F401537
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 312 | 154 | 624 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10107088|Ga0070658_101070884 |
| Length | 242 |
| Sequence | MLHKTRGIVLKTTDYGESSVIVQVFTEKFGLQSYMVNGVKKPKAKINRNMLQPLHLLDMVVYHKGGGSNVQRISEVKNSPLLQTIPYDVIKSSIAMFLNEVLYKSVRQHPEDIHLFDFIFNAVEWLDHQNEGLANFHLLFLIQLTRYLGFYPDKFMMDEADYFDMKNGNFCRYKPDSVLYLSPPHTQNFAALLNTSFENISQLKFGNDERRYLLAKLLDYYALHIESFGIVRSHEILEEILS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 61 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 95 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 96 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 97 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 98 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 99 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 100 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 101 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 102 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 103 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 104 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 105 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 106 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 107 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 108 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 109 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 110 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 111 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 112 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 113 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 141 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 142 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 143 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 144 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 145 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 146 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 147 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 148 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 149 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 150 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 151 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 152 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 153 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 154 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.44 |
| Metatranscriptomes | 0 |
| Isolates | 2.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.97 |
| Nodule | 0 |
| Rhizoplane | 0.32 |
| Rhizosphere | 81.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10107088 | 3300005327 | Bacteria | 2313 |
| 2 | JGI24736J21556_1010309 | 3300001904 | Bacteria | 1527 |
| 3 | JGI24740J21852_10044086 | 3300001979 | Bacteria | 1326 |
| 4 | JGI24739J22299_10066783 | 3300001989 | Bacteria | 1126 |
| 5 | JGI24739J22299_10076114 | 3300001989 | Bacteria | 1036 |
| 6 | JGI24737J22298_10000323 | 3300001990 | Bacteria | 16025 |
| 7 | JGI24737J22298_10012147 | 3300001990 | Bacteria | 2811 |
| 8 | JGI24735J21928_10000027 | 3300002067 | Bacteria | 83494 |
| 9 | JGI25162J39368_1000008 | 3300002737 | Bacteria | 397212 |
| 10 | JGI25164J39214_1001396 | 3300002772 | Bacteria | 5740 |
| 11 | JGI25165J46597_1000461 | 3300003214 | Bacteria | 40249 |
| 12 | JGI25165J46597_1016834 | 3300003214 | Bacteria | 978 |
| 13 | rootH1_10010188 | 3300003316 | Bacteria | 3622 |
| 14 | rootH1_10016545 | 3300003316 | Bacteria | 8256 |
| 15 | rootH1_10095820 | 3300003316 | Unclassified | 1438 |
| 16 | rootH2_10005644 | 3300003320 | Bacteria | 16297 |
| 17 | rootH2_10005827 | 3300003320 | Bacteria | 117906 |
| 18 | rootH2_10094259 | 3300003320 | Bacteria | 4664 |
| 19 | rootH2_10144991 | 3300003320 | Bacteria | 2992 |
| 20 | rootH2_10167934 | 3300003320 | Bacteria | 1337 |
| 21 | rootL2_10080998 | 3300003322 | Bacteria | 1916 |
| 22 | rootL2_10153329 | 3300003322 | Bacteria | 4717 |
| 23 | rootH1_10013674 | 3300003323 | Bacteria | 50224 |
| 24 | rootH1_10040403 | 3300003323 | Unclassified | 2463 |
| 25 | rootH1_10183596 | 3300003323 | Bacteria | 4693 |
| 26 | rootH1_10250426 | 3300003323 | Unclassified | 1331 |
