F401379

General Info

Members Datasets Scaffolds Average Seq Length
311 193 622 213

Family's Representative Sequence

Representative Sequence 3300046648|Ga0495611_0051531|Ga0495611_0051531_661_1359
Length 232
Sequence MTPTLYSAWRATAPYRVRIGLALKGLAYDYVPIDLIKGEQREAAYRAVNPQGLTPALDLGDGQVLTQSVAILEWLEETQPEPAILPKGALDRQRVRTMALIIACDIHPLNNTRIGRKLHQIGIDQAGILEWTQGWIRDGFDTLEPMIARHGKGFAFGETPTIADCCLIPQVYSANRYEVDLTPYPAIRAVADRAAEHPAFQAAHPNKQPDAKPLKDAQGCRRGRRVLERDHA

Samples

Sample ID Description Type Environment
1 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
173 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
174 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
176 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
177 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
181 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
182 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
183 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
184 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
185 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
186 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
187 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
188 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
189 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
190 2849560528 Caulobacter zeae 410 Isolate Unclassified
191 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
192 2851153111 Caulobacter radicis 736 Isolate Unclassified
193 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 0
Isolates 3.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 0
Rhizoplane 4.18
Rhizosphere 76.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495611_0051531 3300046648 Bacteria 1855
2 Ga0055530_10000640 3300003791 Bacteria 30110
3 Ga0055531_10003059 3300003794 Bacteria 10834
4 Ga0055531_10016872 3300003794 Bacteria 3120
5 Ga0055543_1028879 3300004625 Bacteria 975
6 Ga0065165_1001741 3300005262 Bacteria 21716
7 Ga0065165_1011109 3300005262 Bacteria 3801
8 Ga0065165_1013773 3300005262 Bacteria 3186
9 Ga0065707_10128060 3300005295 Bacteria 1972
10 Ga0070658_10078048 3300005327 Bacteria 2717
11 Ga0070658_10110657 3300005327 Bacteria 2275
12 Ga0070658_10139856 3300005327 Bacteria 2022
13 Ga0070658_10338530 3300005327 Bacteria 1287
14 Ga0070676_10023707 3300005328 Bacteria 3450
15 Ga0070670_100223700 3300005331 Bacteria 1638
16 Ga0070666_10179652 3300005335 Bacteria 1484
17 Ga0070666_10212492 3300005335 Bacteria 1363
18 Ga0070680_100218232 3300005336 Bacteria 1609
19 Ga0070680_100266195 3300005336 Bacteria 1451
20 Ga0068868_100167763 3300005338 Bacteria 1816
21 Ga0070660_100044754 3300005339 Bacteria 3386
22 Ga0070691_10002545 3300005341 Bacteria 8125
23 Ga0070661_100255755 3300005344 Bacteria 1353
24 Ga0070668_100000129 3300005347 Bacteria 47127
25 Ga0070668_100000607 3300005347 Bacteria 23979
26 Ga0070668_100013972 3300005347 Bacteria 6002
27 Ga0070668_100089851 3300005347 Bacteria 2420
28 Ga0070669_100561873 3300005353 Bacteria 952
29 Ga0070671_100543723 3300005355 Bacteria 1001
30 Ga0070671_100785587 3300005355 Bacteria 828
31 Ga0070659_100003552 3300005366 Bacteria 11105
