F401477

General Info

Members Datasets Scaffolds Average Seq Length
311 236 622 281

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2867369537|2867373907
Length 314
Sequence PAPAPAPGPSGTSGPIGTGARTGLLPSPTAATTRTSRPPRLSRQRRQRVAADLGLLVAAGAFVVPLLWLVFASLDAEAKLKVSPPSSPTMENFSAVWTDEITFTPMLNSFLICGSGTLLTMVCAALAAYPLSRYRSRFGRPYLLGILFTTCLPITAVMVPIYSLFVQINLIDTMWGTSLFLATSQLPFAIWLMKNFMDGVPIVLEEAAWTDGASWFQALVRVIVPLMGPGVTVVTIYSFIMMWGNFFVPFMLLLDPEKLPASVSIYTFFGNYGVVVYGELAAFSILYSTPVLLLYILISRRMGGGFTLGGGVKG

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
26 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
27 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
28 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
39 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
42 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
43 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
44 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
45 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
46 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
47 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
50 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
51 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
56 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
57 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
58 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
59 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
60 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
61 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
62 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
65 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
66 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
67 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
68 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
69 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
76 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
103 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
108 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
154 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
155 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
156 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
157 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
158 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
159 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 2867369537 Streptomyces sp. Z26 Isolate Unclassified
162 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
163 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
164 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
165 2643221616 Leifsonia sp. Root227 Isolate Unclassified
166 2643221619 Agromyces sp. Root81 Isolate Unclassified
167 2643221647 Streptomyces sp. Root369 Isolate Unclassified
168 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
169 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
170 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
171 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
172 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
173 2808606448 Streptomyces sp. 193411 Isolate Unclassified
174 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
175 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
176 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
177 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
178 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
179 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
180 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
181 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
