F401537

General Info

Members Datasets Scaffolds Average Seq Length
312 154 624 240

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10107088|Ga0070658_101070884
Length 242
Sequence MLHKTRGIVLKTTDYGESSVIVQVFTEKFGLQSYMVNGVKKPKAKINRNMLQPLHLLDMVVYHKGGGSNVQRISEVKNSPLLQTIPYDVIKSSIAMFLNEVLYKSVRQHPEDIHLFDFIFNAVEWLDHQNEGLANFHLLFLIQLTRYLGFYPDKFMMDEADYFDMKNGNFCRYKPDSVLYLSPPHTQNFAALLNTSFENISQLKFGNDERRYLLAKLLDYYALHIESFGIVRSHEILEEILS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
110 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
111 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
142 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
143 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
146 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
147 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
148 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
149 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
150 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
151 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
152 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
153 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
154 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.97
Nodule 0
Rhizoplane 0.32
Rhizosphere 81.73
Stem 0
Stem Tuber 0
Unclassified 3.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10107088 3300005327 Bacteria 2313
2 JGI24736J21556_1010309 3300001904 Bacteria 1527
3 JGI24740J21852_10044086 3300001979 Bacteria 1326
4 JGI24739J22299_10066783 3300001989 Bacteria 1126
5 JGI24739J22299_10076114 3300001989 Bacteria 1036
6 JGI24737J22298_10000323 3300001990 Bacteria 16025
7 JGI24737J22298_10012147 3300001990 Bacteria 2811
8 JGI24735J21928_10000027 3300002067 Bacteria 83494
9 JGI25162J39368_1000008 3300002737 Bacteria 397212
10 JGI25164J39214_1001396 3300002772 Bacteria 5740
11 JGI25165J46597_1000461 3300003214 Bacteria 40249
12 JGI25165J46597_1016834 3300003214 Bacteria 978
13 rootH1_10010188 3300003316 Bacteria 3622
14 rootH1_10016545 3300003316 Bacteria 8256
15 rootH1_10095820 3300003316 Unclassified 1438
16 rootH2_10005644 3300003320 Bacteria 16297
17 rootH2_10005827 3300003320 Bacteria 117906
18 rootH2_10094259 3300003320 Bacteria 4664
19 rootH2_10144991 3300003320 Bacteria 2992
20 rootH2_10167934 3300003320 Bacteria 1337
21 rootL2_10080998 3300003322 Bacteria 1916
22 rootL2_10153329 3300003322 Bacteria 4717
23 rootH1_10013674 3300003323 Bacteria 50224
24 rootH1_10040403 3300003323 Unclassified 2463
25 rootH1_10183596 3300003323 Bacteria 4693
26 rootH1_10250426 3300003323 Unclassified 1331
27 rootH1_10314053 3300003323 Bacteria 2349
28 Ga0065714_10009278 3300005288 Bacteria 2652
29 Ga0070658_10000075 3300005327 Bacteria 95412
30 Ga0070676_10000485 3300005328 Bacteria 18960
31 Ga0068869_100271822 3300005334 Bacteria 1360
32 Ga0068868_100003434 3300005338 Bacteria 11034
33 Ga0068868_100077272 3300005338 Bacteria 2663
34 Ga0070660_100043461 3300005339 Bacteria 3434
35 Ga0070660_100055393 3300005339 Bacteria 3064
36 Ga0070660_100068355 3300005339 Unclassified 2769
37 Ga0070660_100356903 3300005339 Bacteria 1204
38 Ga0070671_100009159 3300005355 Bacteria 7948
39 Ga0070674_100075656 3300005356 Bacteria 2392
40 Ga0070673_100002721 3300005364 Bacteria 10843
41 Ga0070659_100000325 3300005366 Bacteria 36617