32 Ga0070659_100010444 3300005366 Bacteria 6829
33 Ga0070667_100000611 3300005367 Bacteria 34865
34 Ga0070667_100044804 3300005367 Bacteria 3717
35 Ga0070678_100085265 3300005456 Bacteria 2406
36 Ga0070681_10011022 3300005458 Bacteria 8935
37 Ga0070681_10101287 3300005458 Bacteria 2826
38 Ga0070679_100004932 3300005530 Bacteria 12312
39 Ga0070679_100085248 3300005530 Bacteria 3146
40 Ga0070679_100584786 3300005530 Bacteria 1060
41 Ga0068853_100024809 3300005539 Bacteria 5029
42 Ga0070665_100000246 3300005548 Bacteria 90170
43 Ga0070665_100000692 3300005548 Bacteria 44982
44 Ga0070665_100323854 3300005548 Bacteria 1545
45 Ga0068855_100017186 3300005563 Bacteria 8705
46 Ga0068855_100033269 3300005563 Bacteria 6154
47 Ga0068855_100181277 3300005563 Bacteria 2381
48 Ga0070664_100085033 3300005564 Bacteria 2732
49 Ga0068857_100720006 3300005577 Bacteria 949
50 Ga0068854_100632460 3300005578 Bacteria 917
51 Ga0068852_100240832 3300005616 Bacteria 1729
52 Ga0068852_100248429 3300005616 Bacteria 1703
53 Ga0068859_100269387 3300005617 Bacteria 1795
54 Ga0068864_100000225 3300005618 Bacteria 51133
55 Ga0068864_100005824 3300005618 Bacteria 10104
56 Ga0068864_100054186 3300005618 Bacteria 3461
57 Ga0068864_100238601 3300005618 Bacteria 1684
58 Ga0068864_100977761 3300005618 Bacteria 839
59 Ga0068861_100340298 3300005719 Bacteria 1313
60 Ga0068861_100491975 3300005719 Bacteria 1107
61 Ga0068863_100000295 3300005841 Bacteria 51532
62 Ga0068863_100262790 3300005841 Bacteria 1669
63 Ga0068863_100434175 3300005841 Bacteria 1287
64 Ga0068858_100006578 3300005842 Bacteria 11304
65 Ga0068858_100346720 3300005842 Bacteria 1422
66 Ga0068860_100000027 3300005843 Bacteria 267207
67 Ga0068860_100000047 3300005843 Bacteria 213287
68 Ga0068860_100198131 3300005843 Bacteria 1945
69 Ga0068862_100000777 3300005844 Bacteria 31708
70 Ga0068862_100024026 3300005844 Bacteria 5110
71 Ga0068862_100066797 3300005844 Bacteria 3099
72 Ga0068862_100136654 3300005844 Bacteria 2173
73 Ga0081540_1004202 3300005983 Bacteria 11069
74 Ga0075362_10114260 3300006177 Bacteria 1273
75 Ga0075366_10053161 3300006195 Bacteria 2406
76 Ga0075370_10113703 3300006353 Bacteria 1573
77 Ga0068871_100598386 3300006358 Bacteria 1003
78 Ga0068865_100005457 3300006881 Bacteria 7716
79 Ga0097620_100269378 3300006931 Bacteria 1795
80 Ga0105240_10002602 3300009093 Bacteria 28871
81 Ga0105240_10028500 3300009093 Bacteria 7293
82 Ga0105240_10080612 3300009093 Bacteria 4002
83 Ga0105240_10094794 3300009093 Bacteria 3640
84 Ga0105240_10108617 3300009093 Bacteria 3361
85 Ga0105240_10130082 3300009093 Bacteria 3020
86 Ga0105240_10401193 3300009093 Bacteria 1544
87 Ga0105242_10052365 3300009176 Bacteria 3330
88 Ga0105248_10000112 3300009177 Bacteria 91321
89 Ga0105248_10080823 3300009177 Bacteria 3654
90 Ga0105248_10148266 3300009177 Bacteria 2647
91 Ga0105237_10649305 3300009545 Bacteria 1062
92 Ga0105238_10020059 3300009551 Bacteria 6805
93 Ga0105238_10061613 3300009551 Bacteria 3754
94 Ga0105238_10075235 3300009551 Bacteria 3369
95 Ga0105238_10366804 3300009551 Bacteria 1430
96 Ga0105249_10000550 3300009553 Bacteria 34737
97 Ga0105239_10420756 3300010375 Bacteria 1513