182 2862574272 Streptomyces sp. AcE210 Isolate Nodule
183 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
184 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
185 2867428634 Streptomyces sp. RP5T Isolate Unclassified
186 2867475112 Streptomyces sp. TM32 Isolate Unclassified
187 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
188 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
189 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
190 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
191 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
192 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
193 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
194 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
195 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
196 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
197 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
198 2928153084 Leifsonia sp. 563 Isolate Unclassified
199 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
200 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
201 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
202 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
203 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
204 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
205 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
206 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
207 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
208 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
209 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
210 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
211 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
212 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
213 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
214 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
215 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
216 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
217 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
218 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
219 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
220 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
221 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
222 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
223 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
224 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
225 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
226 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
227 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
228 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
229 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
230 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
231 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
232 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
233 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
234 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
235 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
236 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.67
Metatranscriptomes 0.96
Isolates 26.37

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 9.97
Nodule 1.29
Rhizoplane 1.93
Rhizosphere 63.99
Stem 0
Stem Tuber 0.32
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10027589 3300001989 Bacteria 1984
2 JGI24737J22298_10004396 3300001990 Bacteria 4916
3 JGI24737J22298_10024327 3300001990 Bacteria 1918
4 JGI25164J39214_1000788 3300002772 Bacteria 11434
5 JGI25165J46597_1000005 3300003214 Bacteria 623702
6 rootH1_10022188 3300003323 Bacteria 1822
7 JGI25160J50197_1004715 3300003354 Bacteria 5838
8 JGI25160J50197_1012232 3300003354 Bacteria 2993
9 Ga0007416J51690_1053490 3300003577 Bacteria 1861
10 Ga0006562J51391_1114143 3300003578 Bacteria 3730
11 Ga0032354_1082874 3300003693 Bacteria 1212
12 Ga0070713_100222420 3300005436 Bacteria 1713
13 Ga0068855_100093758 3300005563 Bacteria 3462
14 Ga0068856_100081922 3300005614 Bacteria 3202
15 Ga0081455_10091480 3300005937 Bacteria 2464
16 Ga0075368_10028875 3300006042 Bacteria 2144
17 Ga0075363_100011004 3300006048 Bacteria 4318
18 Ga0075363_100014805 3300006048 Bacteria 3821
19 Ga0075367_10043296 3300006178 Bacteria 2637
20 Ga0075369_10063990 3300006186 Bacteria 1610
21 Ga0075370_10062145 3300006353 Bacteria 2128
22 Ga0105244_10002066 3300009036 Bacteria 15467
23 Ga0105243_10124152 3300009148 Bacteria 2181
24 Ga0105241_10160113 3300009174 Bacteria 1849
25 Ga0105246_10047347 3300011119 Bacteria 2936
26 Ga0157369_10159588 3300013105 Bacteria 2380
27 Ga0157369_10478746 3300013105 Bacteria 1288
28 Ga0157372_10204612 3300013307 Bacteria 2287
29 Ga0207427_100024 3300025231 Bacteria 438403
30 Ga0209437_100336 3300025233 Bacteria 57788
31 Ga0209233_1000001 3300025261 Bacteria 2992747
32 Ga0207426_1001550 3300025302 Bacteria 18675
33 Ga0207426_1003744 3300025302 Bacteria 7939
34 Ga0207426_1005334 3300025302 Bacteria 5905
35 Ga0207426_1014222 3300025302 Bacteria 2921
36 Ga0207426_1016854 3300025302 Bacteria 2610
37 Ga0209051_1025515 3300025303 Bacteria 2402
38 Ga0207655_1023161 3300025728 Bacteria 3088
39 Ga0207647_10016734 3300025904 Bacteria 4997
40 Ga0207671_10188597 3300025914 Bacteria 1607
41 Ga0207671_10241299 3300025914 Bacteria 1419
42 Ga0207700_10032535 3300025928 Bacteria 3721
43 Ga0207709_10422225 3300025935 Bacteria 1024
44 Ga0207667_10015371 3300025949 Bacteria 8700
45 Ga0207639_10679904 3300026041 Bacteria 954
46 Ga0207702_10606954 3300026078 Bacteria 1074
47 Ga0209282_1080429 3300027666 Bacteria 1742
48 Ga0209813_10014132 3300027866 Bacteria 2144
49 Ga0307515_10000362 3300028794 Bacteria 111330
50 Ga0307515_10086165 3300028794 Bacteria 4008
51 Ga0307515_10101742 3300028794 Bacteria 3464
52 Ga0307515_10146175 3300028794 Bacteria 2502
53 Ga0307512_10001664 3300030522 Bacteria 30612
54 Ga0307512_10002652 3300030522 Bacteria 22092
55 Ga0307512_10030075 3300030522 Bacteria 4732
56 Ga0307512_10060332 3300030522 Bacteria 2933
57 Ga0307513_10315153 3300031456 Bacteria 1324
58 Ga0307509_10126080 3300031507 Bacteria 2526
59 Ga0307508_10002289 3300031616 Bacteria 20350
60 Ga0307508_10004862 3300031616 Bacteria 12936
61 Ga0307508_10050655 3300031616 Bacteria 3694
62 Ga0307508_10103631 3300031616 Bacteria 2441
63 Ga0307508_10131037 3300031616 Bacteria 2111
64 Ga0307514_10020188 3300031649 Bacteria 5439
65 Ga0307514_10114841 3300031649 Bacteria 1897
66 Ga0307514_10143799 3300031649 Bacteria 1615
67 Ga0307516_10004592 3300031730 Bacteria 16948
68 Ga0307516_10005589 3300031730 Bacteria 14975
69 Ga0307516_10024784 3300031730 Bacteria 6122
70 Ga0307516_10053044 3300031730 Bacteria 3967
71 Ga0307516_10137949 3300031730 Bacteria 2211
72 Ga0307518_10040013 3300031838 Bacteria 3409
73 Ga0307416_100499531 3300032002 Bacteria 1280
74 Ga0307507_10062220 3300033179 Bacteria 3469
75 Ga0307507_10175407 3300033179 Bacteria 1546
76 Ga0307510_10010275 3300033180 Bacteria 11120
77 Ga0307510_10037425 3300033180 Bacteria 5383
78 Ga0373951_0000025 3300035091 Bacteria 60479
79 Ga0395900_0226041 3300037418 Bacteria 1884
80 Ga0395898_0003519 3300037466 Bacteria 17456
81 Ga0395898_0014490 3300037466 Bacteria 8098