42 Ga0070659_100020562 3300005366 Bacteria 5017
43 Ga0070659_100124825 3300005366 Unclassified 2088
44 Ga0070678_100006465 3300005456 Bacteria 6881
45 Ga0070662_100000026 3300005457 Bacteria 83930
46 Ga0070662_100109059 3300005457 Bacteria 2106
47 Ga0070679_100138135 3300005530 Bacteria 2418
48 Ga0070679_100148248 3300005530 Bacteria 2324
49 Ga0070679_100548453 3300005530 Bacteria 1100
50 Ga0070684_100023992 3300005535 Bacteria 5111
51 Ga0068853_100036703 3300005539 Bacteria 4169
52 Ga0068853_100039464 3300005539 Bacteria 4027
53 Ga0068853_100084529 3300005539 Bacteria 2781
54 Ga0070665_100000284 3300005548 Bacteria 82062
55 Ga0068855_100000218 3300005563 Bacteria 73075
56 Ga0068855_100009983 3300005563 Bacteria 11442
57 Ga0068855_100037044 3300005563 Bacteria 5803
58 Ga0068855_100041227 3300005563 Bacteria 5472
59 Ga0068855_101008352 3300005563 Bacteria 874
60 Ga0068857_100057332 3300005577 Bacteria 3457
61 Ga0068857_100063412 3300005577 Bacteria 3285
62 Ga0068856_100022243 3300005614 Bacteria 6164
63 Ga0068856_100096336 3300005614 Bacteria 2947
64 Ga0068852_100003814 3300005616 Bacteria 10581
65 Ga0068852_100045967 3300005616 Bacteria 3717
66 Ga0068866_10090594 3300005718 Bacteria 1664
67 Ga0068851_10322978 3300005834 Bacteria 892
68 Ga0075366_10000172 3300006195 Bacteria 27863
69 Ga0075366_10000471 3300006195 Bacteria 18733
70 Ga0075366_10084617 3300006195 Bacteria 1896
71 Ga0097621_100000321 3300006237 Bacteria 32515
72 Ga0068871_100000450 3300006358 Bacteria 28265
73 Ga0068865_100000582 3300006881 Bacteria 20467
74 Ga0105240_10001259 3300009093 Bacteria 43960
75 Ga0105240_10009108 3300009093 Bacteria 14094
76 Ga0105240_10015506 3300009093 Bacteria 10360
77 Ga0105240_10228884 3300009093 Bacteria 2162
78 Ga0105240_10269811 3300009093 Bacteria 1960
79 Ga0105240_10419484 3300009093 Bacteria 1504
80 Ga0105240_10495408 3300009093 Bacteria 1360
81 Ga0105240_10838320 3300009093 Bacteria 993
82 Ga0105240_10964603 3300009093 Bacteria 914
83 Ga0105243_10486172 3300009148 Unclassified 1166
84 Ga0105241_10000539 3300009174 Bacteria 28510
85 Ga0105241_10023762 3300009174 Bacteria 4548
86 Ga0105241_10050196 3300009174 Bacteria 3179
87 Ga0105241_10597820 3300009174 Bacteria 996
88 Ga0105242_10026174 3300009176 Bacteria 4623
89 Ga0105237_10000215 3300009545 Bacteria 81284
90 Ga0105237_10000758 3300009545 Bacteria 44281
91 Ga0105237_10011689 3300009545 Bacteria 9287
92 Ga0105237_10013448 3300009545 Bacteria 8582
93 Ga0105237_10020811 3300009545 Bacteria 6756
94 Ga0105237_10055877 3300009545 Bacteria 3953
95 Ga0105237_10092725 3300009545 Bacteria 3010
96 Ga0105237_10092948 3300009545 Bacteria 3006
97 Ga0105237_10179652 3300009545 Bacteria 2116
98 Ga0105237_10398163 3300009545 Bacteria 1382
99 Ga0105238_10000693 3300009551 Bacteria 35265
100 Ga0105238_10019749 3300009551 Bacteria 6861
101 Ga0105238_10071970 3300009551 Bacteria 3454
102 Ga0105238_10356603 3300009551 Bacteria 1451
103 Ga0105249_10670207 3300009553 Bacteria 1096
104 Ga0105239_10000008 3300010375 Bacteria 376925
105 Ga0105239_10000012 3300010375 Bacteria 332279
106 Ga0105239_10000285 3300010375 Bacteria 74551
107 Ga0105239_10000955 3300010375 Bacteria 40720
108 Ga0105239_10003362 3300010375 Bacteria 19653
109 Ga0105239_10094758 3300010375 Bacteria 3297
110 Ga0105239_10235499 3300010375 Bacteria 2055
111 Ga0105239_10340279 3300010375 Bacteria 1693
