F401310

General Info

Members Datasets Scaffolds Average Seq Length
311 148 622 291

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0370528|Ga0395905_0370528_10_897
Length 295
Sequence MAGWPNLSDLVSTGHGEASVALLGAPLAAGSVTPGGCDLAPGLLRRTLKRIGRYDVETGRELATQVADRGDIELAGLSIEQATPIIRDAVAASTQAHALTLLVGGNNAVTRPGVLGLGLGGALEEVGLITLDAHFDMRDLDAGLSNGNPVRALIEDGLAGANIAQVGLASFANSRAMHEDALEAGNLVITIGDVRRNGISHAVERALDHVSHCDVLVVDCDIDVIDRSQFPAAPGGRPGGMRVEDFFHAVRKLASDPRVRVIDLTEWDPPLDSTDLSALTAARWVAECLAGFELR

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.65
Rhizosphere 89.39
Stem 0
Stem Tuber 0
Unclassified 0.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0370528 3300037471 Bacteria 1325
2 JGI24737J22298_10000324 3300001990 Bacteria 16023
3 Ga0065712_10088810 3300005290 Bacteria 2501
4 Ga0070658_10081665 3300005327 Bacteria 2655
5 Ga0070676_10168707 3300005328 Bacteria 1414
6 Ga0070676_10194075 3300005328 Bacteria 1327
7 Ga0070670_100014972 3300005331 Bacteria 6656
8 Ga0070670_100015345 3300005331 Bacteria 6579
9 Ga0070670_100051843 3300005331 Bacteria 3523
10 Ga0070670_100066497 3300005331 Bacteria 3093
11 Ga0070670_100094568 3300005331 Bacteria 2570
12 Ga0070677_10008594 3300005333 Bacteria 3442
13 Ga0070666_10005130 3300005335 Bacteria 8018
14 Ga0070666_10248080 3300005335 Bacteria 1260
15 Ga0070660_100007624 3300005339 Bacteria 7544
16 Ga0070660_100029387 3300005339 Bacteria 4119
17 Ga0070660_100321193 3300005339 Bacteria 1272
18 Ga0070661_100013118 3300005344 Bacteria 5814
19 Ga0070661_100028810 3300005344 Bacteria 4006
20 Ga0070661_100171136 3300005344 Bacteria 1649
21 Ga0070669_100034010 3300005353 Bacteria 3689
22 Ga0070669_100339099 3300005353 Bacteria 1218
23 Ga0070675_100005992 3300005354 Bacteria 9317
24 Ga0070675_100059004 3300005354 Bacteria 3165
25 Ga0070671_100000722 3300005355 Bacteria 23671
26 Ga0070671_100016623 3300005355 Bacteria 5947
27 Ga0070671_100026840 3300005355 Bacteria 4737
28 Ga0070671_100028153 3300005355 Bacteria 4627
29 Ga0070671_100081977 3300005355 Bacteria 2697
30 Ga0070671_100169398 3300005355 Bacteria 1847
31 Ga0070671_100211164 3300005355 Bacteria 1646
32 Ga0070671_100323323 3300005355 Bacteria 1315
33 Ga0070674_100041889 3300005356 Bacteria 3107
34 Ga0070674_100049994 3300005356 Bacteria 2877
35 Ga0070674_100052657 3300005356 Bacteria 2808
36 Ga0070673_100010201 3300005364 Bacteria 6346
37 Ga0070673_100031950 3300005364 Bacteria 3957
38 Ga0070673_100263145 3300005364 Bacteria 1507
39 Ga0070659_100046870 3300005366 Bacteria 3389
40 Ga0070659_100065838 3300005366 Bacteria 2870
41 Ga0070659_100137111 3300005366 Bacteria 1990
42 Ga0070659_100205691 3300005366 Bacteria 1621
43 Ga0070659_100296465 3300005366 Bacteria 1347
44 Ga0070659_100570095 3300005366 Bacteria 970
45 Ga0070667_100014738 3300005367 Bacteria 6459
46 Ga0070667_100081936 3300005367 Bacteria 2762
47 Ga0070714_100050559 3300005435 Bacteria 3541
48 Ga0070714_100194302 3300005435 Bacteria 1853
49 Ga0070713_100015586 3300005436 Bacteria 5691
50 Ga0070663_100123800 3300005455 Bacteria 1956