82 Ga0395901_0034424 3300038443 Bacteria 5231
83 Ga0439436_0000454 3300041404 Bacteria 10476
84 Ga0439439_0003658 3300041406 Bacteria 3409
85 Ga0451793_0279641 3300041452 Bacteria 1125
86 Ga0451802_1433528 3300041460 Bacteria 2757
87 Ga0451807_1036583 3300041486 Bacteria 1700
88 Ga0451837_1111830 3300041494 Bacteria 2571
89 Ga0451841_1320072 3300041498 Bacteria 1858
90 Ga0451843_0902557 3300041509 Bacteria 1177
91 Ga0451853_0699918 3300041512 Bacteria 8608
92 Ga0451853_2917445 3300041512 Bacteria 1086
93 Ga0439448_0002408 3300042005 Bacteria 5079
94 Ga0439432_005507 3300042006 Bacteria 4554
95 Ga0439455_0010298 3300042012 Bacteria 2054
96 Ga0439457_000156 3300042014 Bacteria 17591
97 Ga0450903_003141 3300042138 Bacteria 2877
98 Ga0439458_0013883 3300042157 Bacteria 1815
99 Ga0466972_0007186 3300044658 Bacteria 5591
100 Ga0466965_0035915 3300044683 Bacteria 2429
101 Ga0466965_0060768 3300044683 Bacteria 1888
102 Ga0466966_0031723 3300044684 Bacteria 3426
103 Ga0466961_0021801 3300044693 Bacteria 4121
104 Ga0466963_0034236 3300044694 Bacteria 3304
105 Ga0466964_0039310 3300044706 Bacteria 1906
106 Ga0466964_0077975 3300044706 Bacteria 1416
107 Ga0466971_0016350 3300044719 Bacteria 3273
108 Ga0466971_0021008 3300044719 Bacteria 2903
109 Ga0466968_0019901 3300044735 Bacteria 2706
110 Ga0466970_0008563 3300044765 Bacteria 5149
111 Ga0466970_0098341 3300044765 Bacteria 1592
112 Ga0466957_0037978 3300044842 Bacteria 2900
113 Ga0466957_0241782 3300044842 Bacteria 1198
114 Ga0466959_0035686 3300045049 Bacteria 3675
115 Ga0466959_0246149 3300045049 Bacteria 1234
116 Ga0466959_0248210 3300045049 Bacteria 1228
117 Ga0466958_0021237 3300045836 Bacteria 3792
118 Ga0466958_0046246 3300045836 Bacteria 2627
119 Ga0466967_0080145 3300045976 Bacteria 2945
120 Ga0495617_017765 3300046452 Bacteria 2403
121 Ga0495592_0036789 3300046454 Bacteria 3685
122 Ga0495603_0002335 3300046455 Bacteria 11135
123 Ga0495603_0093851 3300046455 Bacteria 1753
124 Ga0495629_0001224 3300046459 Bacteria 20148
125 Ga0495629_0039466 3300046459 Bacteria 3322
126 Ga0495638_0198462 3300046460 Bacteria 1134
127 Ga0495651_0118519 3300046462 Bacteria 1947
128 Ga0495605_0007213 3300046474 Bacteria 6319
129 Ga0495662_0008903 3300046476 Bacteria 4930
130 Ga0495662_0025136 3300046476 Bacteria 2875
131 Ga0495664_0016784 3300046477 Bacteria 4178
132 Ga0495664_0041220 3300046477 Bacteria 2731
133 Ga0495594_0000286 3300046499 Bacteria 24943
134 Ga0495594_0038537 3300046499 Bacteria 2610
135 Ga0495607_0074227 3300046501 Bacteria 1888
136 Ga0495607_0084423 3300046501 Bacteria 1737
137 Ga0495583_0012634 3300046506 Bacteria 4762
138 Ga0495583_0063517 3300046506 Bacteria 1640
139 Ga0495606_0019583 3300046507 Bacteria 5026
140 Ga0495616_0055511 3300046513 Bacteria 1960
141 Ga0495620_0011552 3300046515 Bacteria 4602
142 Ga0495620_0136212 3300046515 Bacteria 962
143 Ga0495628_0249604 3300046516 Bacteria 1325
144 Ga0495637_0065937 3300046520 Bacteria 1473
145 Ga0495643_0001648 3300046522 Bacteria 19654
146 Ga0495648_0052681 3300046524 Bacteria 2470
147 Ga0495666_0084066 3300046526 Bacteria 1504
148 Ga0495642_0039005 3300046528 Bacteria 1926
149 Ga0495652_0053289 3300046529 Bacteria 3448
150 Ga0495665_0176539 3300046531 Bacteria 1111
151 Ga0495640_0023997 3300046533 Bacteria 4436
152 Ga0495640_0183707 3300046533 Bacteria 1332
153 Ga0495609_0005282 3300046538 Bacteria 6851
154 Ga0495597_0014286 3300046542 Bacteria 3783
155 Ga0495622_0004456 3300046557 Bacteria 6502
156 Ga0495622_0007541 3300046557 Bacteria 5051
157 Ga0495656_0045818 3300046615 Bacteria 1848
158 Ga0495668_0029128 3300046616 Bacteria 3121
159 Ga0495668_0158784 3300046616 Bacteria 1238