112 Ga0105239_10469800 3300010375 Bacteria 1428
113 Ga0105239_10927691 3300010375 Bacteria 1000
114 Ga0105246_10047214 3300011119 Bacteria 2940
115 Ga0157373_10000040 3300013100 Bacteria 114771
116 Ga0157373_10169215 3300013100 Bacteria 1538
117 Ga0157371_10000571 3300013102 Bacteria 43698
118 Ga0157371_10012884 3300013102 Bacteria 6367
119 Ga0157371_10016919 3300013102 Bacteria 5430
120 Ga0157371_10025841 3300013102 Unclassified 4273
121 Ga0157370_10053393 3300013104 Bacteria 3854
122 Ga0157369_10008991 3300013105 Bacteria 11443
123 Ga0157369_10790732 3300013105 Bacteria 975
124 Ga0157374_10000076 3300013296 Bacteria 97502
125 Ga0157374_10440132 3300013296 Bacteria 1304
126 Ga0157374_11048425 3300013296 Bacteria 835
127 Ga0157378_10049079 3300013297 Bacteria 3755
128 Ga0157378_10061266 3300013297 Bacteria 3357
129 Ga0157378_10157253 3300013297 Bacteria 2123
130 Ga0163162_10000044 3300013306 Bacteria 128200
131 Ga0163162_10000985 3300013306 Bacteria 26500
132 Ga0163162_10046291 3300013306 Bacteria 4359
133 Ga0157372_10000182 3300013307 Bacteria 69439
134 Ga0157372_10000432 3300013307 Bacteria 46220
135 Ga0157372_10000538 3300013307 Bacteria 41695
136 Ga0157372_10001687 3300013307 Bacteria 23876
137 Ga0157372_10033736 3300013307 Bacteria 5624
138 Ga0157372_10043504 3300013307 Bacteria 4972
139 Ga0157372_10126753 3300013307 Bacteria 2936
140 Ga0157375_10031523 3300013308 Bacteria 5013
141 Ga0157375_10079086 3300013308 Bacteria 3323
142 Ga0157377_10008329 3300014745 Bacteria 5053
143 Ga0157376_10066632 3300014969 Bacteria 3044
144 Ga0163161_10015660 3300017792 Bacteria 5287
145 Ga0213872_10011212 3300021361 Bacteria 4245
146 Ga0209563_103615 3300025230 Bacteria 3149
147 Ga0207427_100138 3300025231 Bacteria 86499
148 Ga0209437_100010 3300025233 Bacteria 838447
149 Ga0209437_100030 3300025233 Bacteria 532466
150 Ga0209026_1000292 3300025250 Bacteria 56639
151 Ga0209026_1008279 3300025250 Bacteria 2192
152 Ga0209148_1024377 3300025254 Bacteria 956
153 Ga0209148_1025819 3300025254 Bacteria 917
154 Ga0209129_1009533 3300025258 Bacteria 2543
155 Ga0209233_1000017 3300025261 Bacteria 898076
156 Ga0209233_1001084 3300025261 Bacteria 11223
157 Ga0209233_1017349 3300025261 Bacteria 1964
158 Ga0209233_1028181 3300025261 Unclassified 1351
159 Ga0209455_1001823 3300025272 Bacteria 8945
160 Ga0207642_10066079 3300025899 Bacteria 1702
161 Ga0207647_10000027 3300025904 Bacteria 109872
162 Ga0207647_10000080 3300025904 Bacteria 71854
163 Ga0207647_10150268 3300025904 Bacteria 1362
164 Ga0207647_10151848 3300025904 Bacteria 1353
165 Ga0207645_10002125 3300025907 Bacteria 15863
166 Ga0207705_10000102 3300025909 Bacteria 98105
167 Ga0207705_10153409 3300025909 Bacteria 1727
168 Ga0207654_10001274 3300025911 Bacteria 13419
169 Ga0207654_10008230 3300025911 Bacteria 5264
170 Ga0207654_10076589 3300025911 Bacteria 2003
171 Ga0207695_10000183 3300025913 Bacteria 181350
172 Ga0207695_10002635 3300025913 Bacteria 26250
173 Ga0207695_10011138 3300025913 Bacteria 10912
174 Ga0207695_10011883 3300025913 Bacteria 10493
175 Ga0207695_10226680 3300025913 Bacteria 1774
176 Ga0207695_10756290 3300025913 Bacteria 852
177 Ga0207671_10000477 3300025914 Bacteria 54330
178 Ga0207671_10001625 3300025914 Bacteria 25578
179 Ga0207671_10006188 3300025914 Bacteria 10746
180 Ga0207671_10009416 3300025914 Bacteria 8167
