F401430

General Info

Members Datasets Scaffolds Average Seq Length
311 199 309 198

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0117812|Ga0501042_0117812_607_1287
Length 226
Sequence MTTGRKLVVGTFLTLDGVMQAPGGPDEDRDGGFEHGGWSVPYFDDKMGEVMVEWVGGAGGFLLGRRTYEIFAAAWPRMDDPSDPLATALNTRPKWVASKTLRSADWQDSTVLTGDIVEEVRRLKADSGGEIQVHGSCGLIQTLLRHDLIDEMRLWIYPLVLGSGKRLFGAGTVPASLRLTSTVFATTGVVLHVYERAGKPEYGSFSPDDAGNEGHRGPETWRASAR

Samples

Sample ID Description Type Environment
1 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
2 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
118 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
119 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
120 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
121 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
122 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
123 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
124 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
125 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
128 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
129 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
130 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 4.18
Rhizosphere 91.96
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001083 3300003203 Bacteria 12778
2 rootH1_10000064 3300003323 Bacteria 13039
3 rootH1_10234601 3300003323 Bacteria 3745
4 JGI25407J50210_10000548 3300003373 Bacteria 7566
5 JGI25404J52841_10006263 3300003659 Bacteria 2484
6 Ga0070683_100002751 3300005329 Bacteria 14053
7 Ga0070690_100260458 3300005330 Bacteria 1230
8 Ga0070680_100528810 3300005336 Unclassified 1010
9 Ga0070680_101197368 3300005336 Bacteria 657
10 Ga0070689_100199345 3300005340 Unclassified 1634
11 Ga0070687_100001118 3300005343 Bacteria 9251
12 Ga0070687_100095305 3300005343 Bacteria 1654
13 Ga0070661_101041469 3300005344 Bacteria 680
14 Ga0070692_10110079 3300005345 Bacteria 1522
15 Ga0070668_100130577 3300005347 Bacteria 2016
16 Ga0070675_100130494 3300005354 Bacteria 2141
17 Ga0070688_100132014 3300005365 Bacteria 1686
18 Ga0070659_100507996 3300005366 Bacteria 1028
19 Ga0070714_100413633 3300005435 Bacteria 1277
20 Ga0070713_100136063 3300005436 Bacteria 2171
21 Ga0070713_100543372 3300005436 Bacteria 1100
22 Ga0070710_10111515 3300005437 Bacteria 1644
23 Ga0070710_10808314 3300005437 Unclassified 670
24 Ga0070701_10242182 3300005438 Bacteria 1085
25 Ga0070708_100454206 3300005445 Bacteria 1209
26 Ga0070708_101327444 3300005445 Bacteria 672
27 Ga0070681_10021645 3300005458 Bacteria 6447
28 Ga0070685_10169181 3300005466 Bacteria 1399
29 Ga0070706_100000024 3300005467 Bacteria 158347
30 Ga0070706_100007547 3300005467 Bacteria 10188
31 Ga0070706_100008033 3300005467 Bacteria 9845
32 Ga0070707_100085054 3300005468 Bacteria 3056
33 Ga0070707_100458595 3300005468 Bacteria 1235
34 Ga0070707_100509942 3300005468 Bacteria 1165
35 Ga0070707_101531726 3300005468 Bacteria 634
36 Ga0070698_100197655 3300005471 Bacteria 1947
37 Ga0070699_100132009 3300005518 Bacteria 2202
38 Ga0070699_101260842 3300005518 Bacteria 678
39 Ga0070684_100001142 3300005535 Bacteria 19085
40 Ga0070697_100011543 3300005536 Bacteria 6901
41 Ga0070686_100000032 3300005544 Bacteria 113996
42 Ga0070665_100375636 3300005548 Unclassified 1428
43 Ga0070665_100910732 3300005548 Bacteria 892
44 Ga0070665_100932638 3300005548 Bacteria 881
45 Ga0070704_100420371 3300005549 Bacteria 1145
46 Ga0068855_100006656 3300005563 Bacteria 14035
47 Ga0070664_100149019 3300005564 Bacteria 2065
48 Ga0068857_100003333 3300005577 Bacteria 13364
49 Ga0068856_100059264 3300005614 Bacteria 3781
50 Ga0081455_10002321 3300005937 Bacteria 22689
51 Ga0081455_10004516 3300005937 Bacteria 15543
52 Ga0081455_10093097 3300005937 Bacteria 2437
53 Ga0081455_10303029 3300005937 Bacteria 1145
54 Ga0081538_10000093 3300005981 Bacteria 86826
55 Ga0081538_10000158 3300005981 Bacteria 71138
56 Ga0081538_10008168 3300005981 Bacteria 8931
57 Ga0081540_1000169 3300005983 Bacteria 68142
58 Ga0081539_10000132 3300005985 Bacteria 175454
59 Ga0081539_10136023 3300005985 Bacteria 1200
60 Ga0070717_10057029 3300006028 Bacteria 3228
61 Ga0070717_10319290 3300006028 Bacteria 1384
62 Ga0070717_10393820 3300006028 Bacteria 1243
63 Ga0075432_10011674 3300006058 Bacteria 2984
64 Ga0070712_100036999 3300006175 Bacteria 3324
65 Ga0075428_100115356 3300006844 Bacteria 2926
66 Ga0075428_100219843 3300006844 Bacteria 2051
67 Ga0075430_100053173 3300006846 Bacteria 3410
68 Ga0075431_100001828 3300006847 Bacteria 20111