160 Ga0495634_0023219 3300046642 Bacteria 4361
161 Ga0495634_0154065 3300046642 Bacteria 1451
162 Ga0495611_0006079 3300046648 Bacteria 5151
163 Ga0495625_0012459 3300046660 Bacteria 6891
164 Ga0495625_0054660 3300046660 Bacteria 2850
165 Ga0495635_0007566 3300046663 Bacteria 7578
166 Ga0495588_0003752 3300046674 Bacteria 6643
167 Ga0495588_0136385 3300046674 Bacteria 1295
168 Ga0495657_0035510 3300046675 Bacteria 3453
169 Ga0495657_0040087 3300046675 Bacteria 3214
170 Ga0495646_0000467 3300046680 Bacteria 21506
171 Ga0495613_0001168 3300046689 Bacteria 20054
172 Ga0495613_0020694 3300046689 Bacteria 4905
173 Ga0495624_0144176 3300046690 Bacteria 1458
174 Ga0495649_0025341 3300046694 Bacteria 3303
175 Ga0495589_0024799 3300046794 Bacteria 3046
176 Ga0495589_0069332 3300046794 Bacteria 1724
177 Ga0495589_0069339 3300046794 Bacteria 1724
178 Ga0495589_0090576 3300046794 Bacteria 1485
179 Ga0495581_0059844 3300047315 Bacteria 2201
180 Ga0495604_0000568 3300047317 Bacteria 32485
181 Ga0495604_0064075 3300047317 Bacteria 2802
182 Ga0495636_0005409 3300047318 Bacteria 5018
183 Ga0495636_0014696 3300047318 Bacteria 3115
184 Ga0495676_0003786 3300047321 Bacteria 13749
185 Ga0495676_0006329 3300047321 Bacteria 10901
186 Ga0495676_0033402 3300047321 Bacteria 4334
187 Ga0495676_0042648 3300047321 Bacteria 3721
188 Ga0495680_0068394 3300047322 Bacteria 2713
189 Ga0495687_001345 3300047443 Bacteria 22903
190 Ga0495685_001509 3300047447 Bacteria 7135
191 Ga0495685_004447 3300047447 Bacteria 4529
192 Ga0495685_012097 3300047447 Bacteria 2919
193 Ga0495685_029388 3300047447 Bacteria 1889
194 Ga0495685_065558 3300047447 Bacteria 1220
195 Ga0495681_0014449 3300047470 Bacteria 4523
196 Ga0495686_0057635 3300047472 Bacteria 2424
197 Ga0495593_0021587 3300047673 Bacteria 3593
198 Ga0495593_0047710 3300047673 Bacteria 2277
199 Ga0495614_0002157 3300048089 Bacteria 8713
200 Ga0495614_0027528 3300048089 Bacteria 2451
201 Ga0495626_0005405 3300048091 Bacteria 7492
202 Ga0496112_0069650 3300048915 Bacteria 3475
203 Ga0496112_0582691 3300048915 Bacteria 1051
204 Ga0496122_0111952 3300048925 Bacteria 1789
205 Ga0496126_0036310 3300048929 Bacteria 4608
206 Ga0501032_0086084 3300049569 Bacteria 2089
207 Ga0501033_0002093 3300049570 Bacteria 17298
208 Ga0501034_0016009 3300049571 Bacteria 7698
209 Ga0501038_0002037 3300049574 Bacteria 18694
210 Ga0501043_0087039 3300049579 Bacteria 2455
211 Ga0501047_0199256 3300049581 Bacteria 1863
212 Ga0501282_002229 3300049778 Bacteria 2126
213 Ga0501035_0030369 3300049822 Bacteria 4927
214 Ga0501044_0009801 3300049823 Bacteria 10415
215 nmdc:mga06z11_29536_c1 3300050494 Bacteria 2642
216 nmdc:mga04h51_16507_c1 3300050495 Bacteria 2144
217 nmdc:mga07m45_108528_c1 3300050496 Bacteria 1597
218 Ga0495612_0051320 3300053078 Bacteria 1695
219 Ga0500635_0000088 3300053080 Bacteria 58889
220 Ga0495619_0102528 3300053085 Bacteria 1949
221 Ga0500651_0049122 3300053093 Bacteria 2650
222 Ga0500640_073544 3300053095 Bacteria 1462
223 Ga0500569_035405 3300053109 Bacteria 1431
224 Ga0500594_0027194 3300053118 Bacteria 1479
225 Ga0500573_0034618 3300053140 Bacteria 2914
226 Ga0500577_0002906 3300053142 Bacteria 4410
227 Ga0500600_0139437 3300053149 Bacteria 1223
228 Ga0466962_0016542 3300061719 Bacteria 3556
229 Ga0466962_0032377 3300061719 Bacteria 2503
230 2867373907 2867369537 Bacteria 6501581
231 2585308093 2582581313 Bacteria 10042643
232 2585309099 2582581313 Bacteria 10042643
233 2585319287 2582581314 Bacteria 11452267
234 2616697341 2616644814 Bacteria 11555299
235 2644097290 2643221616 Bacteria 4066575
236 2644111689 2643221619 Bacteria 4158469
237 2644265765 2643221647 Bacteria 10741251