181 Ga0207671_10023033 3300025914 Bacteria 4700
182 Ga0207671_10024996 3300025914 Bacteria 4489
183 Ga0207671_10035249 3300025914 Bacteria 3715
184 Ga0207671_10131602 3300025914 Bacteria 1920
185 Ga0207671_10344114 3300025914 Bacteria 1182
186 Ga0207657_10018866 3300025919 Bacteria 6568
187 Ga0207657_10073079 3300025919 Bacteria 2899
188 Ga0207652_10085173 3300025921 Bacteria 2770
189 Ga0207694_10108573 3300025924 Unclassified 2205
190 Ga0207694_10310861 3300025924 Bacteria 1299
191 Ga0207644_10009317 3300025931 Bacteria 6446
192 Ga0207690_10001766 3300025932 Bacteria 13287
193 Ga0207690_10017396 3300025932 Bacteria 4388
194 Ga0207690_10214329 3300025932 Bacteria 1470
195 Ga0207706_10000010 3300025933 Bacteria 200039
196 Ga0207706_10122223 3300025933 Bacteria 2289
197 Ga0207709_10330857 3300025935 Unclassified 1143
198 Ga0207669_10096854 3300025937 Bacteria 1938
199 Ga0207704_10000016 3300025938 Bacteria 158362
200 Ga0207667_10000263 3300025949 Bacteria 73089
201 Ga0207667_10010686 3300025949 Bacteria 10711
202 Ga0207667_10014898 3300025949 Bacteria 8841
203 Ga0207667_10030215 3300025949 Bacteria 5864
204 Ga0207651_10064304 3300025960 Bacteria 2567
205 Ga0207677_10054195 3300026023 Bacteria 2735
206 Ga0207639_10025354 3300026041 Bacteria 4299
207 Ga0207639_10028473 3300026041 Bacteria 4080
208 Ga0207639_10049848 3300026041 Bacteria 3177
209 Ga0207702_10139834 3300026078 Bacteria 2189
210 Ga0207674_10064313 3300026116 Bacteria 3701
211 Ga0207674_10071978 3300026116 Bacteria 3473
212 Ga0207683_10019733 3300026121 Bacteria 5758
213 Ga0207698_10085749 3300026142 Bacteria 2558
214 Ga0207698_10167682 3300026142 Bacteria 1929
215 Ga0268266_10000291 3300028379 Bacteria 82093
216 Ga0307517_10015329 3300028786 Bacteria 10201
217 Ga0307515_10000510 3300028794 Bacteria 92702
218 Ga0307515_10004687 3300028794 Bacteria 28038
219 Ga0307513_10350937 3300031456 Bacteria 1223
220 Ga0307509_10049518 3300031507 Bacteria 4504
221 Ga0307408_100003271 3300031548 Bacteria 11144
222 Ga0307408_100005002 3300031548 Bacteria 8893
223 Ga0307412_10001558 3300031911 Bacteria 12638
224 Ga0307412_10087843 3300031911 Unclassified 2167
225 Ga0307414_10439494 3300032004 Bacteria 1141
226 Ga0307414_10488504 3300032004 Bacteria 1087
227 Ga0307507_10001556 3300033179 Bacteria 51074
228 Ga0307510_10000786 3300033180 Bacteria 32897
229 Ga0395899_0000017 3300037312 Bacteria 440179
230 Ga0395899_0000761 3300037312 Bacteria 31881
231 Ga0395899_0001206 3300037312 Bacteria 22702
232 Ga0395899_0013469 3300037312 Bacteria 6254
233 Ga0395900_0000151 3300037418 Bacteria 116281
234 Ga0395900_0000382 3300037418 Bacteria 63898
235 Ga0395900_0015862 3300037418 Bacteria 7677
236 Ga0395900_0056430 3300037418 Bacteria 4043
237 Ga0395898_0008022 3300037466 Bacteria 11197
238 Ga0395905_0000001 3300037471 Bacteria 2037079
239 Ga0395905_0004668 3300037471 Bacteria 14162
240 Ga0395905_0012604 3300037471 Bacteria 8133
241 Ga0395901_0000691 3300038443 Bacteria 38580
242 Ga0395901_0005385 3300038443 Bacteria 12948
243 Ga0395901_0420726 3300038443 Bacteria 1370
244 Ga0436361_1160711 3300039447 Bacteria 11479
245 Ga0451849_1384794 3300041505 Bacteria 830
246 Ga0439448_0004084 3300042005 Bacteria 4107
247 Ga0439457_006384 3300042014 Bacteria 2893
248 Ga0466966_0229797 3300044684 Bacteria 1119
249 Ga0495592_0220364 3300046454 Bacteria 1269