69 Ga0075431_100062791 3300006847 Bacteria 3833
70 Ga0075431_100309520 3300006847 Bacteria 1595
71 Ga0075431_100343400 3300006847 Bacteria 1502
72 Ga0075433_10148670 3300006852 Bacteria 2083
73 Ga0075434_100634768 3300006871 Bacteria 1087
74 Ga0068865_100770195 3300006881 Bacteria 828
75 Ga0075435_100447615 3300007076 Bacteria 1114
76 Ga0105250_10054347 3300009092 Bacteria 1606
77 Ga0111539_11018754 3300009094 Bacteria 962
78 Ga0105247_10829489 3300009101 Unclassified 708
79 Ga0114129_10117498 3300009147 Bacteria 3664
80 Ga0114129_10200202 3300009147 Bacteria 2706
81 Ga0105243_10864334 3300009148 Bacteria 897
82 Ga0105248_10009898 3300009177 Bacteria 10495
83 Ga0105239_11259969 3300010375 Bacteria 853
84 Ga0105246_10640815 3300011119 Bacteria 924
85 Ga0157375_11054910 3300013308 Bacteria 950
86 Ga0157380_10006873 3300014326 Bacteria 8042
87 Ga0157380_10455749 3300014326 Bacteria 1230
88 Ga0213874_10125797 3300021377 Bacteria 875
89 Ga0207699_10045175 3300025906 Bacteria 2570
90 Ga0207684_10000004 3300025910 Bacteria 755956
91 Ga0207684_10002345 3300025910 Bacteria 19179
92 Ga0207684_10002585 3300025910 Bacteria 18132
93 Ga0207693_10000956 3300025915 Bacteria 25897
94 Ga0207693_10360323 3300025915 Bacteria 1138
95 Ga0207660_10672239 3300025917 Bacteria 844
96 Ga0207662_10003677 3300025918 Bacteria 7945
97 Ga0207662_10623986 3300025918 Bacteria 751
98 Ga0207646_10083557 3300025922 Bacteria 2856
99 Ga0207646_10263330 3300025922 Bacteria 1558
100 Ga0207646_10387373 3300025922 Bacteria 1263
101 Ga0207646_11293037 3300025922 Bacteria 637
102 Ga0207650_10558767 3300025925 Bacteria 960
103 Ga0207650_10628655 3300025925 Bacteria 904
104 Ga0207664_10649526 3300025929 Bacteria 948
105 Ga0207709_10758987 3300025935 Bacteria 780
106 Ga0207711_10014794 3300025941 Bacteria 6483
107 Ga0207661_10008179 3300025944 Bacteria 7466
108 Ga0207679_10222902 3300025945 Bacteria 1587
109 Ga0207667_10038369 3300025949 Bacteria 5117
110 Ga0207668_10462628 3300025972 Bacteria 1085
111 Ga0207708_10095597 3300026075 Bacteria 2295
112 Ga0207648_10159006 3300026089 Bacteria 1995
113 Ga0207648_10552839 3300026089 Bacteria 1057
114 Ga0207648_10884930 3300026089 Bacteria 834
115 Ga0207674_10006320 3300026116 Bacteria 13962
116 Ga0207683_11170057 3300026121 Bacteria 713
117 Ga0207698_10294169 3300026142 Bacteria 1508
118 Ga0207428_10104733 3300027907 Bacteria 2183
119 Ga0268266_10058884 3300028379 Bacteria 3308
120 Ga0307512_10137598 3300030522 Bacteria 1506
121 Ga0307513_10010442 3300031456 Bacteria 11641
122 Ga0307513_10399432 3300031456 Bacteria 1109
123 Ga0307408_100067668 3300031548 Bacteria 2628
124 Ga0307408_100091506 3300031548 Bacteria 2297
125 Ga0307408_100135958 3300031548 Bacteria 1923
126 Ga0307408_101057866 3300031548 Bacteria 751
127 Ga0307508_10116215 3300031616 Bacteria 2277
128 Ga0307405_10003336 3300031731 Bacteria 7353
129 Ga0307405_10276072 3300031731 Bacteria 1263
130 Ga0307413_10011775 3300031824 Bacteria 4319
131 Ga0307413_10119835 3300031824 Bacteria 1780
132 Ga0307410_10008537 3300031852 Bacteria 5687
133 Ga0307410_10028000 3300031852 Bacteria 3568
134 Ga0307410_10088764 3300031852 Bacteria 2190
135 Ga0307410_10154718 3300031852 Bacteria 1711
136 Ga0307410_10612757 3300031852 Bacteria 909
137 Ga0307406_10157229 3300031901 Bacteria 1629
138 Ga0307406_10339153 3300031901 Bacteria 1170
139 Ga0307407_10019388 3300031903 Bacteria 3463
140 Ga0307407_10021026 3300031903 Bacteria 3356
141 Ga0307407_10023610 3300031903 Bacteria 3211
142 Ga0307407_10540017 3300031903 Bacteria 860
143 Ga0307407_10837029 3300031903 Bacteria 702
144 Ga0307412_10040691 3300031911 Bacteria 3008
145 Ga0307412_10122389 3300031911 Bacteria 1875
146 Ga0307412_10521149 3300031911 Bacteria 993
147 Ga0307412_10587467 3300031911 Bacteria 941
148 Ga0307412_10831147 3300031911 Bacteria 804
149 Ga0307409_100023098 3300031995 Bacteria 4301
150 Ga0307409_100035130 3300031995 Bacteria 3669
151 Ga0307409_100128247 3300031995 Bacteria 2162
152 Ga0307409_100520864 3300031995 Bacteria 1161
153 Ga0307409_100795616 3300031995 Bacteria 953
154 Ga0307409_101447062 3300031995 Bacteria 714
155 Ga0307416_100011312 3300032002 Bacteria 5940
156 Ga0307416_100033103 3300032002 Bacteria 3914
157 Ga0307416_100063112 3300032002 Bacteria 3032
158 Ga0307416_100082460 3300032002 Bacteria 2724
159 Ga0307416_100242338 3300032002 Bacteria 1748
160 Ga0307416_100344615 3300032002 Bacteria 1505
161 Ga0307416_101698672 3300032002 Bacteria 736
162 Ga0307414_10064729 3300032004 Bacteria 2605