238 2644266301 2643221647 Bacteria 10741251
239 2784590451 2784132148 Bacteria 8627943
240 2785366049 2784746768 Bacteria 10036182
241 2785371544 2784746768 Bacteria 10036182
242 2786667031 2786546132 Bacteria 10419719
243 2793983614 2791355406 Bacteria 11364898
244 2808913663 2808606375 Bacteria 9466072
245 2809234124 2808606448 Bacteria 8656184
246 2811844367 2808606982 Bacteria 7791042
247 2812355903 2811994879 Bacteria 9313447
248 2812478713 2811994917 Bacteria 7761064
249 2844849154 2844849076 Bacteria 4091819
250 2862186455 2862178590 Bacteria 8583590
251 2862284698 2862281513 Bacteria 9621493
252 2862293536 2862290372 Bacteria 7471434
253 2862392311 2862382967 Bacteria 10317375
254 2862577465 2862574272 Bacteria 10567477
255 2862993527 2862993130 Bacteria 3860849
256 2863408659 2863404153 Bacteria 9672205
257 2867428846 2867428634 Bacteria 9590268
258 2867478850 2867475112 Bacteria 6909112
259 2873154012 2873151551 Bacteria 8625867
260 2877684448 2877676314 Bacteria 9512378
261 2884763515 2884763398 Bacteria 4091164
262 2895429188 2895427314 Bacteria 13147766
263 2904511181 2904509784 Bacteria 3520416
264 2904777369 2904776348 Bacteria 4658726
265 2908680073 2908678064 Bacteria 3482747
266 2912730121 2912723979 Bacteria 8557534
267 2912762793 2912757875 Bacteria 7940295
268 2919056938 2919055335 Bacteria 3875751
269 2919540208 2919538618 Bacteria 4677069
270 2928154649 2928153084 Bacteria 4020257
271 2946069884 2946064051 Bacteria 8957905
272 2947226903 2947224130 Bacteria 9938529
273 2954005515 2954002825 Bacteria 9173742
274 2954383964 2954380949 Bacteria 10050426
275 2954389988 2954380949 Bacteria 10050426
276 2954682116 2954673503 Bacteria 9685905
277 2954690808 2954682443 Bacteria 9862841
278 2954694760 2954691527 Bacteria 10720516
279 2954700661 2954691527 Bacteria 10720516
280 2954701568 2954701450 Bacteria 10834262
281 2954709962 2954701450 Bacteria 10834262
282 2954714269 2954711539 Bacteria 10867210
283 2954724219 2954721474 Bacteria 10456478
284 2954737620 2954731030 Bacteria 10243860
285 2954743116 2954740390 Bacteria 10229294
286 2954756455 2954749733 Bacteria 10366972
287 2954762074 2954759201 Bacteria 9358192
288 2974296533 2974294766 Bacteria 3767688
289 2974327230 2974324384 Bacteria 3750535
290 2977228901 2977228692 Bacteria 3450105
291 2977237693 2977236895 Bacteria 3569373
292 2984544524 2984542743 Bacteria 3569378
293 2990061860 2990059506 Bacteria 9321252
294 2990093346 2990088156 Bacteria 6657676
295 2997452914 2997451912 Bacteria 8492419
296 3006500159 3006493962 Bacteria 8825450
297 8008562831 8008558824 Bacteria 10610750
298 8008577129 8008574985 Bacteria 7815457
299 8023629617 8023623736 Bacteria 8593882
300 8025479061 8025478263 Bacteria 8209203
301 8025536237 8025530807 Bacteria 8495698
302 8033685345 8033684223 Bacteria 6906479
303 8047896063 8047893842 Bacteria 11723082
304 8048132224 8048127548 Bacteria 11053136
305 8048362872 8048356638 Bacteria 11044339
306 8048373088 8048369669 Bacteria 11666822
307 8048382021 8048379754 Bacteria 11877923
308 8055066728 8055066027 Bacteria 9479577
309 8056453761 8056447290 Bacteria 7680491
310 8056672518 8056667051 Bacteria 6953971
311 8056832240 8056829672 Bacteria 9045328
312 JGI24739J22299_10027589
313 JGI24737J22298_10004396
314 JGI24737J22298_10024327
315 JGI25164J39214_1000788
316 JGI25165J46597_1000005
317 rootH1_10022188
318 JGI25160J50197_1004715
319 JGI25160J50197_1012232
320 Ga0007416J51690_1053490
321 Ga0006562J51391_1114143
322 Ga0032354_1082874
323 Ga0070713_100222420
324 Ga0068855_100093758
325 Ga0068856_100081922
326 Ga0081455_10091480
327 Ga0075368_10028875
