F401290

General Info

Members Datasets Scaffolds Average Seq Length
311 240 596 316

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0009970|Ga0373926_0009970_182_1213
Length 343
Sequence MQRPQRQHDQQTDLEEMMSTQMHQNIATQDKASKFFLSPEELAEFHTRGFIGPYDLMDPDEMKAHWKRLRLDLFDRTKAVYPDAQPGTGIYDYDRHLDNSFLADVVCRPEITHRMASILGPDVLCWRSEFFPKYPGDEGTDWHQVDTFGGADGIPHIHWPNGSDFGGAMTAWIAFTDAPAEMSCMQFMPGTQRTMYFDESKGMHYDLDRVNKKEIKGIRRGFFGYDWRELQKDPNWEPDESKAVTMPCRAGQFIIFPTTLMHASTPHQGQRKEMRLAFAGRYVPTSVTLYENMKETGIVKELGGSYSLENYGAVLVTGKNEYTHNRMRTHTTTGKAFVNSNPR

Samples

Sample ID Description Type Environment
1 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
110 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
111 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
152 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
153 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
154 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
155 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
156 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
157 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
158 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
159 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
160 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
161 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
162 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
163 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
164 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
167 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
168 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
169 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
170 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
171 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
182 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 2501939600 Micromonospora sp. L5 Isolate Unclassified
198 2558860280 Kutzneria sp. 744 Isolate Unclassified
199 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
200 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
201 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
202 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
203 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
204 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
205 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
206 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
207 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
208 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
209 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
210 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
211 2643221548 Streptomyces sp. Root55 Isolate Unclassified
212 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
213 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
214 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
215 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
216 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
217 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
218 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
219 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
220 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
221 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
222 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
223 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
