F401590

General Info

Members Datasets Scaffolds Average Seq Length
312 239 624 108

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_101810647|Ga0070663_1018106472
Length 121
Sequence MDVVNHTTPRSSPKRDEVWLVPLDPSQGAEIQKTRPCVIVSPDESNRALRTVIIAPMTTAERLYPTRIAVSFQGKRGQIALDQIRAVDRTRLTRRLGRISPTTAVAVSSVLVEMFTREAGE

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
132 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
203 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
220 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
237 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
239 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 1.92
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0.32
Rhizoplane 4.17
Rhizosphere 90.71
Stem 0
Stem Tuber 0
Unclassified 24.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_101810647 3300005455 Bacteria 547
2 JGI24735J21928_10002515 3300002067 Bacteria 6339
3 JGI24735J21928_10005364 3300002067 Bacteria 4255
4 JGI24735J21928_10024650 3300002067 Bacteria 1818
5 rootL2_10302801 3300003322 Bacteria 1372
6 Ga0065715_10279040 3300005293 Unclassified 1091
7 Ga0070658_10088045 3300005327 Bacteria 2556
8 Ga0070683_100566533 3300005329 Bacteria 1086
9 Ga0070670_100434278 3300005331 Unclassified 1162
10 Ga0070677_10070747 3300005333 Bacteria 1467
11 Ga0070666_10109975 3300005335 Bacteria 1905
12 Ga0070666_11148190 3300005335 Unclassified 578
13 Ga0070680_100014220 3300005336 Bacteria 6216
14 Ga0070660_100107460 3300005339 Bacteria 2217
15 Ga0070661_100857510 3300005344 Bacteria 748
16 Ga0070675_100981345 3300005354 Bacteria 775
17 Ga0070675_101540898 3300005354 Bacteria 613
18 Ga0070671_100649957 3300005355 Unclassified 913
19 Ga0070671_101827487 3300005355 Unclassified 540
20 Ga0070674_100143024 3300005356 Bacteria 1797
21 Ga0070673_100386746 3300005364 Bacteria 1248
22 Ga0070659_100593596 3300005366 Bacteria 951
23 Ga0070667_100159579 3300005367 Bacteria 1985
24 Ga0070667_101617414 3300005367 Unclassified 609
25 Ga0070714_100673867 3300005435 Unclassified 997
26 Ga0070714_100776556 3300005435 Bacteria 927
27 Ga0070701_10962188 3300005438 Unclassified 593
28 Ga0070705_100216695 3300005440 Unclassified 1323
29 Ga0070694_100535111 3300005444 Unclassified 936
30 Ga0070708_100663999 3300005445 Unclassified 982
31 Ga0070681_10030118 3300005458 Bacteria 5445
32 Ga0070706_102162458 3300005467 Unclassified 503
33 Ga0070707_100199303 3300005468 Bacteria 1951
34 Ga0070707_100379008 3300005468 Bacteria 1374
35 Ga0070698_100511481 3300005471 Unclassified 1139
36 Ga0070699_100144358 3300005518 Unclassified 2103
37 Ga0070699_100194142 3300005518 Bacteria 1804
38 Ga0070684_100379543 3300005535 Bacteria 1302
39 Ga0070697_100493896 3300005536 Bacteria 1070
40 Ga0068853_100974489 3300005539 Bacteria 816
41 Ga0070672_100085454 3300005543 Bacteria 2536
42 Ga0070696_100446261 3300005546 Unclassified 1020
43 Ga0070696_100596720 3300005546 Bacteria 890
44 Ga0070665_100083822 3300005548 Bacteria 3193
45 Ga0070704_100228252 3300005549 Bacteria 1517
46 Ga0070704_101990841 3300005549 Unclassified 539