163 Ga0307414_10079399 3300032004 Bacteria 2395
164 Ga0307414_11019320 3300032004 Bacteria 762
165 Ga0307411_10023261 3300032005 Bacteria 3667
166 Ga0307411_10036458 3300032005 Bacteria 3081
167 Ga0307411_10240976 3300032005 Bacteria 1416
168 Ga0307415_100015945 3300032126 Bacteria 4463
169 Ga0307415_100016990 3300032126 Bacteria 4353
170 Ga0307415_100086158 3300032126 Bacteria 2259
171 Ga0307415_100107102 3300032126 Bacteria 2065
172 Ga0307415_100229400 3300032126 Bacteria 1494
173 Ga0307415_100662595 3300032126 Bacteria 937
174 Ga0307415_100800187 3300032126 Bacteria 860
175 Ga0373923_0122491 3300035111 Bacteria 1163
176 Ga0373936_0566771 3300035113 Bacteria 532
177 Ga0373954_0223019 3300035118 Bacteria 927
178 Ga0373943_0449197 3300035170 Bacteria 749
179 Ga0373924_0150983 3300035410 Bacteria 1016
180 Ga0373931_0240792 3300035691 Bacteria 1097
181 Ga0373927_0016358 3300035695 Bacteria 4893
182 Ga0373933_0133929 3300035724 Bacteria 1560
183 Ga0373937_0343025 3300036401 Bacteria 1414
184 Ga0373925_0240680 3300037068 Bacteria 1449
185 Ga0395899_0057233 3300037312 Bacteria 2879
186 Ga0395899_0210883 3300037312 Bacteria 1350
187 Ga0395899_0240214 3300037312 Bacteria 1247
188 Ga0395900_0047115 3300037418 Bacteria 4438
189 Ga0395900_0072278 3300037418 Bacteria 3547
190 Ga0395900_0260541 3300037418 Bacteria 1732
191 Ga0395900_0313323 3300037418 Bacteria 1552
192 Ga0395900_1326559 3300037418 Bacteria 633
193 Ga0395898_0212873 3300037466 Bacteria 1843
194 Ga0395898_0476214 3300037466 Bacteria 1188
195 Ga0395898_1105043 3300037466 Bacteria 726
196 Ga0395905_0008244 3300037471 Bacteria 10290
197 Ga0395905_0035645 3300037471 Bacteria 4671
198 Ga0395905_0337781 3300037471 Bacteria 1397
199 Ga0436364_0118296 3300037853 Bacteria 2791
200 Ga0395901_0007022 3300038443 Bacteria 11379
201 Ga0395901_0039877 3300038443 Bacteria 4861
202 Ga0395901_0381291 3300038443 Bacteria 1451
203 Ga0436365_1190866 3300039437 Bacteria 7724
204 Ga0439448_0011771 3300042005 Bacteria 2609
205 Ga0439448_0013497 3300042005 Bacteria 2455
206 Ga0439450_000156 3300042008 Bacteria 7588
207 Ga0439451_006873 3300042009 Bacteria 2330
208 Ga0439454_005812 3300042011 Bacteria 1490
209 Ga0439455_0002531 3300042012 Bacteria 3340
210 Ga0439456_026558 3300042013 Bacteria 1232
211 Ga0450913_004613 3300042117 Bacteria 954
212 Ga0450895_010743 3300042132 Bacteria 784
213 Ga0450905_018866 3300042142 Bacteria 1007
214 Ga0450889_006273 3300042144 Bacteria 1192
215 Ga0439458_0007531 3300042157 Bacteria 2424
216 Ga0450908_032102 3300042184 Bacteria 911
217 Ga0439444_0000266 3300042437 Bacteria 5262
218 Ga0439464_0002579 3300042439 Bacteria 4475
219 Ga0439460_0000164 3300042461 Bacteria 12295
220 Ga0451577_0000192 3300042876 Bacteria 128752
221 Ga0451577_0055091 3300042876 Bacteria 3549
222 Ga0451577_0241700 3300042876 Bacteria 1634
223 Ga0439440_0000964 3300042993 Bacteria 5063
224 Ga0439440_0008435 3300042993 Bacteria 2115
225 Ga0453683_0279639 3300044673 Unclassified 1066
226 Ga0453684_0242815 3300044712 Bacteria 2072
227 Ga0466957_0178008 3300044842 Bacteria 1388
228 Ga0451576_1997441 3300045051 Bacteria 597
229 Ga0466967_1729369 3300045976 Bacteria 623
230 Ga0495592_0177713 3300046454 Bacteria 1452
231 Ga0495641_0124525 3300046461 Bacteria 1150
232 Ga0495651_0167763 3300046462 Bacteria 1566
233 Ga0495651_0335690 3300046462 Unclassified 1003
234 Ga0495651_0518093 3300046462 Bacteria 761
235 Ga0495653_0096746 3300046463 Bacteria 2146
236 Ga0495582_0224277 3300046473 Bacteria 1076
237 Ga0495582_0456626 3300046473 Bacteria 738
238 Ga0495664_0277798 3300046477 Bacteria 1012
239 Ga0495664_0485909 3300046477 Bacteria 738
240 Ga0495594_0018619 3300046499 Bacteria 3680
241 Ga0495596_0107421 3300046500 Bacteria 1084
242 Ga0495608_0006793 3300046511 Bacteria 8110
243 Ga0495608_0126624 3300046511 Bacteria 1636
244 Ga0495628_0099252 3300046516 Bacteria 2249
245 Ga0495628_0375796 3300046516 Bacteria 1041
246 Ga0495630_0052455 3300046517 Bacteria 3054
247 Ga0495642_0247755 3300046528 Bacteria 779
248 Ga0495652_0220518 3300046529 Bacteria 1425
249 Ga0495665_0116061 3300046531 Bacteria 1403
250 Ga0495640_0224404 3300046533 Bacteria 1184
251 Ga0495587_0007260 3300046536 Bacteria 7186
252 Ga0495622_0391038 3300046557 Bacteria 600
253 Ga0495667_0006388 3300046559 Bacteria 7987
254 Ga0495667_0525468 3300046559 Unclassified 740
255 Ga0495634_0089923 3300046642 Bacteria 1995
256 Ga0495635_0105893 3300046663 Bacteria 1921
257 Ga0495657_0030125 3300046675 Bacteria 3802
258 Ga0495599_0121375 3300046678 Bacteria 1624