| 27 | rootH1_10314053 | 3300003323 | Bacteria | 2349 |
| 28 | Ga0065714_10009278 | 3300005288 | Bacteria | 2652 |
| 29 | Ga0070658_10000075 | 3300005327 | Bacteria | 95412 |
| 30 | Ga0070676_10000485 | 3300005328 | Bacteria | 18960 |
| 31 | Ga0068869_100271822 | 3300005334 | Bacteria | 1360 |
| 32 | Ga0068868_100003434 | 3300005338 | Bacteria | 11034 |
| 33 | Ga0068868_100077272 | 3300005338 | Bacteria | 2663 |
| 34 | Ga0070660_100043461 | 3300005339 | Bacteria | 3434 |
| 35 | Ga0070660_100055393 | 3300005339 | Bacteria | 3064 |
| 36 | Ga0070660_100068355 | 3300005339 | Unclassified | 2769 |
| 37 | Ga0070660_100356903 | 3300005339 | Bacteria | 1204 |
| 38 | Ga0070671_100009159 | 3300005355 | Bacteria | 7948 |
| 39 | Ga0070674_100075656 | 3300005356 | Bacteria | 2392 |
| 40 | Ga0070673_100002721 | 3300005364 | Bacteria | 10843 |
| 41 | Ga0070659_100000325 | 3300005366 | Bacteria | 36617 |
| 42 | Ga0070659_100020562 | 3300005366 | Bacteria | 5017 |
| 43 | Ga0070659_100124825 | 3300005366 | Unclassified | 2088 |
| 44 | Ga0070678_100006465 | 3300005456 | Bacteria | 6881 |
| 45 | Ga0070662_100000026 | 3300005457 | Bacteria | 83930 |
| 46 | Ga0070662_100109059 | 3300005457 | Bacteria | 2106 |
| 47 | Ga0070679_100138135 | 3300005530 | Bacteria | 2418 |
| 48 | Ga0070679_100148248 | 3300005530 | Bacteria | 2324 |
| 49 | Ga0070679_100548453 | 3300005530 | Bacteria | 1100 |
| 50 | Ga0070684_100023992 | 3300005535 | Bacteria | 5111 |
| 51 | Ga0068853_100036703 | 3300005539 | Bacteria | 4169 |
| 52 | Ga0068853_100039464 | 3300005539 | Bacteria | 4027 |
| 53 | Ga0068853_100084529 | 3300005539 | Bacteria | 2781 |
| 54 | Ga0070665_100000284 | 3300005548 | Bacteria | 82062 |
| 55 | Ga0068855_100000218 | 3300005563 | Bacteria | 73075 |
| 56 | Ga0068855_100009983 | 3300005563 | Bacteria | 11442 |
| 57 | Ga0068855_100037044 | 3300005563 | Bacteria | 5803 |
| 58 | Ga0068855_100041227 | 3300005563 | Bacteria | 5472 |
| 59 | Ga0068855_101008352 | 3300005563 | Bacteria | 874 |
| 60 | Ga0068857_100057332 | 3300005577 | Bacteria | 3457 |
| 61 | Ga0068857_100063412 | 3300005577 | Bacteria | 3285 |
| 62 | Ga0068856_100022243 | 3300005614 | Bacteria | 6164 |
| 63 | Ga0068856_100096336 | 3300005614 | Bacteria | 2947 |
| 64 | Ga0068852_100003814 | 3300005616 | Bacteria | 10581 |
| 65 | Ga0068852_100045967 | 3300005616 | Bacteria | 3717 |
| 66 | Ga0068866_10090594 | 3300005718 | Bacteria | 1664 |
| 67 | Ga0068851_10322978 | 3300005834 | Bacteria | 892 |
| 68 | Ga0075366_10000172 | 3300006195 | Bacteria | 27863 |
| 69 | Ga0075366_10000471 | 3300006195 | Bacteria | 18733 |
| 70 | Ga0075366_10084617 | 3300006195 | Bacteria | 1896 |
| 71 | Ga0097621_100000321 | 3300006237 | Bacteria | 32515 |
| 72 | Ga0068871_100000450 | 3300006358 | Bacteria | 28265 |
| 73 | Ga0068865_100000582 | 3300006881 | Bacteria | 20467 |
| 74 | Ga0105240_10001259 | 3300009093 | Bacteria | 43960 |
| 75 | Ga0105240_10009108 | 3300009093 | Bacteria | 14094 |
| 76 | Ga0105240_10015506 | 3300009093 | Bacteria | 10360 |
| 77 | Ga0105240_10228884 | 3300009093 | Bacteria | 2162 |
| 78 | Ga0105240_10269811 | 3300009093 | Bacteria | 1960 |
| 79 | Ga0105240_10419484 | 3300009093 | Bacteria | 1504 |
| 80 | Ga0105240_10495408 | 3300009093 | Bacteria | 1360 |
| 81 | Ga0105240_10838320 | 3300009093 | Bacteria | 993 |
| 82 | Ga0105240_10964603 | 3300009093 | Bacteria | 914 |
| 83 | Ga0105243_10486172 | 3300009148 | Unclassified | 1166 |
| 84 | Ga0105241_10000539 | 3300009174 | Bacteria | 28510 |
| 85 | Ga0105241_10023762 | 3300009174 | Bacteria | 4548 |
| 86 | Ga0105241_10050196 | 3300009174 | Bacteria | 3179 |
| 87 | Ga0105241_10597820 | 3300009174 | Bacteria | 996 |
| 88 | Ga0105242_10026174 | 3300009176 | Bacteria | 4623 |
| 89 | Ga0105237_10000215 | 3300009545 | Bacteria | 81284 |
| 90 | Ga0105237_10000758 | 3300009545 | Bacteria | 44281 |
| 91 | Ga0105237_10011689 | 3300009545 | Bacteria | 9287 |
| 92 | Ga0105237_10013448 | 3300009545 | Bacteria | 8582 |
| 93 | Ga0105237_10020811 | 3300009545 | Bacteria | 6756 |
| 94 | Ga0105237_10055877 | 3300009545 | Bacteria | 3953 |
| 95 | Ga0105237_10092725 | 3300009545 | Bacteria | 3010 |
