F401623

General Info

Members Datasets Scaffolds Average Seq Length
312 171 624 148

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_101281114|Ga0068864_1012811141
Length 157
Sequence MLAYFVSNMIVADLSQIAGRTYPARRRTQNLVGGASPIQATNFSMGHVTLEPNGGQVPWHNQQQEEIYFIVEGTGEMCLGEERISVQTGQAVYIPPTVFHQLTNTGSTPMRMIYCYGPAGDVAHWRQELDGTLPRAGVDVPALPPGAAPQCTEKPKA

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
113 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
120 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
160 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
161 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
162 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
165 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 0.96
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 11.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_101281114 3300005618 Bacteria 733
2 Ga0070658_10000837 3300005327 Bacteria 26278
3 Ga0070658_10000975 3300005327 Bacteria 24554
4 Ga0070658_10586111 3300005327 Bacteria 966
5 Ga0070683_100000007 3300005329 Bacteria 342155
6 Ga0070683_100276334 3300005329 Bacteria 1598
7 Ga0070683_100737933 3300005329 Bacteria 943
8 Ga0070683_101117901 3300005329 Unclassified 757
9 Ga0070666_10357288 3300005335 Bacteria 1046
10 Ga0070680_100248215 3300005336 Bacteria 1505
11 Ga0070680_100787789 3300005336 Bacteria 819
12 Ga0070680_101890246 3300005336 Bacteria 517
13 Ga0070660_100040349 3300005339 Bacteria 3552
14 Ga0070689_101071819 3300005340 Bacteria 719
15 Ga0070688_100580188 3300005365 Bacteria 856
16 Ga0070688_101424417 3300005365 Bacteria 562
17 Ga0070709_10178644 3300005434 Bacteria 1489
18 Ga0070709_10181908 3300005434 Unclassified 1477
19 Ga0070709_10184098 3300005434 Unclassified 1469
20 Ga0070709_10235194 3300005434 Bacteria 1313
21 Ga0070714_100001665 3300005435 Bacteria 16171
22 Ga0070713_100000270 3300005436 Bacteria 34169
23 Ga0070713_100996766 3300005436 Bacteria 808
24 Ga0070713_101038938 3300005436 Bacteria 791
25 Ga0070711_100013161 3300005439 Bacteria 5189
26 Ga0070681_10022365 3300005458 Bacteria 6349
27 Ga0070681_10816219 3300005458 Bacteria 850
28 Ga0070681_10984438 3300005458 Bacteria 763
29 Ga0070679_100042278 3300005530 Bacteria 4538
30 Ga0070679_100211331 3300005530 Bacteria 1904
31 Ga0070684_100000054 3300005535 Bacteria 76916
32 Ga0070684_100237019 3300005535 Bacteria 1666
33 Ga0070684_102227897 3300005535 Unclassified 517
34 Ga0070697_100713758 3300005536 Bacteria 885
35 Ga0068855_101586164 3300005563 Bacteria 670
36 Ga0068857_100967835 3300005577 Unclassified 818
37 Ga0068857_101869819 3300005577 Bacteria 588
38 Ga0068856_100629778 3300005614 Bacteria 1093
39 Ga0068852_100439883 3300005616 Bacteria 1289
40 Ga0068852_101167600 3300005616 Bacteria 791
41 Ga0068851_10019024 3300005834 Bacteria 3317
42 Ga0068851_10143960 3300005834 Unclassified 1298
43 Ga0068858_100524890 3300005842 Bacteria 1145
44 Ga0068858_102178642 3300005842 Unclassified 548
45 Ga0081539_10205731 3300005985 Bacteria 905
46 Ga0070717_10150789 3300006028 Bacteria 2011
47 Ga0070717_10278529 3300006028 Bacteria 1483
48 Ga0070717_10376333 3300006028 Bacteria 1273
49 Ga0070717_11157044 3300006028 Bacteria 704
50 Ga0075363_100201469 3300006048 Bacteria 1137