98 Ga0157373_10367307 3300013100 Bacteria 1028
99 Ga0157374_10318921 3300013296 Bacteria 1540
100 Ga0157372_10061377 3300013307 Bacteria 4209
101 Ga0157372_10533104 3300013307 Bacteria 1368
102 Ga0163163_10073353 3300014325 Bacteria 3413
103 Ga0163163_10103417 3300014325 Bacteria 2873
104 Ga0163163_10272705 3300014325 Bacteria 1743
105 Ga0163163_10456849 3300014325 Bacteria 1338
106 Ga0157380_10700648 3300014326 Bacteria 1018
107 Ga0182008_10230870 3300014497 Bacteria 949
108 Ga0157379_10011603 3300014968 Bacteria 7695
109 Ga0157379_10770179 3300014968 Bacteria 907
110 Ga0209026_1000638 3300025250 Bacteria 21767
111 Ga0209148_1011175 3300025254 Bacteria 1676
112 Ga0209455_1018319 3300025272 Bacteria 1441
113 Ga0209758_1000404 3300025297 Bacteria 74016
114 Ga0209050_1001947 3300025298 Bacteria 19566
115 Ga0209257_1000227 3300025304 Bacteria 133512
116 Ga0209257_1000507 3300025304 Bacteria 68362
117 Ga0207705_10002827 3300025909 Bacteria 13280
118 Ga0207654_10211565 3300025911 Bacteria 1282
119 Ga0207707_10013355 3300025912 Bacteria 7158
120 Ga0207707_10105839 3300025912 Bacteria 2459
121 Ga0207707_10172594 3300025912 Bacteria 1889
122 Ga0207695_10001434 3300025913 Bacteria 40063
123 Ga0207695_10002208 3300025913 Bacteria 29280
124 Ga0207695_10008553 3300025913 Bacteria 12789
125 Ga0207695_10018032 3300025913 Bacteria 8173
126 Ga0207695_10212350 3300025913 Bacteria 1845
127 Ga0207695_10299910 3300025913 Bacteria 1498
128 Ga0207660_10040266 3300025917 Bacteria 3271
129 Ga0207657_10004268 3300025919 Bacteria 15143
130 Ga0207657_10037922 3300025919 Bacteria 4298
131 Ga0207657_10166391 3300025919 Bacteria 1788
132 Ga0207649_10257903 3300025920 Bacteria 1259
133 Ga0207649_10526114 3300025920 Bacteria 902
134 Ga0207652_10010326 3300025921 Bacteria 7520
135 Ga0207652_10261555 3300025921 Bacteria 1561
136 Ga0207681_10410507 3300025923 Bacteria 1095
137 Ga0207694_10294405 3300025924 Bacteria 1335
138 Ga0207650_10000030 3300025925 Bacteria 235824
139 Ga0207690_10000230 3300025932 Bacteria 41628
140 Ga0207690_10024990 3300025932 Bacteria 3746
141 Ga0207706_10170769 3300025933 Bacteria 1911
142 Ga0207686_10027356 3300025934 Bacteria 3339
143 Ga0207704_10000424 3300025938 Bacteria 18950
144 Ga0207711_10000718 3300025941 Bacteria 32642
145 Ga0207711_10002456 3300025941 Bacteria 16536
146 Ga0207711_10055085 3300025941 Bacteria 3414
147 Ga0207667_10037527 3300025949 Bacteria 5178
148 Ga0207667_10128907 3300025949 Bacteria 2605
149 Ga0207651_10726969 3300025960 Bacteria 876
150 Ga0207712_10030514 3300025961 Bacteria 3624
151 Ga0207668_10000755 3300025972 Bacteria 19802
152 Ga0207668_10007955 3300025972 Bacteria 6309
153 Ga0207668_10079006 3300025972 Bacteria 2378
154 Ga0207658_10000417 3300025986 Bacteria 40403
155 Ga0207658_10016972 3300025986 Bacteria 5010
156 Ga0207677_10055997 3300026023 Bacteria 2699
157 Ga0207703_10001137 3300026035 Bacteria 25123
158 Ga0207703_10407703 3300026035 Bacteria 1262
159 Ga0207639_10813379 3300026041 Bacteria 871
160 Ga0207702_10027809 3300026078 Bacteria 4698
161 Ga0207641_10002542 3300026088 Bacteria 16784
162 Ga0207641_10231870 3300026088 Bacteria 1716