259 Ga0495623_0025650 3300046679 Bacteria 3797
260 Ga0495658_0087815 3300046683 Bacteria 1837
261 Ga0495613_0060384 3300046689 Bacteria 2777
262 Ga0495613_0388294 3300046689 Bacteria 954
263 Ga0495600_0007008 3300046809 Bacteria 6883
264 Ga0495581_0048360 3300047315 Bacteria 2457
265 Ga0495581_0078472 3300047315 Bacteria 1911
266 Ga0495604_0005067 3300047317 Bacteria 10429
267 Ga0495604_0439421 3300047317 Unclassified 854
268 Ga0495674_0055994 3300047319 Bacteria 3456
269 Ga0495676_0560831 3300047321 Bacteria 746
270 Ga0495680_0049118 3300047322 Bacteria 3307
271 Ga0495675_0003762 3300047444 Bacteria 9180
272 Ga0495675_0249433 3300047444 Bacteria 1067
273 Ga0495684_0177343 3300047471 Bacteria 1581
274 Ga0495602_0026404 3300048088 Bacteria 5601
275 Ga0496104_0014409 3300048907 Bacteria 7145
276 Ga0496104_0256801 3300048907 Bacteria 1660
277 Ga0496107_0279423 3300048910 Bacteria 1243
278 Ga0496108_0149354 3300048911 Bacteria 2016
279 Ga0496109_0578854 3300048912 Bacteria 1058
280 Ga0496110_0430455 3300048913 Bacteria 1203
281 Ga0496110_0535809 3300048913 Bacteria 1065
282 Ga0496112_0063634 3300048915 Bacteria 3639
283 Ga0496112_0464204 3300048915 Bacteria 1203
284 Ga0496113_0025212 3300048916 Bacteria 4236
285 Ga0496114_0247053 3300048917 Bacteria 1570
286 Ga0496114_0585125 3300048917 Bacteria 985
287 Ga0496115_0148612 3300048918 Bacteria 1934
288 Ga0496125_0117559 3300048928 Bacteria 1906
289 Ga0501040_0233531 3300049576 Bacteria 1310
290 Ga0501042_0117812 3300049578 Bacteria 1912
291 Ga0501046_0328544 3300049580 Bacteria 1113
292 Ga0501048_0266727 3300049582 Bacteria 1217
293 Ga0501075_0034765 3300049591 Bacteria 3754
294 Ga0501076_0585944 3300049592 Bacteria 920
295 Ga0501258_017160 3300049687 Bacteria 824
296 Ga0501081_0022056 3300049743 Bacteria 4258
297 nmdc:mga05p37_60960_c1 3300050507 Bacteria 4645
298 nmdc:mga06r32_271195_c1 3300050510 Bacteria 1684
299 nmdc:mga06r32_344524_c1 3300050510 Bacteria 1475
300 nmdc:mga06r32_54051_c1 3300050510 Bacteria 3850
301 nmdc:mga0rr50_66664_c1 3300050513 Bacteria 2732
302 Ga0495612_0054138 3300053078 Bacteria 1653
303 Ga0495595_0012462 3300053084 Bacteria 3575
304 Ga0495619_0153493 3300053085 Bacteria 1589
305 Ga0500559_0291630 3300053136 Bacteria 767
306 Ga0501084_0066693 3300054114 Bacteria 3012
307 Ga0590075_034796 3300059424 Bacteria 1282
308 Ga0590075_077196 3300059424 Unclassified 862
309 Ga0501082_0016680 3300060353 Bacteria 6325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0449197 Ga0373943_0449197_16_489 156
2 3300046533 Ga0495640_0224404 Ga0495640_0224404_699_1172 156
3 3300035113 Ga0373936_0566771 Ga0373936_0566771_11_487 157
4 3300059424 Ga0590075_034796 Ga0590075_034796_483_974 159
5 3300037418 Ga0395900_1326559 Ga0395900_1326559_68_559 162
6 3300045051 Ga0451576_1997441 Ga0451576_1997441_13_543 167
7 3300046500 Ga0495596_0107421 Ga0495596_0107421_438_950 169
8 3300048918 Ga0496115_0148612 Ga0496115_0148612_22_558 177
9 3300025915 Ga0207693_10360323 Ga0207693_103603232 181
10 3300005437 Ga0070710_10808314 Ga0070710_108083141 184
11 3300006028 Ga0070717_10057029 Ga0070717_100570293 184
12 3300003323 rootH1_10000064 rootH1_100000647 186
13 3300031995 Ga0307409_101447062 Ga0307409_1014470621 186
14 3300032002 Ga0307416_100242338 Ga0307416_1002423381 186
15 3300039437 Ga0436365_1190866 Ga0436365_1190866_2872_3435 186
16 3300005548 Ga0070665_100932638 Ga0070665_1009326381 187
17 3300009147 Ga0114129_10117498 Ga0114129_101174981 187
18 3300009148 Ga0105243_10864334 Ga0105243_108643341 187
19 3300025935 Ga0207709_10758987 Ga0207709_107589872 187
20 3300005340 Ga0070689_100199345 Ga0070689_1001993451 188
21 3300042876 Ga0451577_0241700 Ga0451577_0241700_707_1276 188
22 3300044673 Ga0453683_0279639 Ga0453683_0279639_460_1044 189
23 3300046557 Ga0495622_0391038 Ga0495622_0391038_21_590 189
24 3300048917 Ga0496114_0247053 Ga0496114_0247053_949_1527 189
25 3300048917 Ga0496114_0585125 Ga0496114_0585125_400_969 189
26 3300053136 Ga0500559_0291630 Ga0500559_0291630_181_750 189
27 3300006846 Ga0075430_100053173 Ga0075430_1000531732 190
28 3300006847 Ga0075431_100001828 Ga0075431_10000182815 190
29 3300027907 Ga0207428_10104733 Ga0207428_101047332 190
30 3300026075 Ga0207708_10095597 Ga0207708_100955972 191
31 3300048915 Ga0496112_0063634 Ga0496112_0063634_1006_1740 191
32 3300005435 Ga0070714_100413633 Ga0070714_1004136332 192
33 3300005436 Ga0070713_100543372 Ga0070713_1005433722 192
34 3300006028 Ga0070717_10319290 Ga0070717_103192902 192
35 3300025929 Ga0207664_10649526 Ga0207664_106495262 192