| 96 | Ga0105237_10092948 | 3300009545 | Bacteria | 3006 |
| 97 | Ga0105237_10179652 | 3300009545 | Bacteria | 2116 |
| 98 | Ga0105237_10398163 | 3300009545 | Bacteria | 1382 |
| 99 | Ga0105238_10000693 | 3300009551 | Bacteria | 35265 |
| 100 | Ga0105238_10019749 | 3300009551 | Bacteria | 6861 |
| 101 | Ga0105238_10071970 | 3300009551 | Bacteria | 3454 |
| 102 | Ga0105238_10356603 | 3300009551 | Bacteria | 1451 |
| 103 | Ga0105249_10670207 | 3300009553 | Bacteria | 1096 |
| 104 | Ga0105239_10000008 | 3300010375 | Bacteria | 376925 |
| 105 | Ga0105239_10000012 | 3300010375 | Bacteria | 332279 |
| 106 | Ga0105239_10000285 | 3300010375 | Bacteria | 74551 |
| 107 | Ga0105239_10000955 | 3300010375 | Bacteria | 40720 |
| 108 | Ga0105239_10003362 | 3300010375 | Bacteria | 19653 |
| 109 | Ga0105239_10094758 | 3300010375 | Bacteria | 3297 |
| 110 | Ga0105239_10235499 | 3300010375 | Bacteria | 2055 |
| 111 | Ga0105239_10340279 | 3300010375 | Bacteria | 1693 |
| 112 | Ga0105239_10469800 | 3300010375 | Bacteria | 1428 |
| 113 | Ga0105239_10927691 | 3300010375 | Bacteria | 1000 |
| 114 | Ga0105246_10047214 | 3300011119 | Bacteria | 2940 |
| 115 | Ga0157373_10000040 | 3300013100 | Bacteria | 114771 |
| 116 | Ga0157373_10169215 | 3300013100 | Bacteria | 1538 |
| 117 | Ga0157371_10000571 | 3300013102 | Bacteria | 43698 |
| 118 | Ga0157371_10012884 | 3300013102 | Bacteria | 6367 |
| 119 | Ga0157371_10016919 | 3300013102 | Bacteria | 5430 |
| 120 | Ga0157371_10025841 | 3300013102 | Unclassified | 4273 |
| 121 | Ga0157370_10053393 | 3300013104 | Bacteria | 3854 |
| 122 | Ga0157369_10008991 | 3300013105 | Bacteria | 11443 |
| 123 | Ga0157369_10790732 | 3300013105 | Bacteria | 975 |
| 124 | Ga0157374_10000076 | 3300013296 | Bacteria | 97502 |
| 125 | Ga0157374_10440132 | 3300013296 | Bacteria | 1304 |
| 126 | Ga0157374_11048425 | 3300013296 | Bacteria | 835 |
| 127 | Ga0157378_10049079 | 3300013297 | Bacteria | 3755 |
| 128 | Ga0157378_10061266 | 3300013297 | Bacteria | 3357 |
| 129 | Ga0157378_10157253 | 3300013297 | Bacteria | 2123 |
| 130 | Ga0163162_10000044 | 3300013306 | Bacteria | 128200 |
| 131 | Ga0163162_10000985 | 3300013306 | Bacteria | 26500 |
| 132 | Ga0163162_10046291 | 3300013306 | Bacteria | 4359 |
| 133 | Ga0157372_10000182 | 3300013307 | Bacteria | 69439 |
| 134 | Ga0157372_10000432 | 3300013307 | Bacteria | 46220 |
| 135 | Ga0157372_10000538 | 3300013307 | Bacteria | 41695 |
| 136 | Ga0157372_10001687 | 3300013307 | Bacteria | 23876 |
| 137 | Ga0157372_10033736 | 3300013307 | Bacteria | 5624 |
| 138 | Ga0157372_10043504 | 3300013307 | Bacteria | 4972 |
| 139 | Ga0157372_10126753 | 3300013307 | Bacteria | 2936 |
| 140 | Ga0157375_10031523 | 3300013308 | Bacteria | 5013 |
| 141 | Ga0157375_10079086 | 3300013308 | Bacteria | 3323 |
| 142 | Ga0157377_10008329 | 3300014745 | Bacteria | 5053 |
| 143 | Ga0157376_10066632 | 3300014969 | Bacteria | 3044 |
| 144 | Ga0163161_10015660 | 3300017792 | Bacteria | 5287 |
| 145 | Ga0213872_10011212 | 3300021361 | Bacteria | 4245 |
| 146 | Ga0209563_103615 | 3300025230 | Bacteria | 3149 |
| 147 | Ga0207427_100138 | 3300025231 | Bacteria | 86499 |
| 148 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 149 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 150 | Ga0209026_1000292 | 3300025250 | Bacteria | 56639 |
| 151 | Ga0209026_1008279 | 3300025250 | Bacteria | 2192 |
| 152 | Ga0209148_1024377 | 3300025254 | Bacteria | 956 |
| 153 | Ga0209148_1025819 | 3300025254 | Bacteria | 917 |
| 154 | Ga0209129_1009533 | 3300025258 | Bacteria | 2543 |
| 155 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 156 | Ga0209233_1001084 | 3300025261 | Bacteria | 11223 |
| 157 | Ga0209233_1017349 | 3300025261 | Bacteria | 1964 |
| 158 | Ga0209233_1028181 | 3300025261 | Unclassified | 1351 |
| 159 | Ga0209455_1001823 | 3300025272 | Bacteria | 8945 |
| 160 | Ga0207642_10066079 | 3300025899 | Bacteria | 1702 |
| 161 | Ga0207647_10000027 | 3300025904 | Bacteria | 109872 |
| 162 | Ga0207647_10000080 | 3300025904 | Bacteria | 71854 |
| 163 | Ga0207647_10150268 | 3300025904 | Bacteria | 1362 |
| 164 | Ga0207647_10151848 | 3300025904 | Bacteria | 1353 |
| 165 | Ga0207645_10002125 | 3300025907 | Bacteria | 15863 |