224 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
225 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
226 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
227 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
228 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
229 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
230 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
231 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
232 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
233 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
234 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
235 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
236 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
237 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
238 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
239 649633069 Micromonospora sp. L5 Isolate Unclassified
240 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.24
Metatranscriptomes 9
Isolates 15.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0
Rhizoplane 6.43
Rhizosphere 81.35
Stem 0
Stem Tuber 0.32
Unclassified 7.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373926_0009970 3300035083 Unclassified 3179
2 JGI25406J46586_10006754 3300003203 Bacteria 5273
3 Ga0006777J48905_1033644 3300003308 Bacteria 5435
4 Ga0006777J48905_1054764 3300003308 Bacteria 1321
5 rootL2_10230019 3300003322 Bacteria 1692
6 Ga0058863_10089071 3300004799 Bacteria 7565
7 Ga0058863_10152556 3300004799 Bacteria 2970
8 Ga0058861_10168280 3300004800 Unclassified 1615
9 Ga0058861_11904211 3300004800 Bacteria 3320
10 Ga0058862_10105337 3300004803 Unclassified 4245
11 Ga0065712_10087575 3300005290 Bacteria 2564
12 Ga0065707_10030895 3300005295 Unclassified 1237
13 Ga0070658_10183699 3300005327 Bacteria 1760
14 Ga0070683_100015795 3300005329 Bacteria 6637
15 Ga0070683_100145242 3300005329 Bacteria 2248
16 Ga0070680_100016476 3300005336 Bacteria 5817
17 Ga0070668_100210248 3300005347 Bacteria 1600
18 Ga0070714_100004066 3300005435 Bacteria 10991
19 Ga0070714_100005756 3300005435 Bacteria 9505
20 Ga0070714_100238227 3300005435 Bacteria 1679
21 Ga0070713_100017843 3300005436 Bacteria 5382
22 Ga0070713_100324562 3300005436 Bacteria 1422
23 Ga0070710_10000046 3300005437 Bacteria 57484
24 Ga0070711_100000060 3300005439 Bacteria 64859
25 Ga0070711_100000283 3300005439 Bacteria 26272
26 Ga0070711_100075931 3300005439 Bacteria 2381
27 Ga0070705_100002985 3300005440 Bacteria 8362
28 Ga0070700_100000081 3300005441 Bacteria 64423
29 Ga0070662_100000972 3300005457 Bacteria 17534
30 Ga0070681_10004091 3300005458 Bacteria 13784
31 Ga0070681_10004162 3300005458 Bacteria 13690
32 Ga0070698_100019074 3300005471 Bacteria 7212
33 Ga0070679_100244502 3300005530 Bacteria 1751
34 Ga0070679_100281339 3300005530 Bacteria 1616
35 Ga0070684_100017578 3300005535 Bacteria 5875
36 Ga0070684_100035922 3300005535 Unclassified 4244
37 Ga0070693_100115882 3300005547 Unclassified 1655
38 Ga0068855_100248999 3300005563 Unclassified 1982
39 Ga0070664_100114791 3300005564 Unclassified 2353
40 Ga0068857_100138651 3300005577 Bacteria 2197
41 Ga0068859_100012829 3300005617 Bacteria 8415
42 Ga0068864_100123529 3300005618 Bacteria 2317
43 Ga0081455_10117424 3300005937 Bacteria 2102
44 Ga0081539_10000217 3300005985 Bacteria 134597
45 Ga0081539_10003025 3300005985 Bacteria 21801
46 Ga0070717_10078733 3300006028 Bacteria 2763