163 Ga0207641_10459645 3300026088 Bacteria 1231
164 Ga0207641_10970304 3300026088 Bacteria 846
165 Ga0207676_10000227 3300026095 Bacteria 48869
166 Ga0207676_10067378 3300026095 Bacteria 2859
167 Ga0207676_10183148 3300026095 Bacteria 1836
168 Ga0207676_10212380 3300026095 Bacteria 1718
169 Ga0207676_10465820 3300026095 Bacteria 1194
170 Ga0207674_10401167 3300026116 Bacteria 1325
171 Ga0207674_10993646 3300026116 Bacteria 808
172 Ga0207675_100547582 3300026118 Bacteria 1156
173 Ga0207683_10093691 3300026121 Bacteria 2676
174 Ga0207698_10208317 3300026142 Bacteria 1757
175 Ga0207698_10594164 3300026142 Bacteria 1090
176 Ga0209983_1021498 3300027665 Bacteria 1349
177 Ga0268266_10000003 3300028379 Bacteria 1701703
178 Ga0268266_10003573 3300028379 Bacteria 15411
179 Ga0268265_10001058 3300028380 Bacteria 24688
180 Ga0268265_10010118 3300028380 Bacteria 6368
181 Ga0268265_10322667 3300028380 Bacteria 1399
182 Ga0268265_10367345 3300028380 Bacteria 1319
183 Ga0268264_10000181 3300028381 Bacteria 134092
184 Ga0268264_10000205 3300028381 Bacteria 120743
185 Ga0307517_10006025 3300028786 Bacteria 18059
186 Ga0307517_10194984 3300028786 Bacteria 1278
187 Ga0307515_10198603 3300028794 Bacteria 1889
188 Ga0307515_10233907 3300028794 Bacteria 1623
189 Ga0265328_10015116 3300031239 Bacteria 3030
190 Ga0265327_10001467 3300031251 Bacteria 29538
191 Ga0307513_10000433 3300031456 Bacteria 60335
192 Ga0307513_10005316 3300031456 Bacteria 17027
193 Ga0307513_10007002 3300031456 Bacteria 14669
194 Ga0307408_100420189 3300031548 Bacteria 1153
195 Ga0307508_10085706 3300031616 Bacteria 2733
196 Ga0307510_10202438 3300033180 Bacteria 1518
197 Ga0307510_10215721 3300033180 Bacteria 1436
198 Ga0373936_0029084 3300035113 Bacteria 2174
199 Ga0373943_0366848 3300035170 Bacteria 827
200 Ga0373946_0006963 3300035171 Bacteria 4120
201 Ga0373935_0030494 3300035692 Bacteria 3343
202 Ga0373927_0000257 3300035695 Bacteria 41787
203 Ga0373925_0000083 3300037068 Bacteria 101171
204 Ga0395899_0002440 3300037312 Bacteria 15116
205 Ga0395899_0288379 3300037312 Bacteria 1114
206 Ga0395900_0119047 3300037418 Bacteria 2710
207 Ga0395898_0003119 3300037466 Bacteria 18715
208 Ga0395905_0003431 3300037471 Bacteria 16959
209 Ga0395905_0229753 3300037471 Bacteria 1735
210 Ga0395905_0364242 3300037471 Bacteria 1338
211 Ga0395905_0517387 3300037471 Bacteria 1094
212 Ga0395901_0000008 3300038443 Bacteria 495962
213 Ga0395901_0386048 3300038443 Bacteria 1441
214 Ga0436360_0633587 3300039438 Bacteria 1219
215 Ga0439446_0033969 3300042156 Bacteria 1483
216 Ga0495590_0005965 3300046457 Bacteria 4776
217 Ga0495638_0000185 3300046460 Bacteria 95220
218 Ga0495638_0018150 3300046460 Bacteria 4675
219 Ga0495638_0028101 3300046460 Bacteria 3635
220 Ga0495583_0113822 3300046506 Bacteria 1144
221 Ga0495610_0000985 3300046512 Bacteria 26266
222 Ga0495630_0044621 3300046517 Bacteria 3313
223 Ga0495630_0238612 3300046517 Bacteria 1389
224 Ga0495631_0002374 3300046518 Bacteria 10690
225 Ga0495637_0024108 3300046520 Bacteria 2754
226 Ga0495648_0000191 3300046524 Bacteria 70452
227 Ga0495642_0033586 3300046528 Bacteria 2063
228 Ga0495642_0046824 3300046528 Bacteria 1769