250 Ga0495638_0150952 3300046460 Bacteria 1348
251 Ga0495638_0167893 3300046460 Unclassified 1261
252 Ga0495650_0000098 3300046471 Bacteria 215716
253 Ga0495585_0000308 3300046492 Bacteria 48809
254 Ga0495585_0000794 3300046492 Bacteria 27702
255 Ga0495583_0023237 3300046506 Bacteria 3141
256 Ga0495583_0066080 3300046506 Bacteria 1601
257 Ga0495606_0000021 3300046507 Bacteria 271238
258 Ga0495606_0003957 3300046507 Bacteria 15203
259 Ga0495606_0030829 3300046507 Bacteria 3739
260 Ga0495606_0063923 3300046507 Bacteria 2344
261 Ga0495610_0000735 3300046512 Bacteria 31026
262 Ga0495616_0001331 3300046513 Bacteria 17264
263 Ga0495616_0002324 3300046513 Bacteria 12711
264 Ga0495632_0177407 3300046519 Bacteria 977
265 Ga0495644_0013034 3300046523 Bacteria 3195
266 Ga0495648_0010009 3300046524 Bacteria 7270
267 Ga0495648_0010590 3300046524 Bacteria 7011
268 Ga0495652_0351309 3300046529 Bacteria 1056
269 Ga0495609_0005700 3300046538 Bacteria 6485
270 Ga0495609_0020950 3300046538 Bacteria 3017
271 Ga0495622_0298916 3300046557 Bacteria 702
272 Ga0495633_0000082 3300046558 Bacteria 125101
273 Ga0495633_0002240 3300046558 Bacteria 13840
274 Ga0495668_0000017 3300046616 Bacteria 434025
275 Ga0495668_0098514 3300046616 Bacteria 1600
276 Ga0495625_0000155 3300046660 Bacteria 105066
277 Ga0495625_0000183 3300046660 Bacteria 98174
278 Ga0495625_0000589 3300046660 Bacteria 52785
279 Ga0495625_0081873 3300046660 Bacteria 2246
280 Ga0495625_0291006 3300046660 Bacteria 1048
281 Ga0495661_0002653 3300046665 Bacteria 13699
282 Ga0495661_0037784 3300046665 Bacteria 3012
283 Ga0495658_0016004 3300046683 Bacteria 3857
284 Ga0495649_0000046 3300046694 Bacteria 120254
285 Ga0495660_0011781 3300046810 Bacteria 5070
286 Ga0495683_0008660 3300047323 Bacteria 5433
287 Ga0495687_000440 3300047443 Bacteria 51285
288 Ga0495687_004943 3300047443 Bacteria 8722
289 Ga0495679_034549 3300047446 Bacteria 1608
290 Ga0495686_0000541 3300047472 Bacteria 54075
291 Ga0495686_0000554 3300047472 Bacteria 53514
292 Ga0495686_0042880 3300047472 Bacteria 2873
293 Ga0495686_0103608 3300047472 Bacteria 1714
294 Ga0495682_0164490 3300049460 Bacteria 790
295 Ga0501033_0146594 3300049570 Bacteria 1704
296 nmdc:mga0k408_299_c1 3300050493 Bacteria 26804
297 nmdc:mga0k408_57_c1 3300050493 Bacteria 56021
298 nmdc:mga0k408_66242_c1 3300050493 Bacteria 2104
299 Ga0500635_0024054 3300053080 Bacteria 1907
300 Ga0500578_0280981 3300053086 Bacteria 993
301 Ga0500608_000432 3300053122 Bacteria 15781
302 Ga0500618_000218 3300053125 Bacteria 45135
303 Ga0500622_0001236 3300053156 Bacteria 20943
304 Ga0500624_000568 3300053157 Bacteria 10203
305 2599481736 2599185184 Bacteria 6430550
306 2852625750 2852623160 Bacteria 4376875
307 2884935725 2884933994 Bacteria 4535041
308 2919439790 2919437846 Bacteria 6199444
309 2928082009 2928078545 Bacteria 6534839
310 2928152029 2928147474 Bacteria 6512076
311 2932088064 2932082852 Bacteria 6563563
312 2977235073 2977232053 Bacteria 5485925
313 Ga0070658_10107088
314 JGI24736J21556_1010309
315 JGI24740J21852_10044086
316 JGI24739J22299_10066783
317 JGI24739J22299_10076114
318 JGI24737J22298_10000323
319 JGI24737J22298_10012147
320 JGI24735J21928_10000027
321 JGI25162J39368_1000008
322 JGI25164J39214_1001396
323 JGI25165J46597_1000461
324 JGI25165J46597_1016834
325 rootH1_10010188
326 rootH1_10016545
327 rootH1_10095820