328 Ga0075363_100011004
329 Ga0075363_100014805
330 Ga0075367_10043296
331 Ga0075369_10063990
332 Ga0075370_10062145
333 Ga0105244_10002066
334 Ga0105243_10124152
335 Ga0105241_10160113
336 Ga0105246_10047347
337 Ga0157369_10159588
338 Ga0157369_10478746
339 Ga0157372_10204612
340 Ga0207427_100024
341 Ga0209437_100336
342 Ga0209233_1000001
343 Ga0207426_1001550
344 Ga0207426_1003744
345 Ga0207426_1005334
346 Ga0207426_1014222
347 Ga0207426_1016854
348 Ga0209051_1025515
349 Ga0207655_1023161
350 Ga0207647_10016734
351 Ga0207671_10188597
352 Ga0207671_10241299
353 Ga0207700_10032535
354 Ga0207709_10422225
355 Ga0207667_10015371
356 Ga0207639_10679904
357 Ga0207702_10606954
358 Ga0209282_1080429
359 Ga0209813_10014132
360 Ga0307515_10000362
361 Ga0307515_10086165
362 Ga0307515_10101742
363 Ga0307515_10146175
364 Ga0307512_10001664
365 Ga0307512_10002652
366 Ga0307512_10030075
367 Ga0307512_10060332
368 Ga0307513_10315153
369 Ga0307509_10126080
370 Ga0307508_10002289
371 Ga0307508_10004862
372 Ga0307508_10050655
373 Ga0307508_10103631
374 Ga0307508_10131037
375 Ga0307514_10020188
376 Ga0307514_10114841
377 Ga0307514_10143799
378 Ga0307516_10004592
379 Ga0307516_10005589
380 Ga0307516_10024784
381 Ga0307516_10053044
382 Ga0307516_10137949
383 Ga0307518_10040013
384 Ga0307416_100499531
385 Ga0307507_10062220
386 Ga0307507_10175407
387 Ga0307510_10010275
388 Ga0307510_10037425
389 Ga0373951_0000025
390 Ga0395900_0226041
391 Ga0395898_0003519
392 Ga0395898_0014490
393 Ga0395901_0034424
394 Ga0439436_0000454
395 Ga0439439_0003658
396 Ga0451793_0279641
397 Ga0451802_1433528
398 Ga0451807_1036583
399 Ga0451837_1111830
400 Ga0451841_1320072
401 Ga0451843_0902557
402 Ga0451853_0699918
403 Ga0451853_2917445
404 Ga0439448_0002408
405 Ga0439432_005507
406 Ga0439455_0010298
407 Ga0439457_000156
408 Ga0450903_003141
409 Ga0439458_0013883
410 Ga0466972_0007186
411 Ga0466965_0035915
412 Ga0466965_0060768
413 Ga0466966_0031723
414 Ga0466961_0021801
415 Ga0466963_0034236
416 Ga0466964_0039310
417 Ga0466964_0077975
418 Ga0466971_0016350
419 Ga0466971_0021008
420 Ga0466968_0019901
421 Ga0466970_0008563
422 Ga0466970_0098341
423 Ga0466957_0037978
424 Ga0466957_0241782
425 Ga0466959_0035686
426 Ga0466959_0246149
427 Ga0466959_0248210
428 Ga0466958_0021237
429 Ga0466958_0046246
430 Ga0466967_0080145
431 Ga0495617_017765
432 Ga0495592_0036789
433 Ga0495603_0002335
434 Ga0495603_0093851
435 Ga0495629_0001224
436 Ga0495629_0039466
437 Ga0495638_0198462
438 Ga0495651_0118519
439 Ga0495605_0007213
440 Ga0495662_0008903
441 Ga0495662_0025136
442 Ga0495664_0016784
443 Ga0495664_0041220
444 Ga0495594_0000286
445 Ga0495594_0038537
446 Ga0495607_0074227
447 Ga0495607_0084423
448 Ga0495583_0012634
449 Ga0495583_0063517
450 Ga0495606_0019583
451 Ga0495616_0055511
452 Ga0495620_0011552
453 Ga0495620_0136212
454 Ga0495628_0249604
455 Ga0495637_0065937
456 Ga0495643_0001648
457 Ga0495648_0052681
458 Ga0495666_0084066
459 Ga0495642_0039005
460 Ga0495652_0053289
461 Ga0495665_0176539
462 Ga0495640_0023997
463 Ga0495640_0183707
464 Ga0495609_0005282
465 Ga0495597_0014286
466 Ga0495622_0004456
467 Ga0495622_0007541
468 Ga0495656_0045818
469 Ga0495668_0029128
470 Ga0495668_0158784
471 Ga0495634_0023219
472 Ga0495634_0154065
473 Ga0495611_0006079
474 Ga0495625_0012459
475 Ga0495625_0054660
476 Ga0495635_0007566
477 Ga0495588_0003752
478 Ga0495588_0136385
479 Ga0495657_0035510
480 Ga0495657_0040087
481 Ga0495646_0000467
482 Ga0495613_0001168
483 Ga0495613_0020694
484 Ga0495624_0144176
485 Ga0495649_0025341
486 Ga0495589_0024799
487 Ga0495589_0069332
488 Ga0495589_0069339
489 Ga0495589_0090576
490 Ga0495581_0059844