51 Ga0070663_100147769 3300005455 Bacteria 1799
52 Ga0070678_100001905 3300005456 Bacteria 11243
53 Ga0070678_100012825 3300005456 Bacteria 5228
54 Ga0070678_100045984 3300005456 Bacteria 3127
55 Ga0070662_100006491 3300005457 Bacteria 7544
56 Ga0070662_100017314 3300005457 Bacteria 4857
57 Ga0070662_100018006 3300005457 Bacteria 4772
58 Ga0070662_100026135 3300005457 Bacteria 4040
59 Ga0070662_100093889 3300005457 Bacteria 2258
60 Ga0070662_100328681 3300005457 Bacteria 1248
61 Ga0070681_10166821 3300005458 Bacteria 2125
62 Ga0070679_100050585 3300005530 Bacteria 4139
63 Ga0070679_100333360 3300005530 Bacteria 1466
64 Ga0070679_100545245 3300005530 Bacteria 1103
65 Ga0070672_100007886 3300005543 Bacteria 7267
66 Ga0070672_100045587 3300005543 Bacteria 3393
67 Ga0070672_100061622 3300005543 Bacteria 2958
68 Ga0070672_100265700 3300005543 Bacteria 1448
69 Ga0070665_100529075 3300005548 Bacteria 1191
70 Ga0070664_100008697 3300005564 Bacteria 8219
71 Ga0070664_100024575 3300005564 Bacteria 4985
72 Ga0070664_100025665 3300005564 Bacteria 4887
73 Ga0070664_100035279 3300005564 Bacteria 4199
74 Ga0068857_100050812 3300005577 Bacteria 3677
75 Ga0068854_100106742 3300005578 Bacteria 2107
76 Ga0068856_100120551 3300005614 Bacteria 2624
77 Ga0068856_100314132 3300005614 Bacteria 1584
78 Ga0068852_100105813 3300005616 Bacteria 2549
79 Ga0068852_100155411 3300005616 Bacteria 2130
80 Ga0068852_100336938 3300005616 Bacteria 1469
81 Ga0068864_100006041 3300005618 Bacteria 9940
82 Ga0068864_100051086 3300005618 Bacteria 3560
83 Ga0068864_100066292 3300005618 Bacteria 3134
84 Ga0068864_100140596 3300005618 Bacteria 2177
85 Ga0068863_100016032 3300005841 Bacteria 7186
86 Ga0068863_100016756 3300005841 Bacteria 7031
87 Ga0068863_100033681 3300005841 Bacteria 4880
88 Ga0068858_100017694 3300005842 Bacteria 6679
89 Ga0070717_10000431 3300006028 Bacteria 26731
90 Ga0097621_100065893 3300006237 Bacteria 2982
91 Ga0097621_100079696 3300006237 Bacteria 2723
92 Ga0075431_100004072 3300006847 Bacteria 14251
93 Ga0105243_10265984 3300009148 Bacteria 1538
94 Ga0105248_10006485 3300009177 Bacteria 12832
95 Ga0105248_10008037 3300009177 Bacteria 11583
96 Ga0105248_10032097 3300009177 Bacteria 5869
97 Ga0105248_10102243 3300009177 Bacteria 3230
98 Ga0105249_10406496 3300009553 Bacteria 1393
99 Ga0105246_10170051 3300011119 Bacteria 1668
100 Ga0157373_10058580 3300013100 Bacteria 2731
101 Ga0157371_10219386 3300013102 Bacteria 1366
102 Ga0157370_10144288 3300013104 Bacteria 2217
103 Ga0157369_10249396 3300013105 Bacteria 1853
104 Ga0157374_10037272 3300013296 Bacteria 4461
105 Ga0157378_10022089 3300013297 Bacteria 5598
106 Ga0163162_10015262 3300013306 Bacteria 7503
107 Ga0163162_10224922 3300013306 Bacteria 2006
108 Ga0157372_10155619 3300013307 Bacteria 2640
109 Ga0157375_10005824 3300013308 Bacteria 10723
110 Ga0157375_10262466 3300013308 Bacteria 1889
111 Ga0163163_10017811 3300014325 Bacteria 6630
112 Ga0157379_10256141 3300014968 Bacteria 1589
113 Ga0157376_10050769 3300014969 Bacteria 3443
114 Ga0163161_10142002 3300017792 Bacteria 1819