| 166 | Ga0207705_10000102 | 3300025909 | Bacteria | 98105 |
| 167 | Ga0207705_10153409 | 3300025909 | Bacteria | 1727 |
| 168 | Ga0207654_10001274 | 3300025911 | Bacteria | 13419 |
| 169 | Ga0207654_10008230 | 3300025911 | Bacteria | 5264 |
| 170 | Ga0207654_10076589 | 3300025911 | Bacteria | 2003 |
| 171 | Ga0207695_10000183 | 3300025913 | Bacteria | 181350 |
| 172 | Ga0207695_10002635 | 3300025913 | Bacteria | 26250 |
| 173 | Ga0207695_10011138 | 3300025913 | Bacteria | 10912 |
| 174 | Ga0207695_10011883 | 3300025913 | Bacteria | 10493 |
| 175 | Ga0207695_10226680 | 3300025913 | Bacteria | 1774 |
| 176 | Ga0207695_10756290 | 3300025913 | Bacteria | 852 |
| 177 | Ga0207671_10000477 | 3300025914 | Bacteria | 54330 |
| 178 | Ga0207671_10001625 | 3300025914 | Bacteria | 25578 |
| 179 | Ga0207671_10006188 | 3300025914 | Bacteria | 10746 |
| 180 | Ga0207671_10009416 | 3300025914 | Bacteria | 8167 |
| 181 | Ga0207671_10023033 | 3300025914 | Bacteria | 4700 |
| 182 | Ga0207671_10024996 | 3300025914 | Bacteria | 4489 |
| 183 | Ga0207671_10035249 | 3300025914 | Bacteria | 3715 |
| 184 | Ga0207671_10131602 | 3300025914 | Bacteria | 1920 |
| 185 | Ga0207671_10344114 | 3300025914 | Bacteria | 1182 |
| 186 | Ga0207657_10018866 | 3300025919 | Bacteria | 6568 |
| 187 | Ga0207657_10073079 | 3300025919 | Bacteria | 2899 |
| 188 | Ga0207652_10085173 | 3300025921 | Bacteria | 2770 |
| 189 | Ga0207694_10108573 | 3300025924 | Unclassified | 2205 |
| 190 | Ga0207694_10310861 | 3300025924 | Bacteria | 1299 |
| 191 | Ga0207644_10009317 | 3300025931 | Bacteria | 6446 |
| 192 | Ga0207690_10001766 | 3300025932 | Bacteria | 13287 |
| 193 | Ga0207690_10017396 | 3300025932 | Bacteria | 4388 |
| 194 | Ga0207690_10214329 | 3300025932 | Bacteria | 1470 |
| 195 | Ga0207706_10000010 | 3300025933 | Bacteria | 200039 |
| 196 | Ga0207706_10122223 | 3300025933 | Bacteria | 2289 |
| 197 | Ga0207709_10330857 | 3300025935 | Unclassified | 1143 |
| 198 | Ga0207669_10096854 | 3300025937 | Bacteria | 1938 |
| 199 | Ga0207704_10000016 | 3300025938 | Bacteria | 158362 |
| 200 | Ga0207667_10000263 | 3300025949 | Bacteria | 73089 |
| 201 | Ga0207667_10010686 | 3300025949 | Bacteria | 10711 |
| 202 | Ga0207667_10014898 | 3300025949 | Bacteria | 8841 |
| 203 | Ga0207667_10030215 | 3300025949 | Bacteria | 5864 |
| 204 | Ga0207651_10064304 | 3300025960 | Bacteria | 2567 |
| 205 | Ga0207677_10054195 | 3300026023 | Bacteria | 2735 |
| 206 | Ga0207639_10025354 | 3300026041 | Bacteria | 4299 |
| 207 | Ga0207639_10028473 | 3300026041 | Bacteria | 4080 |
| 208 | Ga0207639_10049848 | 3300026041 | Bacteria | 3177 |
| 209 | Ga0207702_10139834 | 3300026078 | Bacteria | 2189 |
| 210 | Ga0207674_10064313 | 3300026116 | Bacteria | 3701 |
| 211 | Ga0207674_10071978 | 3300026116 | Bacteria | 3473 |
| 212 | Ga0207683_10019733 | 3300026121 | Bacteria | 5758 |
| 213 | Ga0207698_10085749 | 3300026142 | Bacteria | 2558 |
| 214 | Ga0207698_10167682 | 3300026142 | Bacteria | 1929 |
| 215 | Ga0268266_10000291 | 3300028379 | Bacteria | 82093 |
| 216 | Ga0307517_10015329 | 3300028786 | Bacteria | 10201 |
| 217 | Ga0307515_10000510 | 3300028794 | Bacteria | 92702 |
| 218 | Ga0307515_10004687 | 3300028794 | Bacteria | 28038 |
| 219 | Ga0307513_10350937 | 3300031456 | Bacteria | 1223 |
| 220 | Ga0307509_10049518 | 3300031507 | Bacteria | 4504 |
| 221 | Ga0307408_100003271 | 3300031548 | Bacteria | 11144 |
| 222 | Ga0307408_100005002 | 3300031548 | Bacteria | 8893 |
| 223 | Ga0307412_10001558 | 3300031911 | Bacteria | 12638 |
| 224 | Ga0307412_10087843 | 3300031911 | Unclassified | 2167 |
| 225 | Ga0307414_10439494 | 3300032004 | Bacteria | 1141 |
| 226 | Ga0307414_10488504 | 3300032004 | Bacteria | 1087 |
| 227 | Ga0307507_10001556 | 3300033179 | Bacteria | 51074 |
| 228 | Ga0307510_10000786 | 3300033180 | Bacteria | 32897 |
| 229 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 230 | Ga0395899_0000761 | 3300037312 | Bacteria | 31881 |
| 231 | Ga0395899_0001206 | 3300037312 | Bacteria | 22702 |
| 232 | Ga0395899_0013469 | 3300037312 | Bacteria | 6254 |
| 233 | Ga0395900_0000151 | 3300037418 | Bacteria | 116281 |
| 234 | Ga0395900_0000382 | 3300037418 | Bacteria | 63898 |