229 Ga0495642_0064540 3300046528 Bacteria 1523
230 Ga0495597_0027282 3300046542 Bacteria 2619
231 Ga0495645_0040922 3300046543 Bacteria 3379
232 Ga0495668_0002187 3300046616 Bacteria 16721
233 Ga0495668_0050257 3300046616 Bacteria 2311
234 Ga0495625_0014722 3300046660 Bacteria 6227
235 Ga0495625_0199404 3300046660 Bacteria 1322
236 Ga0495659_0011674 3300046664 Bacteria 2832
237 Ga0495669_0000164 3300046684 Bacteria 42542
238 Ga0495669_0000780 3300046684 Bacteria 13602
239 Ga0495669_0012354 3300046684 Bacteria 3635
240 Ga0495670_0427243 3300046691 Bacteria 717
241 Ga0495671_0040168 3300046692 Bacteria 2360
242 Ga0495581_0091133 3300047315 Bacteria 1768
243 Ga0495636_0024292 3300047318 Bacteria 2457
244 Ga0495672_0006996 3300047320 Bacteria 8573
245 Ga0495673_0000433 3300047469 Bacteria 47031
246 Ga0495681_0115399 3300047470 Bacteria 1158
247 Ga0495686_0000850 3300047472 Bacteria 39221
248 Ga0495686_0006390 3300047472 Bacteria 9035
249 Ga0495686_0056422 3300047472 Bacteria 2454
250 Ga0495602_0672335 3300048088 Bacteria 705
251 Ga0496101_0647584 3300048904 Bacteria 835
252 Ga0496102_0014891 3300048905 Bacteria 6766
253 Ga0496102_0084091 3300048905 Bacteria 2937
254 Ga0496103_0047603 3300048906 Bacteria 2650
255 Ga0496105_0397640 3300048908 Bacteria 1094
256 Ga0496106_0137823 3300048909 Bacteria 1918
257 Ga0496107_0014351 3300048910 Bacteria 5547
258 Ga0496108_0025436 3300048911 Bacteria 4879
259 Ga0496111_0759398 3300048914 Bacteria 703
260 Ga0496115_0001829 3300048918 Bacteria 15223
261 Ga0496115_0012114 3300048918 Bacteria 6483
262 Ga0496115_0015505 3300048918 Bacteria 5782
263 Ga0496115_0267298 3300048918 Bacteria 1405
264 Ga0496117_0014642 3300048920 Bacteria 6745
265 Ga0496118_0010767 3300048921 Bacteria 9014
266 Ga0496121_0000334 3300048924 Bacteria 98442
267 Ga0496125_0147889 3300048928 Bacteria 1620
268 Ga0495678_001819 3300049459 Bacteria 15683
269 Ga0501031_0041323 3300049568 Bacteria 3011
270 Ga0501033_0124259 3300049570 Bacteria 1871
271 Ga0501034_0504095 3300049571 Bacteria 1124
272 Ga0501034_0539851 3300049571 Bacteria 1076
273 Ga0501037_0471480 3300049573 Bacteria 854
274 Ga0501043_0316121 3300049579 Bacteria 1191
275 Ga0501043_0567583 3300049579 Bacteria 841
276 Ga0501047_0008914 3300049581 Bacteria 9469
277 Ga0501047_0049138 3300049581 Bacteria 4073
278 Ga0501047_0123235 3300049581 Bacteria 2473
279 Ga0501035_0054979 3300049822 Bacteria 3555
280 Ga0501044_0020080 3300049823 Bacteria 7133
281 nmdc:mga0k408_47378_c2 3300050493 Bacteria 1956
282 nmdc:mga07m45_94732_c1 3300050496 Bacteria 1712
283 Ga0500578_0000015 3300053086 Bacteria 179217
284 Ga0500643_065991 3300053087 Bacteria 1009
285 Ga0500644_0000058 3300053088 Bacteria 64557
286 Ga0500644_0018082 3300053088 Bacteria 2058
287 Ga0500641_0061033 3300053096 Bacteria 1570
288 Ga0500562_000626 3300053108 Bacteria 8522
289 Ga0500562_001605 3300053108 Bacteria 5617
290 Ga0500594_0000249 3300053118 Bacteria 12919
291 Ga0500594_0226332 3300053118 Bacteria 619
292 Ga0500595_160408 3300053119 Bacteria 627
293 Ga0500655_012696 3300053133 Bacteria 1533
294 Ga0500564_000038 3300053138 Bacteria 36426
295 Ga0500568_0093192 3300053139 Bacteria 1135