328 rootH2_10005644
329 rootH2_10005827
330 rootH2_10094259
331 rootH2_10144991
332 rootH2_10167934
333 rootL2_10080998
334 rootL2_10153329
335 rootH1_10013674
336 rootH1_10040403
337 rootH1_10183596
338 rootH1_10250426
339 rootH1_10314053
340 Ga0065714_10009278
341 Ga0070658_10000075
342 Ga0070676_10000485
343 Ga0068869_100271822
344 Ga0068868_100003434
345 Ga0068868_100077272
346 Ga0070660_100043461
347 Ga0070660_100055393
348 Ga0070660_100068355
349 Ga0070660_100356903
350 Ga0070671_100009159
351 Ga0070674_100075656
352 Ga0070673_100002721
353 Ga0070659_100000325
354 Ga0070659_100020562
355 Ga0070659_100124825
356 Ga0070678_100006465
357 Ga0070662_100000026
358 Ga0070662_100109059
359 Ga0070679_100138135
360 Ga0070679_100148248
361 Ga0070679_100548453
362 Ga0070684_100023992
363 Ga0068853_100036703
364 Ga0068853_100039464
365 Ga0068853_100084529
366 Ga0070665_100000284
367 Ga0068855_100000218
368 Ga0068855_100009983
369 Ga0068855_100037044
370 Ga0068855_100041227
371 Ga0068855_101008352
372 Ga0068857_100057332
373 Ga0068857_100063412
374 Ga0068856_100022243
375 Ga0068856_100096336
376 Ga0068852_100003814
377 Ga0068852_100045967
378 Ga0068866_10090594
379 Ga0068851_10322978
380 Ga0075366_10000172
381 Ga0075366_10000471
382 Ga0075366_10084617
383 Ga0097621_100000321
384 Ga0068871_100000450
385 Ga0068865_100000582
386 Ga0105240_10001259
387 Ga0105240_10009108
388 Ga0105240_10015506
389 Ga0105240_10228884
390 Ga0105240_10269811
391 Ga0105240_10419484
392 Ga0105240_10495408
393 Ga0105240_10838320
394 Ga0105240_10964603
395 Ga0105243_10486172
396 Ga0105241_10000539
397 Ga0105241_10023762
398 Ga0105241_10050196
399 Ga0105241_10597820
400 Ga0105242_10026174
401 Ga0105237_10000215
402 Ga0105237_10000758
403 Ga0105237_10011689
404 Ga0105237_10013448
405 Ga0105237_10020811
406 Ga0105237_10055877
407 Ga0105237_10092725
408 Ga0105237_10092948
409 Ga0105237_10179652
410 Ga0105237_10398163
411 Ga0105238_10000693
412 Ga0105238_10019749
413 Ga0105238_10071970
414 Ga0105238_10356603
415 Ga0105249_10670207
416 Ga0105239_10000008
417 Ga0105239_10000012
418 Ga0105239_10000285
419 Ga0105239_10000955
420 Ga0105239_10003362
421 Ga0105239_10094758
422 Ga0105239_10235499
423 Ga0105239_10340279
424 Ga0105239_10469800
425 Ga0105239_10927691
426 Ga0105246_10047214
427 Ga0157373_10000040
428 Ga0157373_10169215
429 Ga0157371_10000571
430 Ga0157371_10012884
431 Ga0157371_10016919
432 Ga0157371_10025841
433 Ga0157370_10053393
434 Ga0157369_10008991
435 Ga0157369_10790732
436 Ga0157374_10000076
437 Ga0157374_10440132
438 Ga0157374_11048425
439 Ga0157378_10049079
440 Ga0157378_10061266
441 Ga0157378_10157253
442 Ga0163162_10000044
443 Ga0163162_10000985
444 Ga0163162_10046291
445 Ga0157372_10000182
446 Ga0157372_10000432
447 Ga0157372_10000538
448 Ga0157372_10001687
449 Ga0157372_10033736
450 Ga0157372_10043504
451 Ga0157372_10126753
452 Ga0157375_10031523
453 Ga0157375_10079086
454 Ga0157377_10008329
455 Ga0157376_10066632
456 Ga0163161_10015660
457 Ga0213872_10011212
458 Ga0209563_103615
459 Ga0207427_100138
460 Ga0209437_100010
461 Ga0209437_100030
462 Ga0209026_1000292
463 Ga0209026_1008279
464 Ga0209148_1024377
465 Ga0209148_1025819
466 Ga0209129_1009533
467 Ga0209233_1000017
468 Ga0209233_1001084
469 Ga0209233_1017349
470 Ga0209233_1028181
471 Ga0209455_1001823
472 Ga0207642_10066079
473 Ga0207647_10000027