51 Ga0070712_100824854 3300006175 Unclassified 797
52 Ga0075367_10427284 3300006178 Unclassified 839
53 Ga0075366_10215453 3300006195 Bacteria 1169
54 Ga0075430_100046750 3300006846 Bacteria 3655
55 Ga0075434_101700302 3300006871 Bacteria 639
56 Ga0075435_100212356 3300007076 Bacteria 1642
57 Ga0105240_10000724 3300009093 Bacteria 60274
58 Ga0105240_10000725 3300009093 Bacteria 60249
59 Ga0105240_10148676 3300009093 Bacteria 2792
60 Ga0105240_10265672 3300009093 Bacteria 1978
61 Ga0105240_11003682 3300009093 Bacteria 892
62 Ga0105245_10207549 3300009098 Bacteria 1884
63 Ga0105241_11253902 3300009174 Unclassified 704
64 Ga0105242_11699405 3300009176 Bacteria 667
65 Ga0105242_12292386 3300009176 Unclassified 586
66 Ga0105248_10069822 3300009177 Bacteria 3945
67 Ga0105237_10012241 3300009545 Bacteria 9042
68 Ga0105237_10012431 3300009545 Bacteria 8971
69 Ga0105237_10093587 3300009545 Bacteria 2994
70 Ga0105238_10297457 3300009551 Bacteria 1597
71 Ga0105239_10009261 3300010375 Bacteria 11132
72 Ga0105239_10032934 3300010375 Bacteria 5694
73 Ga0105239_11391075 3300010375 Bacteria 810
74 Ga0105246_11073731 3300011119 Bacteria 733
75 Ga0157373_10237013 3300013100 Bacteria 1289
76 Ga0157371_11587571 3300013102 Bacteria 512
77 Ga0157370_10154500 3300013104 Bacteria 2135
78 Ga0157370_10424505 3300013104 Unclassified 1223
79 Ga0157369_10265183 3300013105 Bacteria 1791
80 Ga0157369_10307174 3300013105 Bacteria 1650
81 Ga0157374_10766761 3300013296 Bacteria 980
82 Ga0157374_11132479 3300013296 Bacteria 803
83 Ga0157374_11405144 3300013296 Bacteria 721
84 Ga0157372_10079825 3300013307 Bacteria 3701
85 Ga0157372_10290766 3300013307 Bacteria 1900
86 Ga0157372_10615979 3300013307 Unclassified 1265
87 Ga0157375_10940552 3300013308 Bacteria 1006
88 Ga0163163_10511193 3300014325 Bacteria 1263
89 Ga0163163_12108897 3300014325 Bacteria 623
90 Ga0157380_10721866 3300014326 Bacteria 1004
91 Ga0157379_10481565 3300014968 Bacteria 1148
92 Ga0157379_11695701 3300014968 Bacteria 619
93 Ga0213873_10205877 3300021358 Unclassified 612
94 Ga0213872_10000098 3300021361 Bacteria 80168
95 Ga0213876_10057363 3300021384 Bacteria 2056
96 Ga0213876_10682062 3300021384 Bacteria 547
97 Ga0213875_10000006 3300021388 Bacteria 579005
98 Ga0213875_10000094 3300021388 Bacteria 102400
99 Ga0213875_10018677 3300021388 Bacteria 3341
100 Ga0213875_10047729 3300021388 Bacteria 2009
101 Ga0213875_10090444 3300021388 Bacteria 1427
102 Ga0213875_10259516 3300021388 Bacteria 820
103 Ga0213871_10117430 3300021441 Unclassified 791
104 Ga0207656_10060310 3300025321 Bacteria 1663
105 Ga0207680_10582601 3300025903 Bacteria 800
106 Ga0207705_10009948 3300025909 Bacteria 6925
107 Ga0207705_10013021 3300025909 Bacteria 6003
108 Ga0207707_10102491 3300025912 Bacteria 2502
109 Ga0207695_10000208 3300025913 Bacteria 158591
110 Ga0207695_10002442 3300025913 Bacteria 27468
111 Ga0207695_10066786 3300025913 Bacteria 3692
112 Ga0207695_10289261 3300025913 Bacteria 1531
113 Ga0207695_10546198 3300025913 Unclassified 1040
114 Ga0207671_10022299 3300025914 Bacteria 4789
115 Ga0207671_10888653 3300025914 Bacteria 705
116 Ga0207663_10024704 3300025916 Bacteria 3464
117 Ga0207663_11055662 3300025916 Bacteria 652
118 Ga0207663_11363951 3300025916 Bacteria 571
119 Ga0207660_10026238 3300025917 Bacteria 3966