115 Ga0213876_10051571 3300021384 Bacteria 2174
116 Ga0207688_10120073 3300025901 Unclassified 1533
117 Ga0207680_10074381 3300025903 Bacteria 2115
118 Ga0207680_10198469 3300025903 Bacteria 1366
119 Ga0207647_10055624 3300025904 Bacteria 2431
120 Ga0207645_10206712 3300025907 Bacteria 1292
121 Ga0207705_10001727 3300025909 Bacteria 17322
122 Ga0207705_10005709 3300025909 Bacteria 9295
123 Ga0207705_10172639 3300025909 Bacteria 1628
124 Ga0207705_10189550 3300025909 Bacteria 1554
125 Ga0207707_10170106 3300025912 Bacteria 1904
126 Ga0207657_10004404 3300025919 Bacteria 14894
127 Ga0207657_10008624 3300025919 Bacteria 10320
128 Ga0207657_10015907 3300025919 Bacteria 7268
129 Ga0207657_10023268 3300025919 Bacteria 5772
130 Ga0207657_10045447 3300025919 Bacteria 3854
131 Ga0207657_10090369 3300025919 Bacteria 2556
132 Ga0207649_10028382 3300025920 Bacteria 3294
133 Ga0207649_10169218 3300025920 Bacteria 1521
134 Ga0207652_10017192 3300025921 Bacteria 5917
135 Ga0207650_10170086 3300025925 Bacteria 1731
136 Ga0207659_10039864 3300025926 Bacteria 3280
137 Ga0207659_10126410 3300025926 Bacteria 1967
138 Ga0207664_10016785 3300025929 Bacteria 5349
139 Ga0207644_10001903 3300025931 Bacteria 13541
140 Ga0207644_10009123 3300025931 Bacteria 6503
141 Ga0207644_10022050 3300025931 Bacteria 4346
142 Ga0207644_10171023 3300025931 Bacteria 1696
143 Ga0207690_10108658 3300025932 Bacteria 1994
144 Ga0207690_10120901 3300025932 Bacteria 1902
145 Ga0207690_10344891 3300025932 Bacteria 1176
146 Ga0207706_10029655 3300025933 Bacteria 4883
147 Ga0207706_10088866 3300025933 Bacteria 2716
148 Ga0207706_10111788 3300025933 Bacteria 2403
149 Ga0207706_10196724 3300025933 Bacteria 1768
150 Ga0207706_10287925 3300025933 Bacteria 1432
151 Ga0207706_10480595 3300025933 Bacteria 1073
152 Ga0207669_10027638 3300025937 Bacteria 3110
153 Ga0207669_10040034 3300025937 Bacteria 2715
154 Ga0207669_10045286 3300025937 Bacteria 2591
155 Ga0207704_10094620 3300025938 Bacteria 1973
156 Ga0207665_10063852 3300025939 Bacteria 2501
157 Ga0207691_10022250 3300025940 Bacteria 5981
158 Ga0207691_10025076 3300025940 Bacteria 5601
159 Ga0207691_10053848 3300025940 Bacteria 3672
160 Ga0207691_10056568 3300025940 Bacteria 3573
161 Ga0207711_10003441 3300025941 Bacteria 13694
162 Ga0207711_10057378 3300025941 Bacteria 3347
163 Ga0207689_10023438 3300025942 Bacteria 5181
164 Ga0207679_10002271 3300025945 Bacteria 11853
165 Ga0207679_10016486 3300025945 Bacteria 4908
166 Ga0207679_10055990 3300025945 Bacteria 2910
167 Ga0207679_10068508 3300025945 Bacteria 2666
168 Ga0207679_10433696 3300025945 Bacteria 1162
169 Ga0207679_10436971 3300025945 Bacteria 1158
170 Ga0207651_10029414 3300025960 Bacteria 3480
171 Ga0207651_10153157 3300025960 Bacteria 1797
172 Ga0207712_10185223 3300025961 Bacteria 1639
173 Ga0207668_10178594 3300025972 Bacteria 1672
174 Ga0207658_10060524 3300025986 Bacteria 2826
175 Ga0207658_10070428 3300025986 Bacteria 2646
176 Ga0207658_10336161 3300025986 Bacteria 1311
177 Ga0207703_10029280 3300026035 Bacteria 4344