47 Ga0070717_10538535 3300006028 Bacteria 1057
48 Ga0075365_10006279 3300006038 Bacteria 6520
49 Ga0075364_10040006 3300006051 Bacteria 3040
50 Ga0075364_10056731 3300006051 Bacteria 2565
51 Ga0070712_100001378 3300006175 Bacteria 14749
52 Ga0070712_100010746 3300006175 Bacteria 5785
53 Ga0070712_100041509 3300006175 Bacteria 3159
54 Ga0075428_100080930 3300006844 Bacteria 3545
55 Ga0075428_100173193 3300006844 Bacteria 2338
56 Ga0075428_100357073 3300006844 Bacteria 1568
57 Ga0075430_100000695 3300006846 Bacteria 25646
58 Ga0075430_100264937 3300006846 Bacteria 1423
59 Ga0075431_100096895 3300006847 Bacteria 3045
60 Ga0075431_100143644 3300006847 Bacteria 2459
61 Ga0097620_100012830 3300006931 Bacteria 8415
62 Ga0105244_10008960 3300009036 Bacteria 6193
63 Ga0105240_10032402 3300009093 Bacteria 6766
64 Ga0105240_10091746 3300009093 Bacteria 3710
65 Ga0111539_10195888 3300009094 Bacteria 2357
66 Ga0105248_10000859 3300009177 Bacteria 34163
67 Ga0105238_10019281 3300009551 Bacteria 6949
68 Ga0105246_10076620 3300011119 Bacteria 2370
69 Ga0157373_10001428 3300013100 Bacteria 18225
70 Ga0157370_10329793 3300013104 Unclassified 1407
71 Ga0157369_10048855 3300013105 Unclassified 4590
72 Ga0157372_10230714 3300013307 Bacteria 2146
73 Ga0206356_10214761 3300020070 Unclassified 1514
74 Ga0206352_10606210 3300020078 Bacteria 1799
75 Ga0206350_10163884 3300020080 Bacteria 1740
76 Ga0206354_10589526 3300020081 Bacteria 2310
77 Ga0206353_10021138 3300020082 Unclassified 2706
78 Ga0224712_10026016 3300022467 Bacteria 2064
79 Ga0224712_10038617 3300022467 Bacteria 1785
80 Ga0209759_1022869 3300025256 Bacteria 1389
81 Ga0207655_1000022 3300025728 Bacteria 483933
82 Ga0207692_10010767 3300025898 Bacteria 3869
83 Ga0207643_10000449 3300025908 Bacteria 26759
84 Ga0207707_10062342 3300025912 Unclassified 3244
85 Ga0207707_10334879 3300025912 Bacteria 1305
86 Ga0207695_10060366 3300025913 Unclassified 3925
87 Ga0207695_10070546 3300025913 Bacteria 3571
88 Ga0207693_10000296 3300025915 Bacteria 46372
89 Ga0207693_10004019 3300025915 Bacteria 12506
90 Ga0207693_10200979 3300025915 Bacteria 1567
91 Ga0207663_10000507 3300025916 Bacteria 17049
92 Ga0207663_10000592 3300025916 Bacteria 16053
93 Ga0207660_10200737 3300025917 Unclassified 1557
94 Ga0207646_10055560 3300025922 Bacteria 3540
95 Ga0207687_10118049 3300025927 Bacteria 1979
96 Ga0207700_10093394 3300025928 Bacteria 2381
97 Ga0207664_10000247 3300025929 Bacteria 40518
98 Ga0207706_10002043 3300025933 Bacteria 19790
99 Ga0207711_10000833 3300025941 Bacteria 29912
100 Ga0207689_10054059 3300025942 Bacteria 3308
101 Ga0207661_10042502 3300025944 Unclassified 3583
102 Ga0207667_10032022 3300025949 Bacteria 5669
103 Ga0207668_10271336 3300025972 Bacteria 1387
104 Ga0207708_10000740 3300026075 Bacteria 24496
105 Ga0207674_10160223 3300026116 Bacteria 2205
106 Ga0207675_100269774 3300026118 Bacteria 1651
107 Ga0307517_10001451 3300028786 Bacteria 39803
108 Ga0307517_10002683 3300028786 Bacteria 28422
109 Ga0307517_10049263 3300028786 Bacteria 4314
110 Ga0307515_10002733 3300028794 Bacteria 37739
111 Ga0316181_1122414 3300030744 Bacteria 2538
112 Ga0265331_10010581 3300031250 Bacteria 5096
113 Ga0265327_10008946 3300031251 Bacteria 7341
114 Ga0307509_10082235 3300031507 Bacteria 3323
115 Ga0307408_100022656 3300031548 Bacteria 4270
116 Ga0307408_100180818 3300031548 Bacteria 1691
117 Ga0307508_10009853 3300031616 Bacteria 8759