120 Ga0207660_10795865 3300025917 Bacteria 772
121 Ga0207660_10948653 3300025917 Bacteria 702
122 Ga0207657_10124739 3300025919 Bacteria 2116
123 Ga0207652_10175751 3300025921 Bacteria 1923
124 Ga0207652_10265183 3300025921 Bacteria 1549
125 Ga0207694_10449116 3300025924 Unclassified 1076
126 Ga0207687_10131947 3300025927 Bacteria 1884
127 Ga0207700_10000996 3300025928 Bacteria 16329
128 Ga0207700_10802778 3300025928 Bacteria 842
129 Ga0207700_11033961 3300025928 Bacteria 735
130 Ga0207664_10006866 3300025929 Bacteria 7869
131 Ga0207664_10955153 3300025929 Bacteria 769
132 Ga0207670_10731326 3300025936 Unclassified 821
133 Ga0207711_10041527 3300025941 Bacteria 3917
134 Ga0207661_10000010 3300025944 Bacteria 375338
135 Ga0207661_10916243 3300025944 Unclassified 807
136 Ga0207667_11669203 3300025949 Bacteria 604
137 Ga0207651_10982601 3300025960 Bacteria 754
138 Ga0207703_10302256 3300026035 Bacteria 1460
139 Ga0207639_10000012 3300026041 Bacteria 344067
140 Ga0207639_10352483 3300026041 Bacteria 1315
141 Ga0207678_10365205 3300026067 Unclassified 1246
142 Ga0207702_10809168 3300026078 Bacteria 926
143 Ga0207641_10832704 3300026088 Bacteria 914
144 Ga0207676_10903520 3300026095 Bacteria 866
145 Ga0207674_10869699 3300026116 Unclassified 869
146 Ga0207674_11514788 3300026116 Bacteria 640
147 Ga0265357_1028495 3300028023 Bacteria 632
148 Ga0268266_10034325 3300028379 Bacteria 4315
149 Ga0268266_11440691 3300028379 Bacteria 664
150 Ga0265337_1002085 3300028556 Bacteria 9453
151 Ga0265319_1001051 3300028563 Bacteria 17224
152 Ga0265319_1092848 3300028563 Bacteria 951
153 Ga0265319_1120299 3300028563 Bacteria 818
154 Ga0265318_10112971 3300028577 Bacteria 998
155 Ga0265323_10002187 3300028653 Bacteria 9112
156 Ga0265336_10171778 3300028666 Bacteria 645
157 Ga0307515_10000008 3300028794 Bacteria 663660
158 Ga0265338_10014387 3300028800 Bacteria 8807
159 Ga0265338_10288764 3300028800 Bacteria 1196
160 Ga0265338_10582360 3300028800 Bacteria 781
161 Ga0307511_10382930 3300030521 Unclassified 587
162 Ga0265330_10191572 3300031235 Bacteria 865
163 Ga0265330_10257758 3300031235 Bacteria 735
164 Ga0265332_10045813 3300031238 Bacteria 1884
165 Ga0265320_10009300 3300031240 Bacteria 5935
166 Ga0265320_10019797 3300031240 Bacteria 3667
167 Ga0265320_10041946 3300031240 Bacteria 2273
168 Ga0265320_10066446 3300031240 Bacteria 1709
169 Ga0265325_10087052 3300031241 Bacteria 1545
170 Ga0265331_10008531 3300031250 Bacteria 5823
171 Ga0265331_10060816 3300031250 Bacteria 1784
172 Ga0265331_10244822 3300031250 Bacteria 804
173 Ga0265316_10035211 3300031344 Bacteria 4059
174 Ga0265316_10037750 3300031344 Bacteria 3896
175 Ga0265316_10097235 3300031344 Bacteria 2241
176 Ga0265316_10207632 3300031344 Bacteria 1450
177 Ga0265313_10004854 3300031595 Bacteria 10103
178 Ga0265313_10006498 3300031595 Bacteria 8261
179 Ga0265313_10023442 3300031595 Bacteria 3323
180 Ga0265314_10119450 3300031711 Bacteria 1662
181 Ga0265314_10193621 3300031711 Unclassified 1208
182 Ga0265342_10009089 3300031712 Bacteria 7043
183 Ga0265342_10076156 3300031712 Bacteria 1945
184 Ga0316576_10372102 3300031727 Unclassified 1062
185 Ga0307414_10526191 3300032004 Bacteria 1050
186 Ga0307414_10580351 3300032004 Bacteria 1003
187 Ga0373954_0022144 3300035118 Bacteria 2881