178 Ga0207678_10018633 3300026067 Bacteria 6094
179 Ga0207678_10043612 3300026067 Bacteria 3881
180 Ga0207678_10073034 3300026067 Bacteria 2940
181 Ga0207641_10071287 3300026088 Bacteria 2988
182 Ga0207641_10185204 3300026088 Bacteria 1909
183 Ga0207676_10009268 3300026095 Bacteria 7002
184 Ga0207676_10014804 3300026095 Bacteria 5618
185 Ga0207676_10043911 3300026095 Bacteria 3445
186 Ga0207676_10114066 3300026095 Bacteria 2266
187 Ga0207674_10004552 3300026116 Bacteria 16658
188 Ga0207674_10071582 3300026116 Bacteria 3484
189 Ga0207683_10007823 3300026121 Bacteria 9149
190 Ga0207683_10012789 3300026121 Bacteria 7163
191 Ga0207683_10020172 3300026121 Bacteria 5698
192 Ga0207683_10026607 3300026121 Bacteria 4994
193 Ga0207683_10078113 3300026121 Bacteria 2933
194 Ga0207698_10160379 3300026142 Bacteria 1966
195 Ga0207698_10304638 3300026142 Bacteria 1485
196 Ga0209974_10031533 3300027876 Bacteria 1755
197 Ga0268266_10224410 3300028379 Bacteria 1728
198 Ga0307408_100040317 3300031548 Bacteria 3306
199 Ga0307408_100131727 3300031548 Bacteria 1951
200 Ga0307408_100348694 3300031548 Bacteria 1255
201 Ga0307405_10065874 3300031731 Bacteria 2308
202 Ga0307405_10128809 3300031731 Bacteria 1745
203 Ga0307413_10002144 3300031824 Bacteria 7928
204 Ga0307413_10011041 3300031824 Bacteria 4417
205 Ga0307413_10187248 3300031824 Bacteria 1482
206 Ga0307410_10000996 3300031852 Bacteria 12244
207 Ga0307410_10004669 3300031852 Bacteria 7119
208 Ga0307410_10027043 3300031852 Bacteria 3621
209 Ga0307410_10088159 3300031852 Bacteria 2196
210 Ga0307406_10012815 3300031901 Bacteria 4788
211 Ga0307406_10281415 3300031901 Bacteria 1269
212 Ga0307407_10017042 3300031903 Bacteria 3634
213 Ga0307412_10025832 3300031911 Bacteria 3642
214 Ga0307412_10032997 3300031911 Bacteria 3286
215 Ga0307412_10135206 3300031911 Bacteria 1797
216 Ga0307409_100051888 3300031995 Bacteria 3141
217 Ga0307409_100055559 3300031995 Bacteria 3058
218 Ga0307416_100003477 3300032002 Bacteria 9253
219 Ga0307416_100051543 3300032002 Bacteria 3288
220 Ga0307416_100057077 3300032002 Bacteria 3155
221 Ga0307414_10010814 3300032004 Bacteria 5323
222 Ga0307414_10041434 3300032004 Bacteria 3119
223 Ga0307414_10262733 3300032004 Bacteria 1441
224 Ga0307411_10004196 3300032005 Bacteria 6849
225 Ga0307411_10007454 3300032005 Bacteria 5575
226 Ga0307411_10083326 3300032005 Bacteria 2208
227 Ga0307411_10174200 3300032005 Bacteria 1626
228 Ga0307411_10183642 3300032005 Bacteria 1590
229 Ga0307411_10307520 3300032005 Bacteria 1274
230 Ga0307415_100030167 3300032126 Bacteria 3476
231 Ga0307415_100065973 3300032126 Bacteria 2524
232 Ga0373942_0114205 3300035207 Bacteria 838
233 Ga0373931_0021629 3300035691 Bacteria 3228
234 Ga0373925_0475677 3300037068 Bacteria 1024
235 Ga0395899_0005437 3300037312 Bacteria 9884
236 Ga0395900_0004081 3300037418 Bacteria 15571
237 Ga0395900_0073991 3300037418 Bacteria 3503
238 Ga0395898_0006634 3300037466 Bacteria 12340
239 Ga0395898_0103180 3300037466 Bacteria 2736
240 Ga0395898_0529917 3300037466 Bacteria 1119
241 Ga0395905_0003693 3300037471 Bacteria 16206