36 3300046461 Ga0495641_0124525 Ga0495641_0124525_539_1120 192
37 3300046462 Ga0495651_0335690 Ga0495651_0335690_390_971 192
38 3300046462 Ga0495651_0518093 Ga0495651_0518093_114_692 192
39 3300046511 Ga0495608_0126624 Ga0495608_0126624_943_1524 192
40 3300046531 Ga0495665_0116061 Ga0495665_0116061_346_924 192
41 3300046559 Ga0495667_0525468 Ga0495667_0525468_148_729 192
42 3300046689 Ga0495613_0388294 Ga0495613_0388294_56_637 192
43 3300047315 Ga0495581_0048360 Ga0495581_0048360_1539_2117 192
44 3300047317 Ga0495604_0439421 Ga0495604_0439421_19_600 192
45 3300048907 Ga0496104_0014409 Ga0496104_0014409_2182_2763 192
46 3300048913 Ga0496110_0430455 Ga0496110_0430455_380_961 192
47 3300005343 Ga0070687_100001118 Ga0070687_1000011187 193
48 3300005343 Ga0070687_100095305 Ga0070687_1000953052 193
49 3300005436 Ga0070713_100136063 Ga0070713_1001360632 193
50 3300005437 Ga0070710_10111515 Ga0070710_101115151 193
51 3300005544 Ga0070686_100000032 Ga0070686_10000003264 193
52 3300006028 Ga0070717_10393820 Ga0070717_103938202 193
53 3300006175 Ga0070712_100036999 Ga0070712_1000369994 193
54 3300025906 Ga0207699_10045175 Ga0207699_100451752 193
55 3300025915 Ga0207693_10000956 Ga0207693_1000095615 193
56 3300025918 Ga0207662_10003677 Ga0207662_100036774 193
57 3300035111 Ga0373923_0122491 Ga0373923_0122491_369_953 193
58 3300035118 Ga0373954_0223019 Ga0373954_0223019_260_844 193
59 3300035410 Ga0373924_0150983 Ga0373924_0150983_369_953 193
60 3300035724 Ga0373933_0133929 Ga0373933_0133929_812_1396 193
61 3300036401 Ga0373937_0343025 Ga0373937_0343025_773_1357 193
62 3300037312 Ga0395899_0240214 Ga0395899_0240214_490_1071 193
63 3300037418 Ga0395900_0072278 Ga0395900_0072278_1918_2499 193
64 3300037466 Ga0395898_0476214 Ga0395898_0476214_178_759 193
65 3300037471 Ga0395905_0008244 Ga0395905_0008244_110_691 193
66 3300037853 Ga0436364_0118296 Ga0436364_0118296_994_1575 193
67 3300038443 Ga0395901_0007022 Ga0395901_0007022_5437_6018 193
68 3300042132 Ga0450895_010743 Ga0450895_010743_21_602 193
69 3300042184 Ga0450908_032102 Ga0450908_032102_114_695 193
70 3300046454 Ga0495592_0177713 Ga0495592_0177713_612_1196 193
71 3300046462 Ga0495651_0167763 Ga0495651_0167763_370_954 193
72 3300046463 Ga0495653_0096746 Ga0495653_0096746_369_953 193
73 3300046473 Ga0495582_0456626 Ga0495582_0456626_68_652 193
74 3300046477 Ga0495664_0277798 Ga0495664_0277798_73_657 193
75 3300046511 Ga0495608_0006793 Ga0495608_0006793_3133_3717 193
76 3300046516 Ga0495628_0375796 Ga0495628_0375796_225_809 193
77 3300046517 Ga0495630_0052455 Ga0495630_0052455_772_1356 193
78 3300046528 Ga0495642_0247755 Ga0495642_0247755_165_746 193
79 3300046529 Ga0495652_0220518 Ga0495652_0220518_612_1196 193
80 3300046559 Ga0495667_0006388 Ga0495667_0006388_810_1394 193
81 3300046642 Ga0495634_0089923 Ga0495634_0089923_539_1123 193
82 3300046663 Ga0495635_0105893 Ga0495635_0105893_1277_1861 193
83 3300046675 Ga0495657_0030125 Ga0495657_0030125_883_1467 193
84 3300046678 Ga0495599_0121375 Ga0495599_0121375_961_1545 193
85 3300046679 Ga0495623_0025650 Ga0495623_0025650_1906_2490 193
86 3300046689 Ga0495613_0060384 Ga0495613_0060384_912_1496 193
87 3300046809 Ga0495600_0007008 Ga0495600_0007008_5120_5704 193
88 3300047315 Ga0495581_0078472 Ga0495581_0078472_1121_1705 193
89 3300047317 Ga0495604_0005067 Ga0495604_0005067_4820_5404 193
90 3300047319 Ga0495674_0055994 Ga0495674_0055994_2586_3170 193
91 3300047321 Ga0495676_0560831 Ga0495676_0560831_80_664 193
92 3300047322 Ga0495680_0049118 Ga0495680_0049118_80_664 193
93 3300047444 Ga0495675_0249433 Ga0495675_0249433_22_606 193
94 3300047471 Ga0495684_0177343 Ga0495684_0177343_598_1182 193
95 3300048088 Ga0495602_0026404 Ga0495602_0026404_3711_4295 193
96 3300048907 Ga0496104_0256801 Ga0496104_0256801_14_598 193
97 3300048910 Ga0496107_0279423 Ga0496107_0279423_293_877 193
98 3300048911 Ga0496108_0149354 Ga0496108_0149354_740_1324 193
99 3300048912 Ga0496109_0578854 Ga0496109_0578854_218_802 193
100 3300048913 Ga0496110_0535809 Ga0496110_0535809_157_741 193
101 3300048915 Ga0496112_0464204 Ga0496112_0464204_86_670 193
102 3300048916 Ga0496113_0025212 Ga0496113_0025212_1939_2523 193
103 3300053078 Ga0495612_0054138 Ga0495612_0054138_232_816 193
104 3300053084 Ga0495595_0012462 Ga0495595_0012462_2785_3369 193
105 3300053085 Ga0495619_0153493 Ga0495619_0153493_777_1361 193
106 3300005336 Ga0070680_100528810 Ga0070680_1005288101 194
107 3300005344 Ga0070661_101041469 Ga0070661_1010414691 194
108 3300005937 Ga0081455_10004516 Ga0081455_100045166 194