491 Ga0495604_0000568
492 Ga0495604_0064075
493 Ga0495636_0005409
494 Ga0495636_0014696
495 Ga0495676_0003786
496 Ga0495676_0006329
497 Ga0495676_0033402
498 Ga0495676_0042648
499 Ga0495680_0068394
500 Ga0495687_001345
501 Ga0495685_001509
502 Ga0495685_004447
503 Ga0495685_012097
504 Ga0495685_029388
505 Ga0495685_065558
506 Ga0495681_0014449
507 Ga0495686_0057635
508 Ga0495593_0021587
509 Ga0495593_0047710
510 Ga0495614_0002157
511 Ga0495614_0027528
512 Ga0495626_0005405
513 Ga0496112_0069650
514 Ga0496112_0582691
515 Ga0496122_0111952
516 Ga0496126_0036310
517 Ga0501032_0086084
518 Ga0501033_0002093
519 Ga0501034_0016009
520 Ga0501038_0002037
521 Ga0501043_0087039
522 Ga0501047_0199256
523 Ga0501282_002229
524 Ga0501035_0030369
525 Ga0501044_0009801
526 nmdc:mga06z11_29536_c1
527 nmdc:mga04h51_16507_c1
528 nmdc:mga07m45_108528_c1
529 Ga0495612_0051320
530 Ga0500635_0000088
531 Ga0495619_0102528
532 Ga0500651_0049122
533 Ga0500640_073544
534 Ga0500569_035405
535 Ga0500594_0027194
536 Ga0500573_0034618
537 Ga0500577_0002906
538 Ga0500600_0139437
539 Ga0466962_0016542
540 Ga0466962_0032377
541 2867373907
542 2585308093
543 2585309099
544 2585319287
545 2616697341
546 2644097290
547 2644111689
548 2644265765
549 2644266301
550 2784590451
551 2785366049
552 2785371544
553 2786667031
554 2793983614
555 2808913663
556 2809234124
557 2811844367
558 2812355903
559 2812478713
560 2844849154
561 2862186455
562 2862284698
563 2862293536
564 2862392311
565 2862577465
566 2862993527
567 2863408659
568 2867428846
569 2867478850
570 2873154012
571 2877684448
572 2884763515
573 2895429188
574 2904511181
575 2904777369
576 2908680073
577 2912730121
578 2912762793
579 2919056938
580 2919540208
581 2928154649
582 2946069884
583 2947226903
584 2954005515
585 2954383964
586 2954389988
587 2954682116
588 2954690808
589 2954694760
590 2954700661
591 2954701568
592 2954709962
593 2954714269
594 2954724219
595 2954737620
596 2954743116
597 2954756455
598 2954762074
599 2974296533
600 2974327230
601 2977228901
602 2977237693
603 2984544524
604 2990061860
605 2990093346
606 2997452914
607 3006500159
608 8008562831
609 8008577129
610 8023629617
611 8025479061
612 8025536237
613 8033685345
614 8047896063
615 8048132224
616 8048362872
617 8048373088
618 8048382021
619 8055066728
620 8056453761
621 8056672518
622 8056832240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

116

304

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.8929 14 274
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8825 14 268
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8815 15 278
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.856 14 273
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8497 20 270
ID Description Score Start End Superfamily
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9248 10 268 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9204 10 268 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9098 15 268 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9028 18 269 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9025 8 268 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A399PHK0-F1-model_v4 Carbohydrate ABC transporter permease 0.9597 15 230 GO:0005886
GO:0055085
AF-A0A2G6K6S2-F1-model_v4 Sugar ABC transporter permease 0.954 10 255 GO:0005886
GO:0055085
AF-W4VNM3-F1-model_v4 Sugar transporter membrane protein 0.948 21 269 GO:0005886
GO:0055085
AF-A0A2N2M8A6-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9461 48 270 GO:0005886
GO:0015423
GO:0042956
AF-A0A6G4VP12-F1-model_v4 Carbohydrate ABC transporter permease 0.946 10 273 GO:0005886
GO:0055085

Map