47 Ga0068855_100017737 3300005563 Bacteria 8557
48 Ga0068855_100242898 3300005563 Bacteria 2011
49 Ga0068855_100841057 3300005563 Bacteria 973
50 Ga0068854_101403574 3300005578 Unclassified 631
51 Ga0068854_101707472 3300005578 Unclassified 576
52 Ga0068856_100006770 3300005614 Bacteria 11217
53 Ga0068856_100823278 3300005614 Bacteria 948
54 Ga0068856_101410367 3300005614 Unclassified 711
55 Ga0068856_101917948 3300005614 Unclassified 603
56 Ga0068864_101635631 3300005618 Unclassified 648
57 Ga0068870_10325027 3300005840 Unclassified 979
58 Ga0068863_101166543 3300005841 Unclassified 776
59 Ga0068858_100394395 3300005842 Bacteria 1329
60 Ga0068858_101707479 3300005842 Unclassified 622
61 Ga0070717_11720113 3300006028 Unclassified 567
62 Ga0075369_10092619 3300006186 Bacteria 1350
63 Ga0097621_100344334 3300006237 Bacteria 1324
64 Ga0097621_100561143 3300006237 Bacteria 1040
65 Ga0097621_101709326 3300006237 Unclassified 599
66 Ga0068871_100348703 3300006358 Unclassified 1309
67 Ga0068871_100537845 3300006358 Bacteria 1057
68 Ga0068871_100815868 3300006358 Bacteria 861
69 Ga0075433_10004258 3300006852 Bacteria 11115
70 Ga0075434_100105354 3300006871 Bacteria 2830
71 Ga0075429_100070462 3300006880 Bacteria 3044
72 Ga0075436_100014664 3300006914 Bacteria 5373
73 Ga0075435_100420581 3300007076 Bacteria 1151
74 Ga0099794_10147716 3300007265 Bacteria 1193
75 Ga0105240_10061017 3300009093 Bacteria 4700
76 Ga0105245_10276329 3300009098 Bacteria 1640
77 Ga0105245_11352555 3300009098 Bacteria 762
78 Ga0114129_10027409 3300009147 Bacteria 8066
79 Ga0114129_10285903 3300009147 Bacteria 2202
80 Ga0105243_10603267 3300009148 Bacteria 1057
81 Ga0105241_10253010 3300009174 Bacteria 1494
82 Ga0105241_11643567 3300009174 Unclassified 623
83 Ga0105242_11374830 3300009176 Bacteria 732
84 Ga0105248_10140979 3300009177 Bacteria 2719
85 Ga0105237_10030546 3300009545 Bacteria 5471
86 Ga0105238_12171414 3300009551 Unclassified 590
87 Ga0105249_13590223 3300009553 Unclassified 500
88 Ga0105239_10015478 3300010375 Bacteria 8449
89 Ga0105239_11283629 3300010375 Unclassified 844
90 Ga0105246_10640832 3300011119 Unclassified 924
91 Ga0157373_10006534 3300013100 Bacteria 8700
92 Ga0157370_10013107 3300013104 Bacteria 8555
93 Ga0157370_10067586 3300013104 Bacteria 3378
94 Ga0157370_11394119 3300013104 Unclassified 631
95 Ga0157369_10005345 3300013105 Bacteria 14964
96 Ga0157369_10333619 3300013105 Bacteria 1575
97 Ga0157369_11799222 3300013105 Unclassified 622
98 Ga0157374_10001147 3300013296 Bacteria 22561
99 Ga0163162_10079957 3300013306 Bacteria 3336
100 Ga0157372_10118772 3300013307 Bacteria 3034
101 Ga0157372_10181622 3300013307 Bacteria 2436
102 Ga0157375_10276361 3300013308 Bacteria 1842
103 Ga0157375_10467043 3300013308 Bacteria 1427
104 Ga0163163_10101733 3300014325 Bacteria 2896
105 Ga0163163_10192331 3300014325 Bacteria 2089
106 Ga0163163_10350840 3300014325 Bacteria 1532
107 Ga0163163_10792906 3300014325 Bacteria 1011
108 Ga0163163_11508165 3300014325 Unclassified 734
109 Ga0182008_10036876 3300014497 Bacteria 2446