109 3300005937 Ga0081455_10093097 Ga0081455_100930972 194
110 3300005937 Ga0081455_10303029 Ga0081455_103030291 194
111 3300006058 Ga0075432_10011674 Ga0075432_100116742 194
112 3300006852 Ga0075433_10148670 Ga0075433_101486702 194
113 3300006871 Ga0075434_100634768 Ga0075434_1006347681 194
114 3300006881 Ga0068865_100770195 Ga0068865_1007701951 194
115 3300007076 Ga0075435_100447615 Ga0075435_1004476152 194
116 3300009101 Ga0105247_10829489 Ga0105247_108294892 194
117 3300013308 Ga0157375_11054910 Ga0157375_110549101 194
118 3300014326 Ga0157380_10455749 Ga0157380_104557492 194
119 3300025917 Ga0207660_10672239 Ga0207660_106722391 194
120 3300026089 Ga0207648_10159006 Ga0207648_101590063 194
121 3300026089 Ga0207648_10552839 Ga0207648_105528391 194
122 3300031548 Ga0307408_100091506 Ga0307408_1000915062 194
123 3300031548 Ga0307408_100135958 Ga0307408_1001359582 194
124 3300031731 Ga0307405_10003336 Ga0307405_100033361 194
125 3300031731 Ga0307405_10276072 Ga0307405_102760722 194
126 3300031824 Ga0307413_10011775 Ga0307413_100117754 194
127 3300031824 Ga0307413_10119835 Ga0307413_101198353 194
128 3300031852 Ga0307410_10008537 Ga0307410_100085376 194
129 3300031852 Ga0307410_10088764 Ga0307410_100887643 194
130 3300031852 Ga0307410_10154718 Ga0307410_101547183 194
131 3300031852 Ga0307410_10612757 Ga0307410_106127571 194
132 3300031901 Ga0307406_10157229 Ga0307406_101572292 194
133 3300031903 Ga0307407_10019388 Ga0307407_100193881 194
134 3300031903 Ga0307407_10021026 Ga0307407_100210262 194
135 3300031903 Ga0307407_10837029 Ga0307407_108370291 194
136 3300031911 Ga0307412_10040691 Ga0307412_100406912 194
137 3300031911 Ga0307412_10122389 Ga0307412_101223893 194
138 3300031911 Ga0307412_10587467 Ga0307412_105874671 194
139 3300031995 Ga0307409_100023098 Ga0307409_1000230981 194
140 3300031995 Ga0307409_100035130 Ga0307409_1000351302 194
141 3300031995 Ga0307409_100128247 Ga0307409_1001282471 194
142 3300031995 Ga0307409_100520864 Ga0307409_1005208642 194
143 3300032002 Ga0307416_100033103 Ga0307416_1000331033 194
144 3300032002 Ga0307416_100063112 Ga0307416_1000631121 194
145 3300032002 Ga0307416_100082460 Ga0307416_1000824601 194
146 3300032002 Ga0307416_101698672 Ga0307416_1016986721 194
147 3300032004 Ga0307414_10064729 Ga0307414_100647294 194
148 3300032004 Ga0307414_10079399 Ga0307414_100793994 194
149 3300032004 Ga0307414_11019320 Ga0307414_110193201 194
150 3300032005 Ga0307411_10023261 Ga0307411_100232611 194
151 3300032005 Ga0307411_10036458 Ga0307411_100364583 194
152 3300032126 Ga0307415_100016990 Ga0307415_1000169901 194
153 3300032126 Ga0307415_100086158 Ga0307415_1000861581 194
154 3300035691 Ga0373931_0240792 Ga0373931_0240792_450_1040 194
155 3300035695 Ga0373927_0016358 Ga0373927_0016358_1901_2485 194
156 3300037068 Ga0373925_0240680 Ga0373925_0240680_364_948 194
157 3300042005 Ga0439448_0013497 Ga0439448_0013497_425_1015 194
158 3300042009 Ga0439451_006873 Ga0439451_006873_770_1357 194
159 3300042157 Ga0439458_0007531 Ga0439458_0007531_1065_1655 194
160 3300045976 Ga0466967_1729369 Ga0466967_1729369_25_609 194
161 3300046473 Ga0495582_0224277 Ga0495582_0224277_416_1000 194
162 3300046499 Ga0495594_0018619 Ga0495594_0018619_2678_3262 194
163 3300049687 Ga0501258_017160 Ga0501258_017160_115_786 194
164 3300050513 nmdc:mga0rr50_66664_c1 nmdc:mga0rr50_66664_c1_19_609 194
165 3300005329 Ga0070683_100002751 Ga0070683_1000027517 195
166 3300005336 Ga0070680_101197368 Ga0070680_1011973681 195
167 3300005345 Ga0070692_10110079 Ga0070692_101100791 195
168 3300005365 Ga0070688_100132014 Ga0070688_1001320143 195
169 3300005438 Ga0070701_10242182 Ga0070701_102421821 195
170 3300005458 Ga0070681_10021645 Ga0070681_100216451 195
171 3300005466 Ga0070685_10169181 Ga0070685_101691812 195
172 3300005535 Ga0070684_100001142 Ga0070684_1000011426 195
173 3300005548 Ga0070665_100375636 Ga0070665_1003756363 195
174 3300005564 Ga0070664_100149019 Ga0070664_1001490192 195
175 3300005577 Ga0068857_100003333 Ga0068857_1000033336 195
176 3300009094 Ga0111539_11018754 Ga0111539_110187542 195
177 3300011119 Ga0105246_10640815 Ga0105246_106408152 195
178 3300025944 Ga0207661_10008179 Ga0207661_100081796 195
179 3300025945 Ga0207679_10222902 Ga0207679_102229022 195
180 3300026116 Ga0207674_10006320 Ga0207674_100063207 195
181 3300028379 Ga0268266_10058884 Ga0268266_100588842 195
182 3300037312 Ga0395899_0057233 Ga0395899_0057233_812_1405 195
183 3300037418 Ga0395900_0047115 Ga0395900_0047115_109_702 195
184 3300037418 Ga0395900_0313323 Ga0395900_0313323_52_645 195