296 Ga0500622_0003083 3300053156 Bacteria 11483
297 Ga0500611_081823 3300053727 Bacteria 807
298 Ga0500645_003388 3300053730 Bacteria 6509
299 Ga0500645_009707 3300053730 Bacteria 3223
300 Ga0500656_006704 3300053732 Bacteria 1177
301 Ga0500599_017890 3300053736 Bacteria 988
302 2585149881 2582581279 Bacteria 4980720
303 2644087209 2643221614 Bacteria 4260023
304 2644342162 2643221661 Bacteria 4267604
305 2644368448 2643221666 Bacteria 4265935
306 2792463111 2791355048 Bacteria 5832535
307 2843745404 2843744320 Bacteria 5659202
308 2849561013 2849560528 Bacteria 5393480
309 2849576241 2849573788 Bacteria 5421256
310 2851157053 2851153111 Bacteria 5542585
311 2898332705 2898329390 Bacteria 5168154
312 Ga0495611_0051531
313 Ga0055530_10000640
314 Ga0055531_10003059
315 Ga0055531_10016872
316 Ga0055543_1028879
317 Ga0065165_1001741
318 Ga0065165_1011109
319 Ga0065165_1013773
320 Ga0065707_10128060
321 Ga0070658_10078048
322 Ga0070658_10110657
323 Ga0070658_10139856
324 Ga0070658_10338530
325 Ga0070676_10023707
326 Ga0070670_100223700
327 Ga0070666_10179652
328 Ga0070666_10212492
329 Ga0070680_100218232
330 Ga0070680_100266195
331 Ga0068868_100167763
332 Ga0070660_100044754
333 Ga0070691_10002545
334 Ga0070661_100255755
335 Ga0070668_100000129
336 Ga0070668_100000607
337 Ga0070668_100013972
338 Ga0070668_100089851
339 Ga0070669_100561873
340 Ga0070671_100543723
341 Ga0070671_100785587
342 Ga0070659_100003552
343 Ga0070659_100010444
344 Ga0070667_100000611
345 Ga0070667_100044804
346 Ga0070678_100085265
347 Ga0070681_10011022
348 Ga0070681_10101287
349 Ga0070679_100004932
350 Ga0070679_100085248
351 Ga0070679_100584786
352 Ga0068853_100024809
353 Ga0070665_100000246
354 Ga0070665_100000692
355 Ga0070665_100323854
356 Ga0068855_100017186
357 Ga0068855_100033269
358 Ga0068855_100181277
359 Ga0070664_100085033
360 Ga0068857_100720006
361 Ga0068854_100632460
362 Ga0068852_100240832
363 Ga0068852_100248429
364 Ga0068859_100269387
365 Ga0068864_100000225
366 Ga0068864_100005824
367 Ga0068864_100054186
368 Ga0068864_100238601
369 Ga0068864_100977761
370 Ga0068861_100340298
371 Ga0068861_100491975
372 Ga0068863_100000295
373 Ga0068863_100262790
374 Ga0068863_100434175
375 Ga0068858_100006578
376 Ga0068858_100346720
377 Ga0068860_100000027
378 Ga0068860_100000047
379 Ga0068860_100198131
380 Ga0068862_100000777
381 Ga0068862_100024026
382 Ga0068862_100066797
383 Ga0068862_100136654
384 Ga0081540_1004202
385 Ga0075362_10114260
386 Ga0075366_10053161
387 Ga0075370_10113703
388 Ga0068871_100598386
389 Ga0068865_100005457
390 Ga0097620_100269378
391 Ga0105240_10002602
392 Ga0105240_10028500
393 Ga0105240_10080612
394 Ga0105240_10094794
395 Ga0105240_10108617
396 Ga0105240_10130082
397 Ga0105240_10401193
398 Ga0105242_10052365
399 Ga0105248_10000112
400 Ga0105248_10080823
401 Ga0105248_10148266
402 Ga0105237_10649305
403 Ga0105238_10020059
404 Ga0105238_10061613
405 Ga0105238_10075235
406 Ga0105238_10366804
407 Ga0105249_10000550
408 Ga0105239_10420756
409 Ga0157373_10367307
410 Ga0157374_10318921
411 Ga0157372_10061377
412 Ga0157372_10533104
413 Ga0163163_10073353
414 Ga0163163_10103417
415 Ga0163163_10272705
416 Ga0163163_10456849