110 Ga0182008_10233299 3300014497 Bacteria 945
111 Ga0157379_10037964 3300014968 Bacteria 4297
112 Ga0157379_11107005 3300014968 Unclassified 759
113 Ga0157376_10302796 3300014969 Bacteria 1514
114 Ga0157376_11034945 3300014969 Bacteria 845
115 Ga0182006_1064729 3300015261 Bacteria 1370
116 Ga0182007_10006630 3300015262 Bacteria 4956
117 Ga0163161_10064617 3300017792 Bacteria 2669
118 Ga0163161_11202388 3300017792 Unclassified 655
119 Ga0197907_11062602 3300020069 Bacteria 1133
120 Ga0206355_1462660 3300020076 Bacteria 1207
121 Ga0206350_10985001 3300020080 Bacteria 845
122 Ga0206353_11484750 3300020082 Bacteria 654
123 Ga0213873_10080479 3300021358 Bacteria 911
124 Ga0213872_10001620 3300021361 Bacteria 14255
125 Ga0213872_10030410 3300021361 Bacteria 2475
126 Ga0213872_10109214 3300021361 Bacteria 1229
127 Ga0213876_10196465 3300021384 Bacteria 1072
128 Ga0213871_10016050 3300021441 Bacteria 1799
129 Ga0224712_10194501 3300022467 Bacteria 919
130 Ga0209676_1069677 3300025292 Bacteria 841
131 Ga0209256_1000860 3300025299 Bacteria 37820
132 Ga0207647_10002069 3300025904 Bacteria 15336
133 Ga0207643_10459264 3300025908 Unclassified 811
134 Ga0207705_10058636 3300025909 Bacteria 2777
135 Ga0207654_10908918 3300025911 Bacteria 638
136 Ga0207707_10389532 3300025912 Bacteria 1197
137 Ga0207695_10046148 3300025913 Bacteria 4620
138 Ga0207663_10785001 3300025916 Unclassified 758
139 Ga0207657_10009741 3300025919 Bacteria 9634
140 Ga0207649_10830884 3300025920 Bacteria 722
141 Ga0207646_11374706 3300025922 Unclassified 615
142 Ga0207646_11465948 3300025922 Unclassified 592
143 Ga0207659_11225378 3300025926 Bacteria 645
144 Ga0207687_11328882 3300025927 Bacteria 618
145 Ga0207687_11518730 3300025927 Bacteria 575
146 Ga0207670_10294331 3300025936 Bacteria 1269
147 Ga0207691_10206191 3300025940 Bacteria 1709
148 Ga0207711_10094723 3300025941 Bacteria 2632
149 Ga0207711_10108802 3300025941 Bacteria 2463
150 Ga0207661_10984016 3300025944 Unclassified 777
151 Ga0207667_10020899 3300025949 Bacteria 7263
152 Ga0207667_10382189 3300025949 Bacteria 1435
153 Ga0207667_10566010 3300025949 Bacteria 1148
154 Ga0207651_10544959 3300025960 Unclassified 1008
155 Ga0207640_11004203 3300025981 Unclassified 734
156 Ga0207658_11177129 3300025986 Unclassified 701
157 Ga0207703_10393621 3300026035 Bacteria 1284
158 Ga0207703_11135429 3300026035 Bacteria 751
159 Ga0207678_10256696 3300026067 Bacteria 1498
160 Ga0207702_10420691 3300026078 Bacteria 1292
161 Ga0207702_10697810 3300026078 Bacteria 1000
162 Ga0207702_11058976 3300026078 Bacteria 805
163 Ga0207641_11354235 3300026088 Unclassified 712
164 Ga0207676_12297288 3300026095 Bacteria 537
165 Ga0209588_1079830 3300027671 Bacteria 1057
166 Ga0268266_11862080 3300028379 Unclassified 576
167 Ga0265760_10231961 3300031090 Unclassified 633
168 Ga0265325_10025127 3300031241 Bacteria 3236
169 Ga0265331_10264380 3300031250 Bacteria 771
170 Ga0265316_10002421 3300031344 Bacteria 19398
171 Ga0265316_10203501 3300031344 Unclassified 1467
172 Ga0265316_10315737 3300031344 Bacteria 1136