| 235 | Ga0395900_0015862 | 3300037418 | Bacteria | 7677 |
| 236 | Ga0395900_0056430 | 3300037418 | Bacteria | 4043 |
| 237 | Ga0395898_0008022 | 3300037466 | Bacteria | 11197 |
| 238 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 239 | Ga0395905_0004668 | 3300037471 | Bacteria | 14162 |
| 240 | Ga0395905_0012604 | 3300037471 | Bacteria | 8133 |
| 241 | Ga0395901_0000691 | 3300038443 | Bacteria | 38580 |
| 242 | Ga0395901_0005385 | 3300038443 | Bacteria | 12948 |
| 243 | Ga0395901_0420726 | 3300038443 | Bacteria | 1370 |
| 244 | Ga0436361_1160711 | 3300039447 | Bacteria | 11479 |
| 245 | Ga0451849_1384794 | 3300041505 | Bacteria | 830 |
| 246 | Ga0439448_0004084 | 3300042005 | Bacteria | 4107 |
| 247 | Ga0439457_006384 | 3300042014 | Bacteria | 2893 |
| 248 | Ga0466966_0229797 | 3300044684 | Bacteria | 1119 |
| 249 | Ga0495592_0220364 | 3300046454 | Bacteria | 1269 |
| 250 | Ga0495638_0150952 | 3300046460 | Bacteria | 1348 |
| 251 | Ga0495638_0167893 | 3300046460 | Unclassified | 1261 |
| 252 | Ga0495650_0000098 | 3300046471 | Bacteria | 215716 |
| 253 | Ga0495585_0000308 | 3300046492 | Bacteria | 48809 |
| 254 | Ga0495585_0000794 | 3300046492 | Bacteria | 27702 |
| 255 | Ga0495583_0023237 | 3300046506 | Bacteria | 3141 |
| 256 | Ga0495583_0066080 | 3300046506 | Bacteria | 1601 |
| 257 | Ga0495606_0000021 | 3300046507 | Bacteria | 271238 |
| 258 | Ga0495606_0003957 | 3300046507 | Bacteria | 15203 |
| 259 | Ga0495606_0030829 | 3300046507 | Bacteria | 3739 |
| 260 | Ga0495606_0063923 | 3300046507 | Bacteria | 2344 |
| 261 | Ga0495610_0000735 | 3300046512 | Bacteria | 31026 |
| 262 | Ga0495616_0001331 | 3300046513 | Bacteria | 17264 |
| 263 | Ga0495616_0002324 | 3300046513 | Bacteria | 12711 |
| 264 | Ga0495632_0177407 | 3300046519 | Bacteria | 977 |
| 265 | Ga0495644_0013034 | 3300046523 | Bacteria | 3195 |
| 266 | Ga0495648_0010009 | 3300046524 | Bacteria | 7270 |
| 267 | Ga0495648_0010590 | 3300046524 | Bacteria | 7011 |
| 268 | Ga0495652_0351309 | 3300046529 | Bacteria | 1056 |
| 269 | Ga0495609_0005700 | 3300046538 | Bacteria | 6485 |
| 270 | Ga0495609_0020950 | 3300046538 | Bacteria | 3017 |
| 271 | Ga0495622_0298916 | 3300046557 | Bacteria | 702 |
| 272 | Ga0495633_0000082 | 3300046558 | Bacteria | 125101 |
| 273 | Ga0495633_0002240 | 3300046558 | Bacteria | 13840 |
| 274 | Ga0495668_0000017 | 3300046616 | Bacteria | 434025 |
| 275 | Ga0495668_0098514 | 3300046616 | Bacteria | 1600 |
| 276 | Ga0495625_0000155 | 3300046660 | Bacteria | 105066 |
| 277 | Ga0495625_0000183 | 3300046660 | Bacteria | 98174 |
| 278 | Ga0495625_0000589 | 3300046660 | Bacteria | 52785 |
| 279 | Ga0495625_0081873 | 3300046660 | Bacteria | 2246 |
| 280 | Ga0495625_0291006 | 3300046660 | Bacteria | 1048 |
| 281 | Ga0495661_0002653 | 3300046665 | Bacteria | 13699 |
| 282 | Ga0495661_0037784 | 3300046665 | Bacteria | 3012 |
| 283 | Ga0495658_0016004 | 3300046683 | Bacteria | 3857 |
| 284 | Ga0495649_0000046 | 3300046694 | Bacteria | 120254 |
| 285 | Ga0495660_0011781 | 3300046810 | Bacteria | 5070 |
| 286 | Ga0495683_0008660 | 3300047323 | Bacteria | 5433 |
| 287 | Ga0495687_000440 | 3300047443 | Bacteria | 51285 |
| 288 | Ga0495687_004943 | 3300047443 | Bacteria | 8722 |
| 289 | Ga0495679_034549 | 3300047446 | Bacteria | 1608 |
| 290 | Ga0495686_0000541 | 3300047472 | Bacteria | 54075 |
| 291 | Ga0495686_0000554 | 3300047472 | Bacteria | 53514 |
| 292 | Ga0495686_0042880 | 3300047472 | Bacteria | 2873 |
| 293 | Ga0495686_0103608 | 3300047472 | Bacteria | 1714 |
| 294 | Ga0495682_0164490 | 3300049460 | Bacteria | 790 |
| 295 | Ga0501033_0146594 | 3300049570 | Bacteria | 1704 |
| 296 | nmdc:mga0k408_299_c1 | 3300050493 | Bacteria | 26804 |
| 297 | nmdc:mga0k408_57_c1 | 3300050493 | Bacteria | 56021 |
| 298 | nmdc:mga0k408_66242_c1 | 3300050493 | Bacteria | 2104 |
| 299 | Ga0500635_0024054 | 3300053080 | Bacteria | 1907 |
| 300 | Ga0500578_0280981 | 3300053086 | Bacteria | 993 |
| 301 | Ga0500608_000432 | 3300053122 | Bacteria | 15781 |
| 302 | Ga0500618_000218 | 3300053125 | Bacteria | 45135 |
| 303 | Ga0500622_0001236 | 3300053156 | Bacteria | 20943 |
| 304 | Ga0500624_000568 | 3300053157 | Bacteria | 10203 |