417 Ga0157380_10700648
418 Ga0182008_10230870
419 Ga0157379_10011603
420 Ga0157379_10770179
421 Ga0209026_1000638
422 Ga0209148_1011175
423 Ga0209455_1018319
424 Ga0209758_1000404
425 Ga0209050_1001947
426 Ga0209257_1000227
427 Ga0209257_1000507
428 Ga0207705_10002827
429 Ga0207654_10211565
430 Ga0207707_10013355
431 Ga0207707_10105839
432 Ga0207707_10172594
433 Ga0207695_10001434
434 Ga0207695_10002208
435 Ga0207695_10008553
436 Ga0207695_10018032
437 Ga0207695_10212350
438 Ga0207695_10299910
439 Ga0207660_10040266
440 Ga0207657_10004268
441 Ga0207657_10037922
442 Ga0207657_10166391
443 Ga0207649_10257903
444 Ga0207649_10526114
445 Ga0207652_10010326
446 Ga0207652_10261555
447 Ga0207681_10410507
448 Ga0207694_10294405
449 Ga0207650_10000030
450 Ga0207690_10000230
451 Ga0207690_10024990
452 Ga0207706_10170769
453 Ga0207686_10027356
454 Ga0207704_10000424
455 Ga0207711_10000718
456 Ga0207711_10002456
457 Ga0207711_10055085
458 Ga0207667_10037527
459 Ga0207667_10128907
460 Ga0207651_10726969
461 Ga0207712_10030514
462 Ga0207668_10000755
463 Ga0207668_10007955
464 Ga0207668_10079006
465 Ga0207658_10000417
466 Ga0207658_10016972
467 Ga0207677_10055997
468 Ga0207703_10001137
469 Ga0207703_10407703
470 Ga0207639_10813379
471 Ga0207702_10027809
472 Ga0207641_10002542
473 Ga0207641_10231870
474 Ga0207641_10459645
475 Ga0207641_10970304
476 Ga0207676_10000227
477 Ga0207676_10067378
478 Ga0207676_10183148
479 Ga0207676_10212380
480 Ga0207676_10465820
481 Ga0207674_10401167
482 Ga0207674_10993646
483 Ga0207675_100547582
484 Ga0207683_10093691
485 Ga0207698_10208317
486 Ga0207698_10594164
487 Ga0209983_1021498
488 Ga0268266_10000003
489 Ga0268266_10003573
490 Ga0268265_10001058
491 Ga0268265_10010118
492 Ga0268265_10322667
493 Ga0268265_10367345
494 Ga0268264_10000181
495 Ga0268264_10000205
496 Ga0307517_10006025
497 Ga0307517_10194984
498 Ga0307515_10198603
499 Ga0307515_10233907
500 Ga0265328_10015116
501 Ga0265327_10001467
502 Ga0307513_10000433
503 Ga0307513_10005316
504 Ga0307513_10007002
505 Ga0307408_100420189
506 Ga0307508_10085706
507 Ga0307510_10202438
508 Ga0307510_10215721
509 Ga0373936_0029084
510 Ga0373943_0366848
511 Ga0373946_0006963
512 Ga0373935_0030494
513 Ga0373927_0000257
514 Ga0373925_0000083
515 Ga0395899_0002440
516 Ga0395899_0288379
517 Ga0395900_0119047
518 Ga0395898_0003119
519 Ga0395905_0003431
520 Ga0395905_0229753
521 Ga0395905_0364242
522 Ga0395905_0517387
523 Ga0395901_0000008
524 Ga0395901_0386048
525 Ga0436360_0633587
526 Ga0439446_0033969
527 Ga0495590_0005965
528 Ga0495638_0000185
529 Ga0495638_0018150
530 Ga0495638_0028101
531 Ga0495583_0113822
532 Ga0495610_0000985
533 Ga0495630_0044621
534 Ga0495630_0238612
535 Ga0495631_0002374
536 Ga0495637_0024108
537 Ga0495648_0000191
538 Ga0495642_0033586
539 Ga0495642_0046824
540 Ga0495642_0064540
541 Ga0495597_0027282
542 Ga0495645_0040922
543 Ga0495668_0002187
544 Ga0495668_0050257
545 Ga0495625_0014722
546 Ga0495625_0199404
547 Ga0495659_0011674
548 Ga0495669_0000164
549 Ga0495669_0000780
550 Ga0495669_0012354
551 Ga0495670_0427243
552 Ga0495671_0040168
553 Ga0495581_0091133
554 Ga0495636_0024292
555 Ga0495672_0006996
