily
5ep9C00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8258 19 272 2.60.120.620
5epaF00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8244 6 270 2.60.120.620
af_A8E5P7_122_256_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8167 122 240 2.60.120.620
5epaF00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8122 6 270 2.60.120.620
af_C7FZX0_9_206_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8104 54 231 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A3N7HA42-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9947 4 272 GO:0051213
AF-A0A317GWP3-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9901 1 272 GO:0051213
AF-A0A4Q3DEH3-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9883 55 272 GO:0051213
AF-A0A068NRC0-F1-model_v4 SnoK-like protein 0.9882 3 271
AF-A0A2D6BU56-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9877 7 271 GO:0051213

Map