242 Ga0395905_0075397 3300037471 Bacteria 3161
243 Ga0395905_0082621 3300037471 Bacteria 3010
244 Ga0395905_0319353 3300037471 Bacteria 1442
245 Ga0395905_0345931 3300037471 Bacteria 1378
246 Ga0395905_0387136 3300037471 Bacteria 1292
247 Ga0395905_0455015 3300037471 Bacteria 1178
248 Ga0395905_0465834 3300037471 Bacteria 1162
249 Ga0395901_0004251 3300038443 Bacteria 14447
250 Ga0395901_0009650 3300038443 Bacteria 9790
251 Ga0395901_0048641 3300038443 Bacteria 4404
252 Ga0395901_0322668 3300038443 Bacteria 1597
253 Ga0436365_1693069 3300039437 Bacteria 3319
254 Ga0436363_0503186 3300039450 Bacteria 1807
255 Ga0439448_0003607 3300042005 Bacteria 4306
256 Ga0439449_0063011 3300042007 Bacteria 1368
257 Ga0439458_0000501 3300042157 Bacteria 10006
258 Ga0466969_0024376 3300044656 Bacteria 3112
259 Ga0466961_0037269 3300044693 Bacteria 3119
260 Ga0466963_0040123 3300044694 Bacteria 3068
261 Ga0466964_0038854 3300044706 Bacteria 1915
262 Ga0466971_0057237 3300044719 Bacteria 1758
263 Ga0466957_0045285 3300044842 Bacteria 2668
264 Ga0466958_0033779 3300045836 Bacteria 3048
265 Ga0466967_0084267 3300045976 Bacteria 2876
266 Ga0495585_0104657 3300046492 Bacteria 1510
267 Ga0495644_0101263 3300046523 Bacteria 1090
268 Ga0495663_0012625 3300046525 Bacteria 2356
269 Ga0495663_0016448 3300046525 Bacteria 2090
270 Ga0495663_0064007 3300046525 Bacteria 1160
271 Ga0495598_0004362 3300046537 Bacteria 3057
272 Ga0495669_0000617 3300046684 Bacteria 15486
273 Ga0495669_0005194 3300046684 Bacteria 5417
274 Ga0495669_0062559 3300046684 Bacteria 1686
275 Ga0495670_0080943 3300046691 Bacteria 1654
276 Ga0495677_0002850 3300047445 Bacteria 6735
277 Ga0495677_0083913 3300047445 Unclassified 1196
278 Ga0496100_0004507 3300048903 Bacteria 7392
279 Ga0496101_0000589 3300048904 Bacteria 22135
280 Ga0496101_0056805 3300048904 Bacteria 2829
281 Ga0496102_0442054 3300048905 Bacteria 1220
282 Ga0496103_0038217 3300048906 Bacteria 2944
283 Ga0496104_0011224 3300048907 Bacteria 8018
284 Ga0496105_0010283 3300048908 Bacteria 7355
285 Ga0496106_0096241 3300048909 Bacteria 2291
286 Ga0496106_0311105 3300048909 Unclassified 1264
287 Ga0496107_0000990 3300048910 Bacteria 16900
288 Ga0496107_0023284 3300048910 Bacteria 4379
289 Ga0496107_0058060 3300048910 Bacteria 2798
290 Ga0496108_0005046 3300048911 Bacteria 10663
291 Ga0496108_0005353 3300048911 Bacteria 10374
292 Ga0496108_0116124 3300048911 Bacteria 2292
293 Ga0496109_0005451 3300048912 Bacteria 10641
294 Ga0496109_0068547 3300048912 Bacteria 3251
295 Ga0496109_0118078 3300048912 Bacteria 2469
296 Ga0496110_0006374 3300048913 Bacteria 9329
297 Ga0496110_0091591 3300048913 Bacteria 2720
298 Ga0496110_0329641 3300048913 Bacteria 1390
299 Ga0496111_0000459 3300048914 Bacteria 20678
300 Ga0496111_0039686 3300048914 Bacteria 3377
301 Ga0496111_0054390 3300048914 Bacteria 2893
302 Ga0496112_0000707 3300048915 Bacteria 23147
303 Ga0496112_0006247 3300048915 Bacteria 10442
304 Ga0496113_0000431 3300048916 Bacteria 20368
305 Ga0496113_0008782 3300048916 Bacteria 6599