188 Ga0373931_0286581 3300035691 Bacteria 1013
189 Ga0373935_0039832 3300035692 Bacteria 2947
190 Ga0373927_0089565 3300035695 Bacteria 1998
191 Ga0373927_0214538 3300035695 Bacteria 1264
192 Ga0373947_0344049 3300035725 Bacteria 1000
193 Ga0373937_0221742 3300036401 Bacteria 1780
194 Ga0373937_0468314 3300036401 Bacteria 1197
195 Ga0373937_1216056 3300036401 Bacteria 702
196 Ga0373925_0948470 3300037068 Bacteria 709
197 Ga0373925_1023753 3300037068 Bacteria 680
198 Ga0395905_0000592 3300037471 Bacteria 48656
199 Ga0395905_0072026 3300037471 Bacteria 3240
200 Ga0395905_0220586 3300037471 Bacteria 1775
201 Ga0395905_0315634 3300037471 Bacteria 1452
202 Ga0395905_1015784 3300037471 Unclassified 732
203 Ga0436364_0255884 3300037853 Bacteria 977
204 Ga0436364_0392266 3300037853 Bacteria 3705
205 Ga0436364_0446548 3300037853 Bacteria 1583
206 Ga0436364_0478514 3300037853 Bacteria 578677
207 Ga0436364_0531584 3300037853 Bacteria 522
208 Ga0436364_0613412 3300037853 Bacteria 6385
209 Ga0436364_0766529 3300037853 Bacteria 1939
210 Ga0436364_1031845 3300037853 Unclassified 836
211 Ga0436364_1078682 3300037853 Bacteria 14308
212 Ga0436364_1104800 3300037853 Bacteria 148674
213 Ga0400490_45931 3300038726 Bacteria 2790
214 Ga0400483_290257 3300039062 Unclassified 1341
215 Ga0436365_0159544 3300039437 Bacteria 967
216 Ga0436365_1031778 3300039437 Bacteria 2890
217 Ga0436365_1417096 3300039437 Bacteria 2481
218 Ga0436360_0543631 3300039438 Bacteria 3343
219 Ga0436360_1169155 3300039438 Bacteria 614
220 Ga0436361_0683315 3300039447 Bacteria 65588
221 Ga0436361_0833684 3300039447 Bacteria 4591
222 Ga0436363_0029766 3300039450 Bacteria 1354
223 Ga0436363_0058563 3300039450 Bacteria 1527
224 Ga0436363_1391844 3300039450 Bacteria 738
225 Ga0436363_1640944 3300039450 Unclassified 731
226 Ga0436362_0146183 3300039453 Bacteria 879
227 Ga0436362_0478552 3300039453 Unclassified 642
228 Ga0436362_0555109 3300039453 Bacteria 1839
229 Ga0451789_0243581 3300041443 Bacteria 589
230 Ga0451839_1001231 3300041496 Bacteria 687
231 Ga0451577_0064587 3300042876 Bacteria 3264
232 Ga0451577_0250285 3300042876 Bacteria 1604
233 Ga0466966_0036615 3300044684 Bacteria 3168
234 Ga0453684_0000093 3300044712 Bacteria 384050
235 Ga0453684_0132512 3300044712 Bacteria 2989
236 Ga0453684_0663602 3300044712 Bacteria 1137
237 Ga0466957_0298501 3300044842 Bacteria 1082
238 Ga0451576_0024327 3300045051 Bacteria 6542
239 Ga0451576_0729241 3300045051 Bacteria 1041
240 Ga0451576_1071516 3300045051 Bacteria 844
241 Ga0451576_1286976 3300045051 Bacteria 762
242 Ga0451576_1426878 3300045051 Bacteria 720
243 Ga0451576_1623991 3300045051 Unclassified 670
244 Ga0495592_0307151 3300046454 Bacteria 1029
245 Ga0495651_0055088 3300046462 Bacteria 3056
246 Ga0495651_0536582 3300046462 Bacteria 745
247 Ga0495653_0157690 3300046463 Bacteria 1579
248 Ga0495580_0276810 3300046472 Unclassified 1145
249 Ga0495580_0825368 3300046472 Bacteria 600
250 Ga0495582_0526938 3300046473 Bacteria 683
251 Ga0495639_0093288 3300046475 Bacteria 1415
252 Ga0495662_0064998 3300046476 Bacteria 1763
253 Ga0495662_0248629 3300046476 Bacteria 876
254 Ga0495664_0027903 3300046477 Bacteria 3293
255 Ga0495664_0229269 3300046477 Bacteria 1124
256 Ga0495608_0185868 3300046511 Bacteria 1313