474 Ga0207647_10000080
475 Ga0207647_10150268
476 Ga0207647_10151848
477 Ga0207645_10002125
478 Ga0207705_10000102
479 Ga0207705_10153409
480 Ga0207654_10001274
481 Ga0207654_10008230
482 Ga0207654_10076589
483 Ga0207695_10000183
484 Ga0207695_10002635
485 Ga0207695_10011138
486 Ga0207695_10011883
487 Ga0207695_10226680
488 Ga0207695_10756290
489 Ga0207671_10000477
490 Ga0207671_10001625
491 Ga0207671_10006188
492 Ga0207671_10009416
493 Ga0207671_10023033
494 Ga0207671_10024996
495 Ga0207671_10035249
496 Ga0207671_10131602
497 Ga0207671_10344114
498 Ga0207657_10018866
499 Ga0207657_10073079
500 Ga0207652_10085173
501 Ga0207694_10108573
502 Ga0207694_10310861
503 Ga0207644_10009317
504 Ga0207690_10001766
505 Ga0207690_10017396
506 Ga0207690_10214329
507 Ga0207706_10000010
508 Ga0207706_10122223
509 Ga0207709_10330857
510 Ga0207669_10096854
511 Ga0207704_10000016
512 Ga0207667_10000263
513 Ga0207667_10010686
514 Ga0207667_10014898
515 Ga0207667_10030215
516 Ga0207651_10064304
517 Ga0207677_10054195
518 Ga0207639_10025354
519 Ga0207639_10028473
520 Ga0207639_10049848
521 Ga0207702_10139834
522 Ga0207674_10064313
523 Ga0207674_10071978
524 Ga0207683_10019733
525 Ga0207698_10085749
526 Ga0207698_10167682
527 Ga0268266_10000291
528 Ga0307517_10015329
529 Ga0307515_10000510
530 Ga0307515_10004687
531 Ga0307513_10350937
532 Ga0307509_10049518
533 Ga0307408_100003271
534 Ga0307408_100005002
535 Ga0307412_10001558
536 Ga0307412_10087843
537 Ga0307414_10439494
538 Ga0307414_10488504
539 Ga0307507_10001556
540 Ga0307510_10000786
541 Ga0395899_0000017
542 Ga0395899_0000761
543 Ga0395899_0001206
544 Ga0395899_0013469
545 Ga0395900_0000151
546 Ga0395900_0000382
547 Ga0395900_0015862
548 Ga0395900_0056430
549 Ga0395898_0008022
550 Ga0395905_0000001
551 Ga0395905_0004668
552 Ga0395905_0012604
553 Ga0395901_0000691
554 Ga0395901_0005385
555 Ga0395901_0420726
556 Ga0436361_1160711
557 Ga0451849_1384794
558 Ga0439448_0004084
559 Ga0439457_006384
560 Ga0466966_0229797
561 Ga0495592_0220364
562 Ga0495638_0150952
563 Ga0495638_0167893
564 Ga0495650_0000098
565 Ga0495585_0000308
566 Ga0495585_0000794
567 Ga0495583_0023237
568 Ga0495583_0066080
569 Ga0495606_0000021
570 Ga0495606_0003957
571 Ga0495606_0030829
572 Ga0495606_0063923
573 Ga0495610_0000735
574 Ga0495616_0001331
575 Ga0495616_0002324
576 Ga0495632_0177407
577 Ga0495644_0013034
578 Ga0495648_0010009
579 Ga0495648_0010590
580 Ga0495652_0351309
581 Ga0495609_0005700
582 Ga0495609_0020950
583 Ga0495622_0298916
584 Ga0495633_0000082
585 Ga0495633_0002240
586 Ga0495668_0000017
587 Ga0495668_0098514
588 Ga0495625_0000155
589 Ga0495625_0000183
590 Ga0495625_0000589
591 Ga0495625_0081873
592 Ga0495625_0291006
593 Ga0495661_0002653
594 Ga0495661_0037784
595 Ga0495658_0016004
596 Ga0495649_0000046
597 Ga0495660_0011781
598 Ga0495683_0008660
599 Ga0495687_000440
600 Ga0495687_004943
601 Ga0495679_034549
602 Ga0495686_0000541
603 Ga0495686_0000554
604 Ga0495686_0042880
605 Ga0495686_0103608
606 Ga0495682_0164490
607 Ga0501033_0146594
608 nmdc:mga0k408_299_c1
609 nmdc:mga0k408_57_c1
610 nmdc:mga0k408_66242_c1
611 Ga0500635_0024054
612 Ga0500578_0280981
613 Ga0500608_000432
614 Ga0500618_000218
615 Ga0500622_0001236
616 Ga0500624_000568
617 2599481736
618 2852625750
619 2884935725
620 2919439790
621 2928082009
622 2928152029
623 2932088064
624 2977235073