306 Ga0496113_0208633 3300048916 Bacteria 1555
307 Ga0496115_0201577 3300048918 Bacteria 1643
308 Ga0501070_0045732 3300049586 Bacteria 3640
309 Ga0501225_0012863 3300049705 Bacteria 2346
310 nmdc:mga06r32_1430_c1 3300050510 Bacteria 21552
311 Ga0466962_0023255 3300061719 Bacteria 2978
312 Ga0395905_0370528
313 JGI24737J22298_10000324
314 Ga0065712_10088810
315 Ga0070658_10081665
316 Ga0070676_10168707
317 Ga0070676_10194075
318 Ga0070670_100014972
319 Ga0070670_100015345
320 Ga0070670_100051843
321 Ga0070670_100066497
322 Ga0070670_100094568
323 Ga0070677_10008594
324 Ga0070666_10005130
325 Ga0070666_10248080
326 Ga0070660_100007624
327 Ga0070660_100029387
328 Ga0070660_100321193
329 Ga0070661_100013118
330 Ga0070661_100028810
331 Ga0070661_100171136
332 Ga0070669_100034010
333 Ga0070669_100339099
334 Ga0070675_100005992
335 Ga0070675_100059004
336 Ga0070671_100000722
337 Ga0070671_100016623
338 Ga0070671_100026840
339 Ga0070671_100028153
340 Ga0070671_100081977
341 Ga0070671_100169398
342 Ga0070671_100211164
343 Ga0070671_100323323
344 Ga0070674_100041889
345 Ga0070674_100049994
346 Ga0070674_100052657
347 Ga0070673_100010201
348 Ga0070673_100031950
349 Ga0070673_100263145
350 Ga0070659_100046870
351 Ga0070659_100065838
352 Ga0070659_100137111
353 Ga0070659_100205691
354 Ga0070659_100296465
355 Ga0070659_100570095
356 Ga0070667_100014738
357 Ga0070667_100081936
358 Ga0070714_100050559
359 Ga0070714_100194302
360 Ga0070713_100015586
361 Ga0070663_100123800
362 Ga0070663_100147769
363 Ga0070678_100001905
364 Ga0070678_100012825
365 Ga0070678_100045984
366 Ga0070662_100006491
367 Ga0070662_100017314
368 Ga0070662_100018006
369 Ga0070662_100026135
370 Ga0070662_100093889
371 Ga0070662_100328681
372 Ga0070681_10166821
373 Ga0070679_100050585
374 Ga0070679_100333360
375 Ga0070679_100545245
376 Ga0070672_100007886
377 Ga0070672_100045587
378 Ga0070672_100061622
379 Ga0070672_100265700
380 Ga0070665_100529075
381 Ga0070664_100008697
382 Ga0070664_100024575
383 Ga0070664_100025665
384 Ga0070664_100035279
385 Ga0068857_100050812
386 Ga0068854_100106742
387 Ga0068856_100120551
388 Ga0068856_100314132
389 Ga0068852_100105813
390 Ga0068852_100155411
391 Ga0068852_100336938
392 Ga0068864_100006041
393 Ga0068864_100051086
394 Ga0068864_100066292
395 Ga0068864_100140596
396 Ga0068863_100016032
397 Ga0068863_100016756
398 Ga0068863_100033681
399 Ga0068858_100017694
400 Ga0070717_10000431
401 Ga0097621_100065893
402 Ga0097621_100079696
403 Ga0075431_100004072
404 Ga0105243_10265984
405 Ga0105248_10006485
406 Ga0105248_10008037
407 Ga0105248_10032097
408 Ga0105248_10102243
409 Ga0105249_10406496
410 Ga0105246_10170051
411 Ga0157373_10058580
412 Ga0157371_10219386
413 Ga0157370_10144288
414 Ga0157369_10249396
415 Ga0157374_10037272
416 Ga0157378_10022089
417 Ga0163162_10015262
418 Ga0163162_10224922
419 Ga0157372_10155619
420 Ga0157375_10005824
421 Ga0157375_10262466
422 Ga0163163_10017811
423 Ga0157379_10256141
424 Ga0157376_10050769
425 Ga0163161_10142002
426 Ga0213876_10051571
427 Ga0207688_10120073
428 Ga0207680_10074381