173 Ga0307408_100035530 3300031548 Bacteria 3498
174 Ga0265313_10428455 3300031595 Bacteria 516
175 Ga0265342_10058787 3300031712 Unclassified 2272
176 Ga0307405_10333675 3300031731 Bacteria 1163
177 Ga0307405_11042823 3300031731 Bacteria 700
178 Ga0307413_11072298 3300031824 Bacteria 694
179 Ga0307410_10351655 3300031852 Bacteria 1178
180 Ga0307410_10866119 3300031852 Bacteria 772
181 Ga0307406_10651380 3300031901 Bacteria 874
182 Ga0307412_10109825 3300031911 Bacteria 1967
183 Ga0307416_100016103 3300032002 Bacteria 5184
184 Ga0307415_100561558 3300032126 Bacteria 1009
185 Ga0316580_10172816 3300032139 Unclassified 664
186 Ga0373959_0019086 3300034820 Bacteria 1296
187 Ga0373954_0043640 3300035118 Bacteria 2091
188 Ga0373956_0279703 3300035119 Unclassified 794
189 Ga0373935_0747945 3300035692 Unclassified 720
190 Ga0373933_0089632 3300035724 Bacteria 1896
191 Ga0395899_0337627 3300037312 Bacteria 1011
192 Ga0395900_0119021 3300037418 Bacteria 2711
193 Ga0395898_0396381 3300037466 Bacteria 1316
194 Ga0395901_0534492 3300038443 Bacteria 1190
195 Ga0436360_0405272 3300039438 Bacteria 1900
196 Ga0436360_0627023 3300039438 Unclassified 758
197 Ga0436361_0159793 3300039447 Bacteria 12742
198 Ga0436361_0645665 3300039447 Bacteria 29461
199 Ga0436361_1045371 3300039447 Bacteria 3528
200 Ga0436361_1180380 3300039447 Bacteria 13463
201 Ga0436363_0012262 3300039450 Bacteria 1376
202 Ga0436363_0979107 3300039450 Unclassified 543
203 Ga0436362_0038203 3300039453 Bacteria 1301
204 Ga0436362_0589286 3300039453 Unclassified 781
205 Ga0436362_1299580 3300039453 Bacteria 1246
206 Ga0451853_2713949 3300041512 Bacteria 2431
207 Ga0439448_0000204 3300042005 Bacteria 12343
208 Ga0451577_0001563 3300042876 Bacteria 30020
209 Ga0453683_0489303 3300044673 Bacteria 798
210 Ga0466963_0071808 3300044694 Bacteria 2330
211 Ga0453684_0004269 3300044712 Bacteria 30512
212 Ga0466967_0032007 3300045976 Bacteria 4436
213 Ga0495627_014226 3300046453 Bacteria 2782
214 Ga0495592_0314597 3300046454 Unclassified 1014
215 Ga0495651_0063767 3300046462 Unclassified 2816
216 Ga0495664_0053691 3300046477 Bacteria 2396
217 Ga0495584_0011545 3300046491 Bacteria 4526
218 Ga0495585_0074870 3300046492 Bacteria 1841
219 Ga0495596_0011631 3300046500 Bacteria 3787
220 Ga0495608_0075574 3300046511 Unclassified 2195
221 Ga0495610_0014088 3300046512 Bacteria 4717
222 Ga0495628_0013921 3300046516 Bacteria 6755
223 Ga0495631_0011464 3300046518 Bacteria 4356
224 Ga0495644_0042930 3300046523 Bacteria 1702
225 Ga0495642_0006534 3300046528 Bacteria 4473
226 Ga0495652_0358281 3300046529 Unclassified 1043
227 Ga0495640_0153568 3300046533 Unclassified 1478
228 Ga0495640_0575332 3300046533 Unclassified 682
229 Ga0495597_0011539 3300046542 Bacteria 4281
230 Ga0495645_0016273 3300046543 Bacteria 5306
231 Ga0495633_0101770 3300046558 Bacteria 1333
232 Ga0495668_0005985 3300046616 Bacteria 8079
233 Ga0495611_0310336 3300046648 Bacteria 726
234 Ga0495659_0058872 3300046664 Unclassified 1415
235 Ga0495661_0007250 3300046665 Bacteria 7735
236 Ga0495657_0195347 3300046675 Unclassified 1235