556 Ga0495673_0000433
557 Ga0495681_0115399
558 Ga0495686_0000850
559 Ga0495686_0006390
560 Ga0495686_0056422
561 Ga0495602_0672335
562 Ga0496101_0647584
563 Ga0496102_0014891
564 Ga0496102_0084091
565 Ga0496103_0047603
566 Ga0496105_0397640
567 Ga0496106_0137823
568 Ga0496107_0014351
569 Ga0496108_0025436
570 Ga0496111_0759398
571 Ga0496115_0001829
572 Ga0496115_0012114
573 Ga0496115_0015505
574 Ga0496115_0267298
575 Ga0496117_0014642
576 Ga0496118_0010767
577 Ga0496121_0000334
578 Ga0496125_0147889
579 Ga0495678_001819
580 Ga0501031_0041323
581 Ga0501033_0124259
582 Ga0501034_0504095
583 Ga0501034_0539851
584 Ga0501037_0471480
585 Ga0501043_0316121
586 Ga0501043_0567583
587 Ga0501047_0008914
588 Ga0501047_0049138
589 Ga0501047_0123235
590 Ga0501035_0054979
591 Ga0501044_0020080
592 nmdc:mga0k408_47378_c2
593 nmdc:mga07m45_94732_c1
594 Ga0500578_0000015
595 Ga0500643_065991
596 Ga0500644_0000058
597 Ga0500644_0018082
598 Ga0500641_0061033
599 Ga0500562_000626
600 Ga0500562_001605
601 Ga0500594_0000249
602 Ga0500594_0226332
603 Ga0500595_160408
604 Ga0500655_012696
605 Ga0500564_000038
606 Ga0500568_0093192
607 Ga0500622_0003083
608 Ga0500611_081823
609 Ga0500645_003388
610 Ga0500645_009707
611 Ga0500656_006704
612 Ga0500599_017890
613 2585149881
614 2644087209
615 2644342162
616 2644368448
617 2792463111
618 2843745404
619 2849561013
620 2849576241
621 2851157053
622 2898332705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

13

78

0.96

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

77

0.94

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

13

83

0.89

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

130

197

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cz3-assembly1.cif.gz_A crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) 0.974 1 214
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9738 4 213
4igj-assembly1.cif.gz_A crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175 0.9609 2 213
4pxo-assembly1.cif.gz_B crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) 0.9604 4 213
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9603 4 213
ID Description Score Start End Superfamily
2v6kB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9852 6 80 3.40.30.10
af_A0A1D6HAW8_13_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9718 6 72 3.40.30.10
4kaeA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9715 86 213 1.20.1050.10
3lg6D02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.961 92 212 1.20.1050.10
af_K7TUZ4_3_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9596 3 67 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W9QY15-F1-model_v4 deleted 0.9854 2 213
AF-A0A1I5I2J3-F1-model_v4 Maleylacetoacetate isomerase 0.9849 4 213 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A2U8PMB9-F1-model_v4 Maleylacetoacetate isomerase 0.9845 4 213 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A2A6PA57-F1-model_v4 Maleylacetoacetate isomerase 0.9844 4 213 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A2T9JID6-F1-model_v4 Maleylacetoacetate isomerase 0.9843 4 213 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034

Map