257 Ga0495628_0019682 3300046516 Bacteria 5576
258 Ga0495628_0160749 3300046516 Bacteria 1707
259 Ga0495628_0235275 3300046516 Bacteria 1372
260 Ga0495630_0124449 3300046517 Bacteria 1956
261 Ga0495665_0102084 3300046531 Bacteria 1505
262 Ga0495586_0178953 3300046535 Bacteria 1199
263 Ga0495587_0045169 3300046536 Bacteria 2619
264 Ga0495621_0125267 3300046539 Unclassified 996
265 Ga0495645_0015679 3300046543 Bacteria 5392
266 Ga0495645_0033310 3300046543 Bacteria 3759
267 Ga0495645_0074652 3300046543 Bacteria 2441
268 Ga0495645_0192000 3300046543 Bacteria 1391
269 Ga0495645_0558851 3300046543 Bacteria 708
270 Ga0495667_0015614 3300046559 Bacteria 5134
271 Ga0495667_0206461 3300046559 Bacteria 1256
272 Ga0495634_0060238 3300046642 Bacteria 2526
273 Ga0495657_0144739 3300046675 Bacteria 1479
274 Ga0495599_0008423 3300046678 Bacteria 6268
275 Ga0495599_0041271 3300046678 Bacteria 2898
276 Ga0495623_0042626 3300046679 Bacteria 2891
277 Ga0495646_0386160 3300046680 Bacteria 729
278 Ga0495613_0551529 3300046689 Bacteria 771
279 Ga0495613_0888973 3300046689 Bacteria 577
280 Ga0495600_0061147 3300046809 Bacteria 2460
281 Ga0495600_0296933 3300046809 Bacteria 1020
282 Ga0495581_0061638 3300047315 Bacteria 2168
283 Ga0495604_0049300 3300047317 Bacteria 3273
284 Ga0495604_0064385 3300047317 Bacteria 2794
285 Ga0495604_0517406 3300047317 Bacteria 772
286 Ga0495674_0249614 3300047319 Bacteria 1460
287 Ga0495674_0395987 3300047319 Bacteria 1115
288 Ga0495680_0044063 3300047322 Bacteria 3530
289 Ga0495680_0378938 3300047322 Bacteria 980
290 Ga0495675_0192161 3300047444 Bacteria 1245
291 Ga0495684_0054768 3300047471 Bacteria 3042
292 Ga0495684_0456672 3300047471 Bacteria 886
293 Ga0496104_0729370 3300048907 Bacteria 898
294 Ga0496112_1140423 3300048915 Bacteria 697
295 Ga0501070_0205347 3300049586 Bacteria 1618
296 Ga0501199_016642 3300049650 Bacteria 830
297 Ga0501216_093993 3300049660 Unclassified 652
298 Ga0501240_072132 3300049673 Unclassified 627
299 Ga0501249_006173 3300049679 Bacteria 2463
300 Ga0501083_0006429 3300049744 Bacteria 8334
301 Ga0501083_0006628 3300049744 Bacteria 8219
302 Ga0501083_0024110 3300049744 Bacteria 4218
303 Ga0501083_0875847 3300049744 Unclassified 584
304 Ga0501268_036407 3300049765 Unclassified 911
305 Ga0501270_010348 3300049767 Bacteria 1227
306 nmdc:mga03n38_125242_c1 3300050490 Bacteria 1267
307 nmdc:mga0k408_531412_c1 3300050493 Unclassified 696
308 nmdc:mga0qj67_108856_c1 3300050509 Bacteria 2236
309 nmdc:mga0n895_1860932_c1 3300050512 Bacteria 561
310 Ga0501082_0000434 3300060353 Bacteria 37104
311 Ga0501082_1307931 3300060353 Bacteria 633
312 2787509953 2786546548 Bacteria 4745694
313 Ga0068864_101281114
314 Ga0070658_10000837
315 Ga0070658_10000975
316 Ga0070658_10586111
317 Ga0070683_100000007
318 Ga0070683_100276334
319 Ga0070683_100737933
320 Ga0070683_101117901
321 Ga0070666_10357288
322 Ga0070680_100248215
323 Ga0070680_100787789
324 Ga0070680_101890246
325 Ga0070660_100040349
326 Ga0070689_101071819
327 Ga0070688_100580188
328 Ga0070688_101424417
329 Ga0070709_10178644
330 Ga0070709_10181908
331 Ga0070709_10184098
332 Ga0070709_10235194
333 Ga0070714_100001665
334 Ga0070713_100000270
335 Ga0070713_100996766
336 Ga0070713_101038938
337 Ga0070711_100013161
338 Ga0070681_10022365