237 Ga0495599_0036961 3300046678 Bacteria 3068
238 Ga0495646_0013904 3300046680 Bacteria 5116
239 Ga0495669_0220458 3300046684 Bacteria 909
240 Ga0495669_0527603 3300046684 Bacteria 574
241 Ga0495670_0004409 3300046691 Bacteria 6905
242 Ga0495589_0193602 3300046794 Bacteria 961
243 Ga0495674_0031446 3300047319 Bacteria 4822
244 Ga0495674_0051416 3300047319 Bacteria 3633
245 Ga0495680_0226582 3300047322 Unclassified 1332
246 Ga0495675_0004469 3300047444 Bacteria 8469
247 Ga0495677_0030714 3300047445 Bacteria 1955
248 Ga0495677_0046094 3300047445 Bacteria 1600
249 Ga0495677_0355599 3300047445 Bacteria 578
250 Ga0495681_0018839 3300047470 Bacteria 3788
251 Ga0495684_0136661 3300047471 Bacteria 1839
252 Ga0495602_0000654 3300048088 Bacteria 32531
253 Ga0496100_0142303 3300048903 Bacteria 1701
254 Ga0496101_0004407 3300048904 Bacteria 8851
255 Ga0496102_0004534 3300048905 Bacteria 11740
256 Ga0496103_0006811 3300048906 Bacteria 6821
257 Ga0496104_0060978 3300048907 Bacteria 3574
258 Ga0496105_0002236 3300048908 Bacteria 14021
259 Ga0496106_0347656 3300048909 Bacteria 1191
260 Ga0496108_0070338 3300048911 Bacteria 2953
261 Ga0496110_0027612 3300048913 Bacteria 4866
262 Ga0496110_0060386 3300048913 Bacteria 3343
263 Ga0496111_0135632 3300048914 Bacteria 1823
264 Ga0496112_0478420 3300048915 Bacteria 1182
265 Ga0496114_0011837 3300048917 Bacteria 6979
266 Ga0496118_0158149 3300048921 Bacteria 1406
267 Ga0496121_0046503 3300048924 Bacteria 3714
268 Ga0496123_0348156 3300048926 Unclassified 690
269 Ga0501299_002940 3300049522 Bacteria 2415
270 Ga0501303_008726 3300049526 Bacteria 925
271 Ga0501031_0581497 3300049568 Unclassified 721
272 Ga0501033_0104943 3300049570 Bacteria 2060
273 Ga0501033_0432681 3300049570 Unclassified 915
274 Ga0501034_0022870 3300049571 Bacteria 6368
275 Ga0501034_0709622 3300049571 Bacteria 904
276 Ga0501036_1165043 3300049572 Unclassified 629
277 Ga0501038_0599499 3300049574 Unclassified 834
278 Ga0501043_0177239 3300049579 Bacteria 1662
279 Ga0501047_0006159 3300049581 Bacteria 11281
280 Ga0501070_0019276 3300049586 Bacteria 5721
281 Ga0501071_1542851 3300049587 Unclassified 513
282 Ga0501073_0338887 3300049589 Unclassified 1038
283 Ga0501074_0780536 3300049590 Unclassified 673
284 Ga0501075_1545758 3300049591 Unclassified 502
285 Ga0501217_106355 3300049661 Bacteria 802
286 Ga0501080_0228306 3300049742 Bacteria 1702
287 Ga0501081_0277582 3300049743 Unclassified 1226
288 Ga0501263_033308 3300049760 Bacteria 735
289 Ga0501279_074821 3300049775 Bacteria 576
290 Ga0501035_0003460 3300049822 Bacteria 15111
291 Ga0501044_0227275 3300049823 Bacteria 1815
292 Ga0501212_024796 3300049851 Bacteria 945
293 nmdc:mga05p37_136998_c1 3300050507 Bacteria 3001
294 nmdc:mga05p37_19720_c2 3300050507 Bacteria 7275
295 nmdc:mga05p37_507005_c1 3300050507 Bacteria 1383
296 nmdc:mga05p37_8493_c1 3300050507 Bacteria 12142
297 nmdc:mga06r32_388960_c1 3300050510 Bacteria 1377
298 nmdc:mga0n895_12590_c1 3300050512 Bacteria 7593
299 nmdc:mga0n895_907875_c1 3300050512 Unclassified 866