118 Ga0307508_10024926 3300031616 Bacteria 5426
119 Ga0307413_10135043 3300031824 Bacteria 1695
120 Ga0307518_10010318 3300031838 Bacteria 6670
121 Ga0307410_10192896 3300031852 Bacteria 1550
122 Ga0307406_10023113 3300031901 Bacteria 3697
123 Ga0307406_10061655 3300031901 Bacteria 2423
124 Ga0307406_10116614 3300031901 Bacteria 1848
125 Ga0307406_10287227 3300031901 Bacteria 1257
126 Ga0307409_100070061 3300031995 Bacteria 2782
127 Ga0307416_100225775 3300032002 Bacteria 1801
128 Ga0307414_10060461 3300032004 Bacteria 2679
129 Ga0307411_10002538 3300032005 Bacteria 8134
130 Ga0307411_10031609 3300032005 Bacteria 3260
131 Ga0307415_100368467 3300032126 Bacteria 1215
132 Ga0307507_10004263 3300033179 Bacteria 25790
133 Ga0307507_10007202 3300033179 Bacteria 16376
134 Ga0307510_10007460 3300033180 Bacteria 13027
135 Ga0373946_0162676 3300035171 Bacteria 1049
136 Ga0373935_0000076 3300035692 Bacteria 42294
137 Ga0373927_0006543 3300035695 Bacteria 7939
138 Ga0373947_0000253 3300035725 Bacteria 30137
139 Ga0373937_0000943 3300036401 Bacteria 24720
140 Ga0373937_0341823 3300036401 Unclassified 1417
141 Ga0373937_0559614 3300036401 Bacteria 1086
142 Ga0373925_0009443 3300037068 Bacteria 7099
143 Ga0373925_0009516 3300037068 Bacteria 7074
144 Ga0373925_0015641 3300037068 Bacteria 5490
145 Ga0395899_0009532 3300037312 Bacteria 7454
146 Ga0395900_0013247 3300037418 Bacteria 8428
147 Ga0395905_0011887 3300037471 Bacteria 8402
148 Ga0451797_1177058 3300041453 Bacteria 1186
149 Ga0451853_0995190 3300041512 Bacteria 9955
150 Ga0439451_000027 3300042009 Bacteria 32302
151 Ga0439463_000544 3300042016 Bacteria 10565
152 Ga0439460_0007133 3300042461 Bacteria 2787
153 Ga0466969_0007099 3300044656 Bacteria 5961
154 Ga0466972_0005501 3300044658 Bacteria 6344
155 Ga0466970_0008706 3300044765 Bacteria 5112
156 Ga0466960_0048291 3300044901 Bacteria 2045
157 Ga0495592_0042134 3300046454 Bacteria 3419
158 Ga0495629_0003457 3300046459 Bacteria 11939
159 Ga0495651_0088685 3300046462 Bacteria 2324
160 Ga0495651_0280410 3300046462 Bacteria 1126
161 Ga0495607_0002686 3300046501 Bacteria 14195
162 Ga0495583_0021302 3300046506 Bacteria 3339
163 Ga0495608_0056424 3300046511 Bacteria 2594
164 Ga0495608_0223624 3300046511 Bacteria 1180
165 Ga0495618_0004895 3300046514 Bacteria 8186
166 Ga0495618_0030419 3300046514 Bacteria 3372
167 Ga0495628_0000706 3300046516 Bacteria 30853
168 Ga0495628_0046635 3300046516 Bacteria 3441
169 Ga0495630_0056629 3300046517 Unclassified 2937
170 Ga0495652_0031359 3300046529 Bacteria 4655
171 Ga0495652_0336512 3300046529 Bacteria 1086
172 Ga0495665_0002128 3300046531 Bacteria 10714
173 Ga0495645_0026601 3300046543 Bacteria 4200
174 Ga0495633_0014602 3300046558 Bacteria 4099
175 Ga0495625_0003469 3300046660 Bacteria 15677
176 Ga0495588_0012739 3300046674 Bacteria 3984
177 Ga0495657_0000638 3300046675 Bacteria 31749
178 Ga0495657_0002460 3300046675 Bacteria 15598
179 Ga0495613_0001146 3300046689 Bacteria 20222
180 Ga0495613_0041840 3300046689 Bacteria 3391
181 Ga0495624_0112734 3300046690 Bacteria 1672
182 Ga0495671_0005647 3300046692 Bacteria 7297
183 Ga0495649_0069150 3300046694 Bacteria 1894
184 Ga0495589_0023819 3300046794 Bacteria 3115
185 Ga0495636_0000355 3300047318 Bacteria 17503
186 Ga0495680_0002444 3300047322 Bacteria 19017
187 Ga0495680_0006066 3300047322 Bacteria 11292
188 Ga0495687_000506 3300047443 Bacteria 46910
189 Ga0495675_0041350 3300047444 Bacteria 2939