339 Ga0070681_10816219
340 Ga0070681_10984438
341 Ga0070679_100042278
342 Ga0070679_100211331
343 Ga0070684_100000054
344 Ga0070684_100237019
345 Ga0070684_102227897
346 Ga0070697_100713758
347 Ga0068855_101586164
348 Ga0068857_100967835
349 Ga0068857_101869819
350 Ga0068856_100629778
351 Ga0068852_100439883
352 Ga0068852_101167600
353 Ga0068851_10019024
354 Ga0068851_10143960
355 Ga0068858_100524890
356 Ga0068858_102178642
357 Ga0081539_10205731
358 Ga0070717_10150789
359 Ga0070717_10278529
360 Ga0070717_10376333
361 Ga0070717_11157044
362 Ga0075363_100201469
363 Ga0070712_100824854
364 Ga0075367_10427284
365 Ga0075366_10215453
366 Ga0075430_100046750
367 Ga0075434_101700302
368 Ga0075435_100212356
369 Ga0105240_10000724
370 Ga0105240_10000725
371 Ga0105240_10148676
372 Ga0105240_10265672
373 Ga0105240_11003682
374 Ga0105245_10207549
375 Ga0105241_11253902
376 Ga0105242_11699405
377 Ga0105242_12292386
378 Ga0105248_10069822
379 Ga0105237_10012241
380 Ga0105237_10012431
381 Ga0105237_10093587
382 Ga0105238_10297457
383 Ga0105239_10009261
384 Ga0105239_10032934
385 Ga0105239_11391075
386 Ga0105246_11073731
387 Ga0157373_10237013
388 Ga0157371_11587571
389 Ga0157370_10154500
390 Ga0157370_10424505
391 Ga0157369_10265183
392 Ga0157369_10307174
393 Ga0157374_10766761
394 Ga0157374_11132479
395 Ga0157374_11405144
396 Ga0157372_10079825
397 Ga0157372_10290766
398 Ga0157372_10615979
399 Ga0157375_10940552
400 Ga0163163_10511193
401 Ga0163163_12108897
402 Ga0157380_10721866
403 Ga0157379_10481565
404 Ga0157379_11695701
405 Ga0213873_10205877
406 Ga0213872_10000098
407 Ga0213876_10057363
408 Ga0213876_10682062
409 Ga0213875_10000006
410 Ga0213875_10000094
411 Ga0213875_10018677
412 Ga0213875_10047729
413 Ga0213875_10090444
414 Ga0213875_10259516
415 Ga0213871_10117430
416 Ga0207656_10060310
417 Ga0207680_10582601
418 Ga0207705_10009948
419 Ga0207705_10013021
420 Ga0207707_10102491
421 Ga0207695_10000208
422 Ga0207695_10002442
423 Ga0207695_10066786
424 Ga0207695_10289261
425 Ga0207695_10546198
426 Ga0207671_10022299
427 Ga0207671_10888653
428 Ga0207663_10024704
429 Ga0207663_11055662
430 Ga0207663_11363951
431 Ga0207660_10026238
432 Ga0207660_10795865
433 Ga0207660_10948653
434 Ga0207657_10124739
435 Ga0207652_10175751
436 Ga0207652_10265183
437 Ga0207694_10449116
438 Ga0207687_10131947
439 Ga0207700_10000996
440 Ga0207700_10802778
441 Ga0207700_11033961
442 Ga0207664_10006866
443 Ga0207664_10955153
444 Ga0207670_10731326
445 Ga0207711_10041527
446 Ga0207661_10000010
447 Ga0207661_10916243
448 Ga0207667_11669203
449 Ga0207651_10982601
450 Ga0207703_10302256
451 Ga0207639_10000012
452 Ga0207639_10352483
453 Ga0207678_10365205
454 Ga0207702_10809168
455 Ga0207641_10832704
456 Ga0207676_10903520
457 Ga0207674_10869699
458 Ga0207674_11514788
459 Ga0265357_1028495
460 Ga0268266_10034325
461 Ga0268266_11440691
462 Ga0265337_1002085
463 Ga0265319_1001051
464 Ga0265319_1092848
465 Ga0265319_1120299
466 Ga0265318_10112971
467 Ga0265323_10002187
468 Ga0265336_10171778
469 Ga0307515_10000008
470 Ga0265338_10014387
471 Ga0265338_10288764
472 Ga0265338_10582360
473 Ga0307511_10382930
474 Ga0265330_10191572
475 Ga0265330_10257758
476 Ga0265332_10045813
477 Ga0265320_10009300
478 Ga0265320_10019797
479 Ga0265320_10041946