| 305 | 2599481736 | 2599185184 | Bacteria | 6430550 |
| 306 | 2852625750 | 2852623160 | Bacteria | 4376875 |
| 307 | 2884935725 | 2884933994 | Bacteria | 4535041 |
| 308 | 2919439790 | 2919437846 | Bacteria | 6199444 |
| 309 | 2928082009 | 2928078545 | Bacteria | 6534839 |
| 310 | 2928152029 | 2928147474 | Bacteria | 6512076 |
| 311 | 2932088064 | 2932082852 | Bacteria | 6563563 |
| 312 | 2977235073 | 2977232053 | Bacteria | 5485925 |
| 313 | Ga0070658_10107088 | |||
| 314 | JGI24736J21556_1010309 | |||
| 315 | JGI24740J21852_10044086 | |||
| 316 | JGI24739J22299_10066783 | |||
| 317 | JGI24739J22299_10076114 | |||
| 318 | JGI24737J22298_10000323 | |||
| 319 | JGI24737J22298_10012147 | |||
| 320 | JGI24735J21928_10000027 | |||
| 321 | JGI25162J39368_1000008 | |||
| 322 | JGI25164J39214_1001396 | |||
| 323 | JGI25165J46597_1000461 | |||
| 324 | JGI25165J46597_1016834 | |||
| 325 | rootH1_10010188 | |||
| 326 | rootH1_10016545 | |||
| 327 | rootH1_10095820 | |||
| 328 | rootH2_10005644 | |||
| 329 | rootH2_10005827 | |||
| 330 | rootH2_10094259 | |||
| 331 | rootH2_10144991 | |||
| 332 | rootH2_10167934 | |||
| 333 | rootL2_10080998 | |||
| 334 | rootL2_10153329 | |||
| 335 | rootH1_10013674 | |||
| 336 | rootH1_10040403 | |||
| 337 | rootH1_10183596 | |||
| 338 | rootH1_10250426 | |||
| 339 | rootH1_10314053 | |||
| 340 | Ga0065714_10009278 | |||
| 341 | Ga0070658_10000075 | |||
| 342 | Ga0070676_10000485 | |||
| 343 | Ga0068869_100271822 | |||
| 344 | Ga0068868_100003434 | |||
| 345 | Ga0068868_100077272 | |||
| 346 | Ga0070660_100043461 | |||
| 347 | Ga0070660_100055393 | |||
| 348 | Ga0070660_100068355 | |||
| 349 | Ga0070660_100356903 | |||
| 350 | Ga0070671_100009159 | |||
| 351 | Ga0070674_100075656 | |||
| 352 | Ga0070673_100002721 | |||
| 353 | Ga0070659_100000325 | |||
| 354 | Ga0070659_100020562 | |||
| 355 | Ga0070659_100124825 | |||
| 356 | Ga0070678_100006465 | |||
| 357 | Ga0070662_100000026 | |||
| 358 | Ga0070662_100109059 | |||
| 359 | Ga0070679_100138135 | |||
| 360 | Ga0070679_100148248 | |||
| 361 | Ga0070679_100548453 | |||
| 362 | Ga0070684_100023992 | |||
| 363 | Ga0068853_100036703 | |||
| 364 | Ga0068853_100039464 | |||
| 365 | Ga0068853_100084529 | |||
| 366 | Ga0070665_100000284 | |||
| 367 | Ga0068855_100000218 | |||
| 368 | Ga0068855_100009983 | |||
| 369 | Ga0068855_100037044 | |||
| 370 | Ga0068855_100041227 | |||
| 371 | Ga0068855_101008352 | |||
| 372 | Ga0068857_100057332 | |||
| 373 | Ga0068857_100063412 | |||
| 374 | Ga0068856_100022243 | |||
| 375 | Ga0068856_100096336 | |||
| 376 | Ga0068852_100003814 | |||
| 377 | Ga0068852_100045967 | |||
| 378 | Ga0068866_10090594 | |||
| 379 | Ga0068851_10322978 | |||
| 380 | Ga0075366_10000172 | |||
| 381 | Ga0075366_10000471 | |||
| 382 | Ga0075366_10084617 | |||
| 383 | Ga0097621_100000321 | |||
| 384 | Ga0068871_100000450 | |||
| 385 | Ga0068865_100000582 | |||
| 386 | Ga0105240_10001259 | |||
| 387 | Ga0105240_10009108 | |||
| 388 | Ga0105240_10015506 | |||
| 389 | Ga0105240_10228884 | |||
| 390 | Ga0105240_10269811 | |||
| 391 | Ga0105240_10419484 | |||
| 392 | Ga0105240_10495408 | |||
| 393 | Ga0105240_10838320 | |||
| 394 | Ga0105240_10964603 | |||
| 395 | Ga0105243_10486172 | |||
| 396 | Ga0105241_10000539 | |||
| 397 | Ga0105241_10023762 | |||
| 398 | Ga0105241_10050196 | |||
| 399 | Ga0105241_10597820 | |||
| 400 | Ga0105242_10026174 | |||
| 401 | Ga0105237_10000215 | |||
| 402 | Ga0105237_10000758 | |||
| 403 | Ga0105237_10011689 | |||
| 404 | Ga0105237_10013448 | |||
| 405 | Ga0105237_10020811 | |||
| 406 | Ga0105237_10055877 | |||
| 407 | Ga0105237_10092725 | |||
| 408 | Ga0105237_10092948 | |||
| 409 | Ga0105237_10179652 | |||
| 410 | Ga0105237_10398163 | |||
| 411 | Ga0105238_10000693 | |||
| 412 | Ga0105238_10019749 | |||
| 413 | Ga0105238_10071970 | |||
| 414 | Ga0105238_10356603 | |||
| 415 | Ga0105249_10670207 | |||
| 416 | Ga0105239_10000008 | |||
| 417 | Ga0105239_10000012 | |||
| 418 | Ga0105239_10000285 | |||
| 419 | Ga0105239_10000955 | |||
| 420 | Ga0105239_10003362 | |||
| 421 | Ga0105239_10094758 | |||
| 422 | Ga0105239_10235499 | |||
| 423 | Ga0105239_10340279 | |||
| 424 | Ga0105239_10469800 | |||