300 nmdc:mga0rr50_30437_c1 3300050513 Bacteria 3821
301 nmdc:mga0a205_289470_c1 3300050515 Bacteria 1513
302 Ga0495601_0008841 3300053077 Bacteria 5944
303 Ga0495612_0000488 3300053078 Bacteria 15818
304 Ga0495595_0035750 3300053084 Bacteria 2251
305 Ga0495619_0020969 3300053085 Bacteria 4168
306 Ga0500559_0000071 3300053136 Bacteria 81143
307 Ga0500568_0010982 3300053139 Bacteria 4219
308 Ga0500616_0000226 3300053153 Bacteria 88101
309 Ga0500599_068305 3300053736 Unclassified 587
310 Ga0590074_064430 3300059423 Bacteria 685
311 Ga0530510_0730364 3300061734 Bacteria 755
312 8055273090 8055266321 Bacteria 7999742
313 Ga0070663_101810647
314 JGI24735J21928_10002515
315 JGI24735J21928_10005364
316 JGI24735J21928_10024650
317 rootL2_10302801
318 Ga0065715_10279040
319 Ga0070658_10088045
320 Ga0070683_100566533
321 Ga0070670_100434278
322 Ga0070677_10070747
323 Ga0070666_10109975
324 Ga0070666_11148190
325 Ga0070680_100014220
326 Ga0070660_100107460
327 Ga0070661_100857510
328 Ga0070675_100981345
329 Ga0070675_101540898
330 Ga0070671_100649957
331 Ga0070671_101827487
332 Ga0070674_100143024
333 Ga0070673_100386746
334 Ga0070659_100593596
335 Ga0070667_100159579
336 Ga0070667_101617414
337 Ga0070714_100673867
338 Ga0070714_100776556
339 Ga0070701_10962188
340 Ga0070705_100216695
341 Ga0070694_100535111
342 Ga0070708_100663999
343 Ga0070681_10030118
344 Ga0070706_102162458
345 Ga0070707_100199303
346 Ga0070707_100379008
347 Ga0070698_100511481
348 Ga0070699_100144358
349 Ga0070699_100194142
350 Ga0070684_100379543
351 Ga0070697_100493896
352 Ga0068853_100974489
353 Ga0070672_100085454
354 Ga0070696_100446261
355 Ga0070696_100596720
356 Ga0070665_100083822
357 Ga0070704_100228252
358 Ga0070704_101990841
359 Ga0068855_100017737
360 Ga0068855_100242898
361 Ga0068855_100841057
362 Ga0068854_101403574
363 Ga0068854_101707472
364 Ga0068856_100006770
365 Ga0068856_100823278
366 Ga0068856_101410367
367 Ga0068856_101917948
368 Ga0068864_101635631
369 Ga0068870_10325027
370 Ga0068863_101166543
371 Ga0068858_100394395
372 Ga0068858_101707479
373 Ga0070717_11720113
374 Ga0075369_10092619
375 Ga0097621_100344334
376 Ga0097621_100561143
377 Ga0097621_101709326
378 Ga0068871_100348703
379 Ga0068871_100537845
380 Ga0068871_100815868
381 Ga0075433_10004258
382 Ga0075434_100105354
383 Ga0075429_100070462
384 Ga0075436_100014664
385 Ga0075435_100420581
386 Ga0099794_10147716
387 Ga0105240_10061017
388 Ga0105245_10276329
389 Ga0105245_11352555
390 Ga0114129_10027409
391 Ga0114129_10285903
392 Ga0105243_10603267
393 Ga0105241_10253010
394 Ga0105241_11643567
395 Ga0105242_11374830
396 Ga0105248_10140979
397 Ga0105237_10030546
398 Ga0105238_12171414
399 Ga0105249_13590223
400 Ga0105239_10015478
401 Ga0105239_11283629
402 Ga0105246_10640832
403 Ga0157373_10006534
404 Ga0157370_10013107
405 Ga0157370_10067586
406 Ga0157370_11394119
407 Ga0157369_10005345
408 Ga0157369_10333619
409 Ga0157369_11799222
410 Ga0157374_10001147
411 Ga0163162_10079957
412 Ga0157372_10118772
413 Ga0157372_10181622
414 Ga0157375_10276361
415 Ga0157375_10467043
416 Ga0163163_10101733