480 Ga0265320_10066446
481 Ga0265325_10087052
482 Ga0265331_10008531
483 Ga0265331_10060816
484 Ga0265331_10244822
485 Ga0265316_10035211
486 Ga0265316_10037750
487 Ga0265316_10097235
488 Ga0265316_10207632
489 Ga0265313_10004854
490 Ga0265313_10006498
491 Ga0265313_10023442
492 Ga0265314_10119450
493 Ga0265314_10193621
494 Ga0265342_10009089
495 Ga0265342_10076156
496 Ga0316576_10372102
497 Ga0307414_10526191
498 Ga0307414_10580351
499 Ga0373954_0022144
500 Ga0373931_0286581
501 Ga0373935_0039832
502 Ga0373927_0089565
503 Ga0373927_0214538
504 Ga0373947_0344049
505 Ga0373937_0221742
506 Ga0373937_0468314
507 Ga0373937_1216056
508 Ga0373925_0948470
509 Ga0373925_1023753
510 Ga0395905_0000592
511 Ga0395905_0072026
512 Ga0395905_0220586
513 Ga0395905_0315634
514 Ga0395905_1015784
515 Ga0436364_0255884
516 Ga0436364_0392266
517 Ga0436364_0446548
518 Ga0436364_0478514
519 Ga0436364_0531584
520 Ga0436364_0613412
521 Ga0436364_0766529
522 Ga0436364_1031845
523 Ga0436364_1078682
524 Ga0436364_1104800
525 Ga0400490_45931
526 Ga0400483_290257
527 Ga0436365_0159544
528 Ga0436365_1031778
529 Ga0436365_1417096
530 Ga0436360_0543631
531 Ga0436360_1169155
532 Ga0436361_0683315
533 Ga0436361_0833684
534 Ga0436363_0029766
535 Ga0436363_0058563
536 Ga0436363_1391844
537 Ga0436363_1640944
538 Ga0436362_0146183
539 Ga0436362_0478552
540 Ga0436362_0555109
541 Ga0451789_0243581
542 Ga0451839_1001231
543 Ga0451577_0064587
544 Ga0451577_0250285
545 Ga0466966_0036615
546 Ga0453684_0000093
547 Ga0453684_0132512
548 Ga0453684_0663602
549 Ga0466957_0298501
550 Ga0451576_0024327
551 Ga0451576_0729241
552 Ga0451576_1071516
553 Ga0451576_1286976
554 Ga0451576_1426878
555 Ga0451576_1623991
556 Ga0495592_0307151
557 Ga0495651_0055088
558 Ga0495651_0536582
559 Ga0495653_0157690
560 Ga0495580_0276810
561 Ga0495580_0825368
562 Ga0495582_0526938
563 Ga0495639_0093288
564 Ga0495662_0064998
565 Ga0495662_0248629
566 Ga0495664_0027903
567 Ga0495664_0229269
568 Ga0495608_0185868
569 Ga0495628_0019682
570 Ga0495628_0160749
571 Ga0495628_0235275
572 Ga0495630_0124449
573 Ga0495665_0102084
574 Ga0495586_0178953
575 Ga0495587_0045169
576 Ga0495621_0125267
577 Ga0495645_0015679
578 Ga0495645_0033310
579 Ga0495645_0074652
580 Ga0495645_0192000
581 Ga0495645_0558851
582 Ga0495667_0015614
583 Ga0495667_0206461
584 Ga0495634_0060238
585 Ga0495657_0144739
586 Ga0495599_0008423
587 Ga0495599_0041271
588 Ga0495623_0042626
589 Ga0495646_0386160
590 Ga0495613_0551529
591 Ga0495613_0888973
592 Ga0495600_0061147
593 Ga0495600_0296933
594 Ga0495581_0061638
595 Ga0495604_0049300
596 Ga0495604_0064385
597 Ga0495604_0517406
598 Ga0495674_0249614
599 Ga0495674_0395987
600 Ga0495680_0044063
601 Ga0495680_0378938
602 Ga0495675_0192161
603 Ga0495684_0054768
604 Ga0495684_0456672
605 Ga0496104_0729370
606 Ga0496112_1140423
607 Ga0501070_0205347
608 Ga0501199_016642
609 Ga0501216_093993
610 Ga0501240_072132
611 Ga0501249_006173
612 Ga0501083_0006429
613 Ga0501083_0006628
614 Ga0501083_0024110
615 Ga0501083_0875847
616 Ga0501268_036407
617 Ga0501270_010348
618 nmdc:mga03n38_125242_c1
619 nmdc:mga0k408_531412_c1
620 nmdc:mga0qj67_108856_c1
621 nmdc:mga0n895_1860932_c1
622 Ga0501082_0000434
623 Ga0501082_1307931
624 2787509953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