| 425 | Ga0105239_10927691 | |||
| 426 | Ga0105246_10047214 | |||
| 427 | Ga0157373_10000040 | |||
| 428 | Ga0157373_10169215 | |||
| 429 | Ga0157371_10000571 | |||
| 430 | Ga0157371_10012884 | |||
| 431 | Ga0157371_10016919 | |||
| 432 | Ga0157371_10025841 | |||
| 433 | Ga0157370_10053393 | |||
| 434 | Ga0157369_10008991 | |||
| 435 | Ga0157369_10790732 | |||
| 436 | Ga0157374_10000076 | |||
| 437 | Ga0157374_10440132 | |||
| 438 | Ga0157374_11048425 | |||
| 439 | Ga0157378_10049079 | |||
| 440 | Ga0157378_10061266 | |||
| 441 | Ga0157378_10157253 | |||
| 442 | Ga0163162_10000044 | |||
| 443 | Ga0163162_10000985 | |||
| 444 | Ga0163162_10046291 | |||
| 445 | Ga0157372_10000182 | |||
| 446 | Ga0157372_10000432 | |||
| 447 | Ga0157372_10000538 | |||
| 448 | Ga0157372_10001687 | |||
| 449 | Ga0157372_10033736 | |||
| 450 | Ga0157372_10043504 | |||
| 451 | Ga0157372_10126753 | |||
| 452 | Ga0157375_10031523 | |||
| 453 | Ga0157375_10079086 | |||
| 454 | Ga0157377_10008329 | |||
| 455 | Ga0157376_10066632 | |||
| 456 | Ga0163161_10015660 | |||
| 457 | Ga0213872_10011212 | |||
| 458 | Ga0209563_103615 | |||
| 459 | Ga0207427_100138 | |||
| 460 | Ga0209437_100010 | |||
| 461 | Ga0209437_100030 | |||
| 462 | Ga0209026_1000292 | |||
| 463 | Ga0209026_1008279 | |||
| 464 | Ga0209148_1024377 | |||
| 465 | Ga0209148_1025819 | |||
| 466 | Ga0209129_1009533 | |||
| 467 | Ga0209233_1000017 | |||
| 468 | Ga0209233_1001084 | |||
| 469 | Ga0209233_1017349 | |||
| 470 | Ga0209233_1028181 | |||
| 471 | Ga0209455_1001823 | |||
| 472 | Ga0207642_10066079 | |||
| 473 | Ga0207647_10000027 | |||
| 474 | Ga0207647_10000080 | |||
| 475 | Ga0207647_10150268 | |||
| 476 | Ga0207647_10151848 | |||
| 477 | Ga0207645_10002125 | |||
| 478 | Ga0207705_10000102 | |||
| 479 | Ga0207705_10153409 | |||
| 480 | Ga0207654_10001274 | |||
| 481 | Ga0207654_10008230 | |||
| 482 | Ga0207654_10076589 | |||
| 483 | Ga0207695_10000183 | |||
| 484 | Ga0207695_10002635 | |||
| 485 | Ga0207695_10011138 | |||
| 486 | Ga0207695_10011883 | |||
| 487 | Ga0207695_10226680 | |||
| 488 | Ga0207695_10756290 | |||
| 489 | Ga0207671_10000477 | |||
| 490 | Ga0207671_10001625 | |||
| 491 | Ga0207671_10006188 | |||
| 492 | Ga0207671_10009416 | |||
| 493 | Ga0207671_10023033 | |||
| 494 | Ga0207671_10024996 | |||
| 495 | Ga0207671_10035249 | |||
| 496 | Ga0207671_10131602 | |||
| 497 | Ga0207671_10344114 | |||
| 498 | Ga0207657_10018866 | |||
| 499 | Ga0207657_10073079 | |||
| 500 | Ga0207652_10085173 | |||
| 501 | Ga0207694_10108573 | |||
| 502 | Ga0207694_10310861 | |||
| 503 | Ga0207644_10009317 | |||
| 504 | Ga0207690_10001766 | |||
| 505 | Ga0207690_10017396 | |||
| 506 | Ga0207690_10214329 | |||
| 507 | Ga0207706_10000010 | |||
| 508 | Ga0207706_10122223 | |||
| 509 | Ga0207709_10330857 | |||
| 510 | Ga0207669_10096854 | |||
| 511 | Ga0207704_10000016 | |||
| 512 | Ga0207667_10000263 | |||
| 513 | Ga0207667_10010686 | |||
| 514 | Ga0207667_10014898 | |||
| 515 | Ga0207667_10030215 | |||
| 516 | Ga0207651_10064304 | |||
| 517 | Ga0207677_10054195 | |||
| 518 | Ga0207639_10025354 | |||
| 519 | Ga0207639_10028473 | |||
| 520 | Ga0207639_10049848 | |||
| 521 | Ga0207702_10139834 | |||
| 522 | Ga0207674_10064313 | |||
| 523 | Ga0207674_10071978 | |||
| 524 | Ga0207683_10019733 | |||
| 525 | Ga0207698_10085749 | |||
| 526 | Ga0207698_10167682 | |||
| 527 | Ga0268266_10000291 | |||
| 528 | Ga0307517_10015329 | |||
| 529 | Ga0307515_10000510 | |||
| 530 | Ga0307515_10004687 | |||
| 531 | Ga0307513_10350937 | |||
| 532 | Ga0307509_10049518 | |||
| 533 | Ga0307408_100003271 | |||
| 534 | Ga0307408_100005002 | |||
| 535 | Ga0307412_10001558 | |||
| 536 | Ga0307412_10087843 | |||
| 537 | Ga0307414_10439494 | |||
| 538 | Ga0307414_10488504 | |||
| 539 | Ga0307507_10001556 | |||
| 540 | Ga0307510_10000786 | |||
| 541 | Ga0395899_0000017 | |||
| 542 | Ga0395899_0000761 | |||
| 543 | Ga0395899_0001206 | |||
| 544 | Ga0395899_0013469 | |||
| 545 | Ga0395900_0000151 | |||
| 546 | Ga0395900_0000382 | |||
| 547 | Ga0395900_0015862 | |||
| 548 | Ga0395900_0056430 | |||
| 549 | Ga0395898_0008022 | |||
| 550 | Ga0395905_0000001 | |||
| 551 | Ga0395905_0004668 | |||
| 552 | Ga0395905_0012604 | |||