417 Ga0163163_10192331
418 Ga0163163_10350840
419 Ga0163163_10792906
420 Ga0163163_11508165
421 Ga0182008_10036876
422 Ga0182008_10233299
423 Ga0157379_10037964
424 Ga0157379_11107005
425 Ga0157376_10302796
426 Ga0157376_11034945
427 Ga0182006_1064729
428 Ga0182007_10006630
429 Ga0163161_10064617
430 Ga0163161_11202388
431 Ga0197907_11062602
432 Ga0206355_1462660
433 Ga0206350_10985001
434 Ga0206353_11484750
435 Ga0213873_10080479
436 Ga0213872_10001620
437 Ga0213872_10030410
438 Ga0213872_10109214
439 Ga0213876_10196465
440 Ga0213871_10016050
441 Ga0224712_10194501
442 Ga0209676_1069677
443 Ga0209256_1000860
444 Ga0207647_10002069
445 Ga0207643_10459264
446 Ga0207705_10058636
447 Ga0207654_10908918
448 Ga0207707_10389532
449 Ga0207695_10046148
450 Ga0207663_10785001
451 Ga0207657_10009741
452 Ga0207649_10830884
453 Ga0207646_11374706
454 Ga0207646_11465948
455 Ga0207659_11225378
456 Ga0207687_11328882
457 Ga0207687_11518730
458 Ga0207670_10294331
459 Ga0207691_10206191
460 Ga0207711_10094723
461 Ga0207711_10108802
462 Ga0207661_10984016
463 Ga0207667_10020899
464 Ga0207667_10382189
465 Ga0207667_10566010
466 Ga0207651_10544959
467 Ga0207640_11004203
468 Ga0207658_11177129
469 Ga0207703_10393621
470 Ga0207703_11135429
471 Ga0207678_10256696
472 Ga0207702_10420691
473 Ga0207702_10697810
474 Ga0207702_11058976
475 Ga0207641_11354235
476 Ga0207676_12297288
477 Ga0209588_1079830
478 Ga0268266_11862080
479 Ga0265760_10231961
480 Ga0265325_10025127
481 Ga0265331_10264380
482 Ga0265316_10002421
483 Ga0265316_10203501
484 Ga0265316_10315737
485 Ga0307408_100035530
486 Ga0265313_10428455
487 Ga0265342_10058787
488 Ga0307405_10333675
489 Ga0307405_11042823
490 Ga0307413_11072298
491 Ga0307410_10351655
492 Ga0307410_10866119
493 Ga0307406_10651380
494 Ga0307412_10109825
495 Ga0307416_100016103
496 Ga0307415_100561558
497 Ga0316580_10172816
498 Ga0373959_0019086
499 Ga0373954_0043640
500 Ga0373956_0279703
501 Ga0373935_0747945
502 Ga0373933_0089632
503 Ga0395899_0337627
504 Ga0395900_0119021
505 Ga0395898_0396381
506 Ga0395901_0534492
507 Ga0436360_0405272
508 Ga0436360_0627023
509 Ga0436361_0159793
510 Ga0436361_0645665
511 Ga0436361_1045371
512 Ga0436361_1180380
513 Ga0436363_0012262
514 Ga0436363_0979107
515 Ga0436362_0038203
516 Ga0436362_0589286
517 Ga0436362_1299580
518 Ga0451853_2713949
519 Ga0439448_0000204
520 Ga0451577_0001563
521 Ga0453683_0489303
522 Ga0466963_0071808
523 Ga0453684_0004269
524 Ga0466967_0032007
525 Ga0495627_014226
526 Ga0495592_0314597
527 Ga0495651_0063767
528 Ga0495664_0053691
529 Ga0495584_0011545
530 Ga0495585_0074870
531 Ga0495596_0011631
532 Ga0495608_0075574
533 Ga0495610_0014088
534 Ga0495628_0013921
535 Ga0495631_0011464
536 Ga0495644_0042930
537 Ga0495642_0006534
538 Ga0495652_0358281
539 Ga0495640_0153568
540 Ga0495640_0575332
541 Ga0495597_0011539
542 Ga0495645_0016273
543 Ga0495633_0101770
544 Ga0495668_0005985
545 Ga0495611_0310336
546 Ga0495659_0058872
547 Ga0495661_0007250
548 Ga0495657_0195347
549 Ga0495599_0036961
550 Ga0495646_0013904
551 Ga0495669_0220458
552 Ga0495669_0527603