190 Ga0495685_000745 3300047447 Bacteria 9983
191 Ga0495681_0009439 3300047470 Bacteria 6013
192 Ga0495614_0004865 3300048089 Bacteria 6064
193 Ga0495614_0006537 3300048089 Bacteria 5225
194 Ga0496102_0104116 3300048905 Bacteria 2640
195 Ga0496106_0519528 3300048909 Unclassified 956
196 Ga0496108_0142272 3300048911 Bacteria 2067
197 Ga0496112_0021607 3300048915 Bacteria 6122
198 Ga0496112_0040309 3300048915 Unclassified 4566
199 Ga0496113_0014460 3300048916 Bacteria 5385
200 Ga0496116_0083352 3300048919 Bacteria 1974
201 Ga0501034_0000158 3300049571 Bacteria 128537
202 Ga0501199_000932 3300049650 Bacteria 2614
203 Ga0501202_000996 3300049652 Bacteria 4379
204 Ga0501216_012948 3300049660 Bacteria 1376
205 Ga0501217_000553 3300049661 Bacteria 6264
206 Ga0501223_005500 3300049663 Bacteria 2660
207 Ga0501224_001986 3300049664 Bacteria 2766
208 Ga0501230_011891 3300049667 Bacteria 1385
209 Ga0501235_001303 3300049669 Bacteria 5282
210 Ga0501236_005312 3300049670 Bacteria 1553
211 Ga0501243_001951 3300049675 Bacteria 3003
212 Ga0501249_023562 3300049679 Bacteria 1352
213 Ga0501257_051811 3300049686 Bacteria 1024
214 Ga0501259_012441 3300049688 Bacteria 1420
215 Ga0501221_044231 3300049704 Bacteria 982
216 Ga0501225_0018712 3300049705 Bacteria 1919
217 Ga0501234_001406 3300049707 Bacteria 3785
218 Ga0501245_008420 3300049708 Bacteria 1469
219 Ga0501268_009180 3300049765 Bacteria 1515
220 Ga0501273_003873 3300049770 Bacteria 1616
221 Ga0501279_011078 3300049775 Bacteria 1216
222 Ga0501226_000774 3300049853 Bacteria 4306
223 nmdc:mga00v17_49209_c1 3300050491 Bacteria 2556
224 nmdc:mga0yw44_45558_c1 3300050492 Bacteria 2630
225 nmdc:mga05p37_136607_c1 3300050507 Bacteria 3006
226 nmdc:mga09592_684423_c1 3300050508 Bacteria 874
227 nmdc:mga0qj67_3384_c1 3300050509 Bacteria 11499
228 nmdc:mga06r32_317106_c1 3300050510 Bacteria 1544
229 nmdc:mga06r32_564962_c1 3300050510 Bacteria 1111
230 nmdc:mga06r32_564964_c1 3300050510 Bacteria 1111
231 nmdc:mga08y16_149742_c1 3300050511 Bacteria 2426
232 nmdc:mga0rr50_290282_c1 3300050513 Bacteria 1366
233 Ga0495601_0017702 3300053077 Bacteria 4329
234 Ga0500555_026985 3300053103 Bacteria 1639
235 Ga0500560_000118 3300053107 Bacteria 8299
236 Ga0500622_0058367 3300053156 Bacteria 1972
237 Ga0587070_023501 3300059491 Bacteria 1059
238 Ga0587073_0015148 3300059492 Bacteria 1384
239 Ga0587077_013672 3300059493 Bacteria 1321
240 Ga0587080_010958 3300059503 Bacteria 1346
241 Ga0587083_0013206 3300059505 Bacteria 1402
242 Ga0587088_010067 3300059508 Bacteria 1377
243 Ga0587091_010511 3300059511 Bacteria 1418
244 Ga0587106_008177 3300059605 Bacteria 1293
245 Ga0587067_013439 3300059640 Bacteria 1296
246 Ga0587076_010732 3300059645 Bacteria 1331
247 Ga0587102_003043 3300059649 Bacteria 1341
248 Ga0587107_006306 3300059652 Bacteria 1294
249 Ga0587071_016202 3300060344 Bacteria 1317
250 2501945559 2501939600 Bacteria 6907073
251 2559432033 2558860280 Bacteria 11429938
252 2599617031 2599185212 Bacteria 6765997
253 2599946395 2599185302 Bacteria 5954930
254 2599957666 2599185304 Bacteria 5951361
255 2599986954 2599185309 Bacteria 5969593
256 2599992317 2599185310 Bacteria 6014457
257 2599997915 2599185311 Bacteria 6354990
258 2600001504 2599185312 Bacteria 5912071
259 2600039320 2599185318 Bacteria 6961590
260 2600041010 2599185319 Bacteria 6637840
261 2600050655 2599185320 Bacteria 5963263
262 2600062844 2599185322 Bacteria 6763055