| 553 | Ga0395901_0000691 | |||
| 554 | Ga0395901_0005385 | |||
| 555 | Ga0395901_0420726 | |||
| 556 | Ga0436361_1160711 | |||
| 557 | Ga0451849_1384794 | |||
| 558 | Ga0439448_0004084 | |||
| 559 | Ga0439457_006384 | |||
| 560 | Ga0466966_0229797 | |||
| 561 | Ga0495592_0220364 | |||
| 562 | Ga0495638_0150952 | |||
| 563 | Ga0495638_0167893 | |||
| 564 | Ga0495650_0000098 | |||
| 565 | Ga0495585_0000308 | |||
| 566 | Ga0495585_0000794 | |||
| 567 | Ga0495583_0023237 | |||
| 568 | Ga0495583_0066080 | |||
| 569 | Ga0495606_0000021 | |||
| 570 | Ga0495606_0003957 | |||
| 571 | Ga0495606_0030829 | |||
| 572 | Ga0495606_0063923 | |||
| 573 | Ga0495610_0000735 | |||
| 574 | Ga0495616_0001331 | |||
| 575 | Ga0495616_0002324 | |||
| 576 | Ga0495632_0177407 | |||
| 577 | Ga0495644_0013034 | |||
| 578 | Ga0495648_0010009 | |||
| 579 | Ga0495648_0010590 | |||
| 580 | Ga0495652_0351309 | |||
| 581 | Ga0495609_0005700 | |||
| 582 | Ga0495609_0020950 | |||
| 583 | Ga0495622_0298916 | |||
| 584 | Ga0495633_0000082 | |||
| 585 | Ga0495633_0002240 | |||
| 586 | Ga0495668_0000017 | |||
| 587 | Ga0495668_0098514 | |||
| 588 | Ga0495625_0000155 | |||
| 589 | Ga0495625_0000183 | |||
| 590 | Ga0495625_0000589 | |||
| 591 | Ga0495625_0081873 | |||
| 592 | Ga0495625_0291006 | |||
| 593 | Ga0495661_0002653 | |||
| 594 | Ga0495661_0037784 | |||
| 595 | Ga0495658_0016004 | |||
| 596 | Ga0495649_0000046 | |||
| 597 | Ga0495660_0011781 | |||
| 598 | Ga0495683_0008660 | |||
| 599 | Ga0495687_000440 | |||
| 600 | Ga0495687_004943 | |||
| 601 | Ga0495679_034549 | |||
| 602 | Ga0495686_0000541 | |||
| 603 | Ga0495686_0000554 | |||
| 604 | Ga0495686_0042880 | |||
| 605 | Ga0495686_0103608 | |||
| 606 | Ga0495682_0164490 | |||
| 607 | Ga0501033_0146594 | |||
| 608 | nmdc:mga0k408_299_c1 | |||
| 609 | nmdc:mga0k408_57_c1 | |||
| 610 | nmdc:mga0k408_66242_c1 | |||
| 611 | Ga0500635_0024054 | |||
| 612 | Ga0500578_0280981 | |||
| 613 | Ga0500608_000432 | |||
| 614 | Ga0500618_000218 | |||
| 615 | Ga0500622_0001236 | |||
| 616 | Ga0500624_000568 | |||
| 617 | 2599481736 | |||
| 618 | 2852625750 | |||
| 619 | 2884935725 | |||
| 620 | 2919439790 | |||
| 621 | 2928082009 | |||
| 622 | 2928152029 | |||
| 623 | 2932088064 | |||
| 624 | 2977235073 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bq2-assembly1.cif.gz_A-2 | crystal structure of medicago truncatula thermospermine synthase (mttsps) | 0.8404 | 8 | 35 |
| 6bq2-assembly1.cif.gz_B | crystal structure of medicago truncatula thermospermine synthase (mttsps) | 0.8391 | 8 | 35 |
| 2pys-assembly1.cif.gz_B | crystal structure of a five site mutated cyanovirin-n with a mannose dimer bound at 1.8 a resolution | 0.8095 | 8 | 38 |
| 3lhc-assembly1.cif.gz_A-2 | crystal structure of cyanovirin-n swapping domain b mutant | 0.8032 | 8 | 37 |
| 3gxz-assembly1.cif.gz_B | crystal structure of cyanovirin-n complexed to oligomannose-9 (man-9) | 0.8029 | 8 | 37 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHI5_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.925 | 1 | 78 | 2.40.50.140 |
| 3q8dB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8534 | 4 | 78 | 2.40.50.140 |
| af_P9WHI5_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8403 | 1 | 78 | 2.40.50.140 |
| 3lhcA00 | Mainly Beta;Roll;HIV-inactivating Protein, Cyanovirin-n;Cyanovirin-N | 0.8043 | 8 | 37 | 2.30.60.10 |
| af_Q9UT10_502_586_2.40.30.10 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.8022 | 5 | 28 | 2.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521AS64-F1-model_v4 | DNA repair protein RecO (Recombination protein O) | 0.9855 | 1 | 239 |
GO:0006302
GO:0006310 GO:0043590 |
| AF-A0A521AS64-F1-model_v4 | DNA repair protein RecO (Recombination protein O) | 0.9815 | 1 | 239 |
GO:0006302
GO:0006310 GO:0043590 |
| AF-F0S4R0-F1-model_v4 | DNA repair protein RecO (Recombination protein O) | 0.9786 | 1 | 239 |
GO:0006302
GO:0006310 GO:0043590 |
| AF-A0A661YN43-F1-model_v4 | DNA repair protein RecO (Recombination protein O) | 0.9783 | 1 | 239 |
GO:0006302
GO:0006310 GO:0043590 |
| AF-A0A519UQY4-F1-model_v4 | DNA repair protein RecO (Recombination protein O) | 0.9772 | 1 | 239 |
GO:0006302
GO:0006310 GO:0043590 |