46

116

0.96

PF16867

DMSP_lyase

Dimethlysulfonioproprionate lyase

20

112

0.91

PF01050

MannoseP_isomer

Mannose-6-phosphate isomerase C-terminal

34

118

0.9

PF00190

Cupin_1

Cupin

25

134

0.85

PF02311

AraC_binding

AraC-like ligand binding domain

50

149

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9299 1 112
2vpv-assembly1.cif.gz_B dimerization domain of mif2p 0.9213 35 112
5wsf-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.9172 1 109
5wse-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.9171 1 109
5wse-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.9143 1 109
ID Description Score Start End Superfamily
af_K7MZP2_73_184_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.942 50 108 2.60.120.10
2vpvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9213 35 112 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9175 17 109 2.60.120.10
af_I1MK06_17_180_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9166 34 108 2.60.120.10
af_A0A0R0L0M3_22_151_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9141 34 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A832NLW8-F1-model_v4 Cupin domain-containing protein 0.9992 1 142
AF-A0A7C6T9A2-F1-model_v4 Cupin domain-containing protein 0.9983 1 142 GO:0046872
AF-A0A521E6F9-F1-model_v4 Cupin domain-containing protein 0.9949 1 142
AF-A0A349GZU5-F1-model_v4 Cupin domain-containing protein 0.9868 1 144 GO:0046872
AF-A0A7V4LSA0-F1-model_v4 Cupin domain-containing protein 0.9868 1 113 GO:0046872

Map