553 Ga0495670_0004409
554 Ga0495589_0193602
555 Ga0495674_0031446
556 Ga0495674_0051416
557 Ga0495680_0226582
558 Ga0495675_0004469
559 Ga0495677_0030714
560 Ga0495677_0046094
561 Ga0495677_0355599
562 Ga0495681_0018839
563 Ga0495684_0136661
564 Ga0495602_0000654
565 Ga0496100_0142303
566 Ga0496101_0004407
567 Ga0496102_0004534
568 Ga0496103_0006811
569 Ga0496104_0060978
570 Ga0496105_0002236
571 Ga0496106_0347656
572 Ga0496108_0070338
573 Ga0496110_0027612
574 Ga0496110_0060386
575 Ga0496111_0135632
576 Ga0496112_0478420
577 Ga0496114_0011837
578 Ga0496118_0158149
579 Ga0496121_0046503
580 Ga0496123_0348156
581 Ga0501299_002940
582 Ga0501303_008726
583 Ga0501031_0581497
584 Ga0501033_0104943
585 Ga0501033_0432681
586 Ga0501034_0022870
587 Ga0501034_0709622
588 Ga0501036_1165043
589 Ga0501038_0599499
590 Ga0501043_0177239
591 Ga0501047_0006159
592 Ga0501070_0019276
593 Ga0501071_1542851
594 Ga0501073_0338887
595 Ga0501074_0780536
596 Ga0501075_1545758
597 Ga0501217_106355
598 Ga0501080_0228306
599 Ga0501081_0277582
600 Ga0501263_033308
601 Ga0501279_074821
602 Ga0501035_0003460
603 Ga0501044_0227275
604 Ga0501212_024796
605 nmdc:mga05p37_136998_c1
606 nmdc:mga05p37_19720_c2
607 nmdc:mga05p37_507005_c1
608 nmdc:mga05p37_8493_c1
609 nmdc:mga06r32_388960_c1
610 nmdc:mga0n895_12590_c1
611 nmdc:mga0n895_907875_c1
612 nmdc:mga0rr50_30437_c1
613 nmdc:mga0a205_289470_c1
614 Ga0495601_0008841
615 Ga0495612_0000488
616 Ga0495595_0035750
617 Ga0495619_0020969
618 Ga0500559_0000071
619 Ga0500568_0010982
620 Ga0500616_0000226
621 Ga0500599_068305
622 Ga0590074_064430
623 Ga0530510_0730364
624 8055273090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

14

115

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xe2-assembly1.cif.gz_A-2 endoribonuclease from mycobacterial species 0.9033 2 102
5co7-assembly3.cif.gz_F e. coli mazf form iii 0.8849 4 106
5xe3-assembly1.cif.gz_A endoribonuclease in complex with its cognate antitoxin from mycobacterial species 0.8814 1 102
5hjz-assembly1.cif.gz_A structure of m. tuberculosis mazf-mt1 (rv2801c) in complex with rna 0.8806 2 102
5ckh-assembly1.cif.gz_A e. coli mazf e24a form iib 0.8788 4 105
ID Description Score Start End Superfamily
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8833 2 102 2.30.30.110
2mf2B00 Mainly Beta;Roll;SH3 type barrels.; 0.8663 2 102 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8614 4 102 2.30.30.110
af_P71650_1_116_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.859 1 102 2.30.30.110
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.8532 1 106 2.30.30.110
ID Description Score Start End GO Terms
AF-S0FQG5-F1-model_v4 Transcriptional modulator of MazE/toxin, MazF 0.9747 38 106 GO:0003677
AF-A0A388RMV5-F1-model_v4 Uncharacterized protein 0.9691 34 106 GO:0003677
AF-A0A259IGU8-F1-model_v4 Growth inhibitor PemK 0.9688 25 106 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A3D4Z0D7-F1-model_v4 Transcriptional regulator 0.9679 42 106 GO:0003677
AF-A0A382RXS8-F1-model_v4 PemK-like protein 0.9676 26 106 GO:0003677

Map