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11967

RecO_N

Recombination protein O N terminal

1

79

0.92

PF02565

RecO_C

Recombination protein O C terminal

86

232

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bq2-assembly1.cif.gz_A-2 crystal structure of medicago truncatula thermospermine synthase (mttsps) 0.8404 8 35
6bq2-assembly1.cif.gz_B crystal structure of medicago truncatula thermospermine synthase (mttsps) 0.8391 8 35
2pys-assembly1.cif.gz_B crystal structure of a five site mutated cyanovirin-n with a mannose dimer bound at 1.8 a resolution 0.8095 8 38
3lhc-assembly1.cif.gz_A-2 crystal structure of cyanovirin-n swapping domain b mutant 0.8032 8 37
3gxz-assembly1.cif.gz_B crystal structure of cyanovirin-n complexed to oligomannose-9 (man-9) 0.8029 8 37
ID Description Score Start End Superfamily
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.925 1 78 2.40.50.140
3q8dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8534 4 78 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8403 1 78 2.40.50.140
3lhcA00 Mainly Beta;Roll;HIV-inactivating Protein, Cyanovirin-n;Cyanovirin-N 0.8043 8 37 2.30.60.10
af_Q9UT10_502_586_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8022 5 28 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A521AS64-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9855 1 239 GO:0006302
GO:0006310
GO:0043590
AF-A0A521AS64-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9815 1 239 GO:0006302
GO:0006310
GO:0043590
AF-F0S4R0-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9786 1 239 GO:0006302
GO:0006310
GO:0043590
AF-A0A661YN43-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9783 1 239 GO:0006302
GO:0006310
GO:0043590
AF-A0A519UQY4-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9772 1 239 GO:0006302
GO:0006310
GO:0043590

Map