185 3300037466 Ga0395898_0212873 Ga0395898_0212873_1057_1650 195
186 3300037471 Ga0395905_0035645 Ga0395905_0035645_1053_1646 195
187 3300038443 Ga0395901_0039877 Ga0395901_0039877_3154_3747 195
188 3300046477 Ga0495664_0485909 Ga0495664_0485909_126_713 195
189 3300046516 Ga0495628_0099252 Ga0495628_0099252_211_798 195
190 3300046536 Ga0495587_0007260 Ga0495587_0007260_245_832 195
191 3300047444 Ga0495675_0003762 Ga0495675_0003762_7780_8367 195
192 3300049576 Ga0501040_0233531 Ga0501040_0233531_661_1248 195
193 3300049582 Ga0501048_0266727 Ga0501048_0266727_546_1133 195
194 3300005445 Ga0070708_100454206 Ga0070708_1004542061 196
195 3300005445 Ga0070708_101327444 Ga0070708_1013274441 196
196 3300005467 Ga0070706_100007547 Ga0070706_1000075472 196
197 3300005468 Ga0070707_100458595 Ga0070707_1004585952 196
198 3300005468 Ga0070707_100509942 Ga0070707_1005099422 196
199 3300005468 Ga0070707_101531726 Ga0070707_1015317261 196
200 3300005471 Ga0070698_100197655 Ga0070698_1001976552 196
201 3300005518 Ga0070699_100132009 Ga0070699_1001320093 196
202 3300005518 Ga0070699_101260842 Ga0070699_1012608421 196
203 3300005981 Ga0081538_10000158 Ga0081538_1000015824 196
204 3300005981 Ga0081538_10008168 Ga0081538_100081684 196
205 3300006844 Ga0075428_100219843 Ga0075428_1002198432 196
206 3300006847 Ga0075431_100309520 Ga0075431_1003095201 196
207 3300009147 Ga0114129_10200202 Ga0114129_102002022 196
208 3300025910 Ga0207684_10002585 Ga0207684_1000258515 196
209 3300025922 Ga0207646_10263330 Ga0207646_102633301 196
210 3300025922 Ga0207646_10387373 Ga0207646_103873732 196
211 3300025922 Ga0207646_11293037 Ga0207646_112930371 196
212 3300031852 Ga0307410_10028000 Ga0307410_100280001 196
213 3300031911 Ga0307412_10831147 Ga0307412_108311471 196
214 3300032126 Ga0307415_100229400 Ga0307415_1002294002 196
215 3300032126 Ga0307415_100662595 Ga0307415_1006625951 196
216 3300032126 Ga0307415_100800187 Ga0307415_1008001871 196
217 3300037471 Ga0395905_0337781 Ga0395905_0337781_118_711 196
218 3300042993 Ga0439440_0000964 Ga0439440_0000964_2996_3589 196
219 3300046683 Ga0495658_0087815 Ga0495658_0087815_617_1210 196
220 3300050507 nmdc:mga05p37_60960_c1 nmdc:mga05p37_60960_c1_528_1121 196
221 3300050510 nmdc:mga06r32_271195_c1 nmdc:mga06r32_271195_c1_211_804 196
222 3300005354 Ga0070675_100130494 Ga0070675_1001304941 197
223 3300025925 Ga0207650_10558767 Ga0207650_105587671 197
224 3300005467 Ga0070706_100000024 Ga0070706_100000024114 198
225 3300005468 Ga0070707_100085054 Ga0070707_1000850544 198
226 3300005536 Ga0070697_100011543 Ga0070697_1000115435 198
227 3300025910 Ga0207684_10000004 Ga0207684_10000004213 198
228 3300025922 Ga0207646_10083557 Ga0207646_100835574 198
229 3300026121 Ga0207683_11170057 Ga0207683_111700571 198
230 3300031548 Ga0307408_100067668 Ga0307408_1000676683 198
231 3300037312 Ga0395899_0210883 Ga0395899_0210883_14_613 198
232 3300037418 Ga0395900_0260541 Ga0395900_0260541_231_830 198
233 3300037466 Ga0395898_1105043 Ga0395898_1105043_18_617 198
234 3300038443 Ga0395901_0381291 Ga0395901_0381291_525_1124 198
235 3300044842 Ga0466957_0178008 Ga0466957_0178008_293_889 198
236 3300005366 Ga0070659_100507996 Ga0070659_1005079962 199
237 3300048928 Ga0496125_0117559 Ga0496125_0117559_131_739 200
238 iso_pu_bacteria 2990088156 2990093839 200
239 3300005985 Ga0081539_10136023 Ga0081539_101360231 201
240 3300025918 Ga0207662_10623986 Ga0207662_106239862 201
241 3300003373 JGI25407J50210_10000548 JGI25407J50210_100005484 202
242 3300005548 Ga0070665_100910732 Ga0070665_1009107321 202
243 3300005937 Ga0081455_10002321 Ga0081455_1000232111 202
244 3300005981 Ga0081538_10000093 Ga0081538_1000009365 202
245 3300014326 Ga0157380_10006873 Ga0157380_1000687310 202
246 iso_pu_bacteria 2791354901 2791916613 202
247 3300003323 rootH1_10234601 rootH1_102346013 203
248 3300005347 Ga0070668_100130577 Ga0070668_1001305772 203
249 3300005467 Ga0070706_100008033 Ga0070706_1000080339 203
250 3300005563 Ga0068855_100006656 Ga0068855_1000066568 203
251 3300005614 Ga0068856_100059264 Ga0068856_1000592643 203
252 3300006847 Ga0075431_100343400 Ga0075431_1003434002 203
253 3300025910 Ga0207684_10002345 Ga0207684_1000234514 203
254 3300025949 Ga0207667_10038369 Ga0207667_100383696 203
255 3300025972 Ga0207668_10462628 Ga0207668_104626281 203
256 3300030522 Ga0307512_10137598 Ga0307512_101375982 203
257 3300031548 Ga0307408_101057866 Ga0307408_1010578662 203
258 3300031616 Ga0307508_10116215 Ga0307508_101162152 203
259 3300031901 Ga0307406_10339153 Ga0307406_103391531 203