429 Ga0207680_10198469
430 Ga0207647_10055624
431 Ga0207645_10206712
432 Ga0207705_10001727
433 Ga0207705_10005709
434 Ga0207705_10172639
435 Ga0207705_10189550
436 Ga0207707_10170106
437 Ga0207657_10004404
438 Ga0207657_10008624
439 Ga0207657_10015907
440 Ga0207657_10023268
441 Ga0207657_10045447
442 Ga0207657_10090369
443 Ga0207649_10028382
444 Ga0207649_10169218
445 Ga0207652_10017192
446 Ga0207650_10170086
447 Ga0207659_10039864
448 Ga0207659_10126410
449 Ga0207664_10016785
450 Ga0207644_10001903
451 Ga0207644_10009123
452 Ga0207644_10022050
453 Ga0207644_10171023
454 Ga0207690_10108658
455 Ga0207690_10120901
456 Ga0207690_10344891
457 Ga0207706_10029655
458 Ga0207706_10088866
459 Ga0207706_10111788
460 Ga0207706_10196724
461 Ga0207706_10287925
462 Ga0207706_10480595
463 Ga0207669_10027638
464 Ga0207669_10040034
465 Ga0207669_10045286
466 Ga0207704_10094620
467 Ga0207665_10063852
468 Ga0207691_10022250
469 Ga0207691_10025076
470 Ga0207691_10053848
471 Ga0207691_10056568
472 Ga0207711_10003441
473 Ga0207711_10057378
474 Ga0207689_10023438
475 Ga0207679_10002271
476 Ga0207679_10016486
477 Ga0207679_10055990
478 Ga0207679_10068508
479 Ga0207679_10433696
480 Ga0207679_10436971
481 Ga0207651_10029414
482 Ga0207651_10153157
483 Ga0207712_10185223
484 Ga0207668_10178594
485 Ga0207658_10060524
486 Ga0207658_10070428
487 Ga0207658_10336161
488 Ga0207703_10029280
489 Ga0207678_10018633
490 Ga0207678_10043612
491 Ga0207678_10073034
492 Ga0207641_10071287
493 Ga0207641_10185204
494 Ga0207676_10009268
495 Ga0207676_10014804
496 Ga0207676_10043911
497 Ga0207676_10114066
498 Ga0207674_10004552
499 Ga0207674_10071582
500 Ga0207683_10007823
501 Ga0207683_10012789
502 Ga0207683_10020172
503 Ga0207683_10026607
504 Ga0207683_10078113
505 Ga0207698_10160379
506 Ga0207698_10304638
507 Ga0209974_10031533
508 Ga0268266_10224410
509 Ga0307408_100040317
510 Ga0307408_100131727
511 Ga0307408_100348694
512 Ga0307405_10065874
513 Ga0307405_10128809
514 Ga0307413_10002144
515 Ga0307413_10011041
516 Ga0307413_10187248
517 Ga0307410_10000996
518 Ga0307410_10004669
519 Ga0307410_10027043
520 Ga0307410_10088159
521 Ga0307406_10012815
522 Ga0307406_10281415
523 Ga0307407_10017042
524 Ga0307412_10025832
525 Ga0307412_10032997
526 Ga0307412_10135206
527 Ga0307409_100051888
528 Ga0307409_100055559
529 Ga0307416_100003477
530 Ga0307416_100051543
531 Ga0307416_100057077
532 Ga0307414_10010814
533 Ga0307414_10041434
534 Ga0307414_10262733
535 Ga0307411_10004196
536 Ga0307411_10007454
537 Ga0307411_10083326
538 Ga0307411_10174200
539 Ga0307411_10183642
540 Ga0307411_10307520
541 Ga0307415_100030167
542 Ga0307415_100065973
543 Ga0373942_0114205
544 Ga0373931_0021629
545 Ga0373925_0475677
546 Ga0395899_0005437
547 Ga0395900_0004081
548 Ga0395900_0073991
549 Ga0395898_0006634
550 Ga0395898_0103180
551 Ga0395898_0529917
552 Ga0395905_0003693
553 Ga0395905_0075397
554 Ga0395905_0082621
555 Ga0395905_0319353
556 Ga0395905_0345931
557 Ga0395905_0387136
558 Ga0395905_0455015
559 Ga0395905_0465834
560 Ga0395901_0004251
561 Ga0395901_0009650