260 3300031903 Ga0307407_10023610 Ga0307407_100236103 203
261 3300031903 Ga0307407_10540017 Ga0307407_105400172 203
262 3300031911 Ga0307412_10521149 Ga0307412_105211492 203
263 3300031995 Ga0307409_100795616 Ga0307409_1007956161 203
264 3300032002 Ga0307416_100011312 Ga0307416_1000113126 203
265 3300032002 Ga0307416_100344615 Ga0307416_1003446152 203
266 3300032005 Ga0307411_10240976 Ga0307411_102409762 203
267 3300032126 Ga0307415_100015945 Ga0307415_1000159457 203
268 3300032126 Ga0307415_100107102 Ga0307415_1001071023 203
269 3300042876 Ga0451577_0000192 Ga0451577_0000192_96656_97273 203
270 3300042876 Ga0451577_0055091 Ga0451577_0055091_1475_2113 203
271 3300044712 Ga0453684_0242815 Ga0453684_0242815_503_1141 203
272 3300050510 nmdc:mga06r32_344524_c1 nmdc:mga06r32_344524_c1_571_1194 203
273 3300003659 JGI25404J52841_10006263 JGI25404J52841_100062633 204
274 3300005330 Ga0070690_100260458 Ga0070690_1002604582 204
275 3300005549 Ga0070704_100420371 Ga0070704_1004203712 204
276 3300005983 Ga0081540_1000169 Ga0081540_10001695 204
277 3300006844 Ga0075428_100115356 Ga0075428_1001153563 204
278 3300006847 Ga0075431_100062791 Ga0075431_1000627912 204
279 3300009092 Ga0105250_10054347 Ga0105250_100543471 204
280 3300009177 Ga0105248_10009898 Ga0105248_100098985 204
281 3300010375 Ga0105239_11259969 Ga0105239_112599691 204
282 3300021377 Ga0213874_10125797 Ga0213874_101257971 204
283 3300025941 Ga0207711_10014794 Ga0207711_100147946 204
284 3300026089 Ga0207648_10884930 Ga0207648_108849302 204
285 3300026142 Ga0207698_10294169 Ga0207698_102941692 204
286 3300031456 Ga0307513_10010442 Ga0307513_100104429 204
287 3300042005 Ga0439448_0011771 Ga0439448_0011771_1769_2413 204
288 3300042008 Ga0439450_000156 Ga0439450_000156_6583_7227 204
289 3300042011 Ga0439454_005812 Ga0439454_005812_344_988 204
290 3300042012 Ga0439455_0002531 Ga0439455_0002531_1061_1705 204
291 3300042013 Ga0439456_026558 Ga0439456_026558_80_724 204
292 3300042117 Ga0450913_004613 Ga0450913_004613_160_804 204
293 3300042142 Ga0450905_018866 Ga0450905_018866_34_678 204
294 3300042144 Ga0450889_006273 Ga0450889_006273_389_1033 204
295 3300042437 Ga0439444_0000266 Ga0439444_0000266_552_1196 204
296 3300042439 Ga0439464_0002579 Ga0439464_0002579_3257_3901 204
297 3300042461 Ga0439460_0000164 Ga0439460_0000164_3584_4228 204
298 3300042993 Ga0439440_0008435 Ga0439440_0008435_19_663 204
299 3300049578 Ga0501042_0117812 Ga0501042_0117812_607_1287 204
300 3300049580 Ga0501046_0328544 Ga0501046_0328544_55_735 204
301 3300049591 Ga0501075_0034765 Ga0501075_0034765_854_1534 204
302 3300049592 Ga0501076_0585944 Ga0501076_0585944_76_756 204
303 3300049743 Ga0501081_0022056 Ga0501081_0022056_2368_3048 204
304 3300050510 nmdc:mga06r32_54051_c1 nmdc:mga06r32_54051_c1_617_1294 204
305 3300054114 Ga0501084_0066693 Ga0501084_0066693_853_1533 204
306 3300059424 Ga0590075_077196 Ga0590075_077196_177_842 204
307 3300060353 Ga0501082_0016680 Ga0501082_0016680_3808_4488 204
308 3300003203 JGI25406J46586_10001083 JGI25406J46586_1000108313 206
309 3300005985 Ga0081539_10000132 Ga0081539_1000013213 206
310 3300025925 Ga0207650_10628655 Ga0207650_106286552 206
311 3300031456 Ga0307513_10399432 Ga0307513_103994322 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

5

191

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8395 2 194
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8142 1 196
2gd9-assembly1.cif.gz_A crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8119 2 194
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8099 1 196
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7998 1 196
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7906 1 196 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.787 3 193 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7863 1 196 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7776 3 193 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7772 2 200 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A537IA96-F1-model_v4 Dihydrofolate reductase 0.9764 2 206 GO:0008703
GO:0009231
AF-A0A4Q9ZXW9-F1-model_v4 deleted 0.9752 1 206
AF-D6U221-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.9749 1 206 GO:0008703
GO:0009231
AF-A0A534JI53-F1-model_v4 Dihydrofolate reductase 0.9746 2 203 GO:0008703
GO:0009231
AF-A0A7D6CMC7-F1-model_v4 Dihydrofolate reductase family protein 0.9726 2 206 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
93.96 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map