562 Ga0395901_0048641
563 Ga0395901_0322668
564 Ga0436365_1693069
565 Ga0436363_0503186
566 Ga0439448_0003607
567 Ga0439449_0063011
568 Ga0439458_0000501
569 Ga0466969_0024376
570 Ga0466961_0037269
571 Ga0466963_0040123
572 Ga0466964_0038854
573 Ga0466971_0057237
574 Ga0466957_0045285
575 Ga0466958_0033779
576 Ga0466967_0084267
577 Ga0495585_0104657
578 Ga0495644_0101263
579 Ga0495663_0012625
580 Ga0495663_0016448
581 Ga0495663_0064007
582 Ga0495598_0004362
583 Ga0495669_0000617
584 Ga0495669_0005194
585 Ga0495669_0062559
586 Ga0495670_0080943
587 Ga0495677_0002850
588 Ga0495677_0083913
589 Ga0496100_0004507
590 Ga0496101_0000589
591 Ga0496101_0056805
592 Ga0496102_0442054
593 Ga0496103_0038217
594 Ga0496104_0011224
595 Ga0496105_0010283
596 Ga0496106_0096241
597 Ga0496106_0311105
598 Ga0496107_0000990
599 Ga0496107_0023284
600 Ga0496107_0058060
601 Ga0496108_0005046
602 Ga0496108_0005353
603 Ga0496108_0116124
604 Ga0496109_0005451
605 Ga0496109_0068547
606 Ga0496109_0118078
607 Ga0496110_0006374
608 Ga0496110_0091591
609 Ga0496110_0329641
610 Ga0496111_0000459
611 Ga0496111_0039686
612 Ga0496111_0054390
613 Ga0496112_0000707
614 Ga0496112_0006247
615 Ga0496113_0000431
616 Ga0496113_0008782
617 Ga0496113_0208633
618 Ga0496115_0201577
619 Ga0501070_0045732
620 Ga0501225_0012863
621 nmdc:mga06r32_1430_c1
622 Ga0466962_0023255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00491

Arginase

Arginase family

18

291

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m1r-assembly1.cif.gz_D the crystal structure of formimidoylglutamase from bacillus subtilis subsp. subtilis str. 168 0.9115 1 293
3m1r-assembly2.cif.gz_A the crystal structure of formimidoylglutamase from bacillus subtilis subsp. subtilis str. 168 0.9081 1 293
3m1r-assembly1.cif.gz_D the crystal structure of formimidoylglutamase from bacillus subtilis subsp. subtilis str. 168 0.8776 1 293
8c0h-assembly1.cif.gz_C error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/8c0h 0.8761 2 290
4myl-assembly1.cif.gz_A crystal structure of trypanosoma cruzi formiminoglutamase (oxidized) at ph 4.6 0.8748 3 293
ID Description Score Start End Superfamily
3m1rA01 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8897 9 291 3.40.800.10
3pzlA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8856 18 292 3.40.800.10
3m1rA01 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.878 9 291 3.40.800.10
2a0mA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8673 5 293 3.40.800.10
1gq7A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8606 2 292 3.40.800.10
ID Description Score Start End GO Terms
AF-A0A7G9SIS4-F1-model_v4 Arginase family protein 0.9619 1 293 GO:0008783
GO:0033389
GO:0046872
AF-A0A7G9SIS4-F1-model_v4 Arginase family protein 0.9586 1 293 GO:0008783
GO:0033389
GO:0046872
AF-A0A6J4TQP2-F1-model_v4 Formimidoylglutamase 0.9349 166 293 GO:0016813
GO:0046872
AF-A0A536EJ92-F1-model_v4 Formimidoylglutamase 0.9346 2 293 GO:0008783
GO:0033389
GO:0046872
AF-A0A2V8USJ4-F1-model_v4 Arginase 0.9328 1 293 GO:0008783
GO:0033389
GO:0046872

Map