263 2600067356 2599185323 Bacteria 6688755
264 2643759626 2643221548 Bacteria 8053412
265 2644013288 2643221601 Bacteria 7493239
266 2644175602 2643221631 Bacteria 8168043
267 2644283891 2643221650 Bacteria 7029547
268 2644462959 2643221682 Bacteria 6743283
269 2671130416 2667528176 Bacteria 6724917
270 2784591472 2784132148 Bacteria 8627943
271 2785373698 2784746768 Bacteria 10036182
272 2808857402 2808606361 Bacteria 6136259
273 2808926666 2808606376 Bacteria 6248667
274 2808937474 2808606378 Bacteria 6177535
275 2808948827 2808606380 Bacteria 6248705
276 2808965852 2808606383 Bacteria 6138645
277 2809000778 2808606389 Bacteria 6138126
278 2854604752 2854601825 Bacteria 4797592
279 2856863560 2856858025 Bacteria 7255264
280 2870075499 2870068957 Bacteria 8925310
281 2913040102 2913036834 Bacteria 6704877
282 2919487369 2919481497 Bacteria 6907839
283 2929147624 2929144301 Bacteria 6622272
284 2947233836 2947233263 Bacteria 6439278
285 2954388948 2954380949 Bacteria 10050426
286 2954694153 2954691527 Bacteria 10720516
287 2954694180 2954691527 Bacteria 10720516
288 2954709263 2954701450 Bacteria 10834262
289 2954709290 2954701450 Bacteria 10834262
290 2954719836 2954711539 Bacteria 10867210
291 2954719848 2954711539 Bacteria 10867210
292 2954729869 2954721474 Bacteria 10456478
293 2954729881 2954721474 Bacteria 10456478
294 2954750864 2954749733 Bacteria 10366972
295 2954750876 2954749733 Bacteria 10366972
296 2988729332 2988728565 Bacteria 6124362
297 649814675 649633069 Bacteria 6962533
298 8056123867 8056120720 Bacteria 5758328
299 Ga0373926_0009970
300 JGI25406J46586_10006754
301 Ga0006777J48905_1033644
302 Ga0006777J48905_1054764
303 rootL2_10230019
304 Ga0058863_10089071
305 Ga0058863_10152556
306 Ga0058861_10168280
307 Ga0058861_11904211
308 Ga0058862_10105337
309 Ga0065712_10087575
310 Ga0065707_10030895
311 Ga0070658_10183699
312 Ga0070683_100015795
313 Ga0070683_100145242
314 Ga0070680_100016476
315 Ga0070668_100210248
316 Ga0070714_100004066
317 Ga0070714_100005756
318 Ga0070714_100238227
319 Ga0070713_100017843
320 Ga0070713_100324562
321 Ga0070710_10000046
322 Ga0070711_100000060
323 Ga0070711_100000283
324 Ga0070711_100075931
325 Ga0070705_100002985
326 Ga0070700_100000081
327 Ga0070662_100000972
328 Ga0070681_10004091
329 Ga0070681_10004162
330 Ga0070698_100019074
331 Ga0070679_100244502
332 Ga0070679_100281339
333 Ga0070684_100017578
334 Ga0070684_100035922
335 Ga0070693_100115882
336 Ga0068855_100248999
337 Ga0070664_100114791
338 Ga0068857_100138651
339 Ga0068859_100012829
340 Ga0068864_100123529
341 Ga0081455_10117424
342 Ga0081539_10000217
343 Ga0081539_10003025
344 Ga0070717_10078733
345 Ga0070717_10538535
346 Ga0075365_10006279
347 Ga0075364_10040006
348 Ga0075364_10056731
349 Ga0070712_100001378
350 Ga0070712_100010746
351 Ga0070712_100041509
352 Ga0075428_100080930
353 Ga0075428_100173193
354 Ga0075428_100357073
355 Ga0075430_100000695
356 Ga0075430_100264937
357 Ga0075431_100096895
358 Ga0075431_100143644
359 Ga0097620_100012830
360 Ga0105244_10008960
361 Ga0105240_10032402
362 Ga0105240_10091746
363 Ga0111539_10195888
364 Ga0105248_10000859
365 Ga0105238_10019281
366 Ga0105246_10076620
367 Ga0157373_10001428
368 Ga0157370_10329793
369 Ga0157369_10048855
370 Ga0157372_10230714
371 Ga0206356_10214761
372 Ga0206352_10606210
373 Ga0206350_10163884
374 Ga0206354_10589526
375 Ga0206353_10021138
376 Ga0224712_10026016
377 Ga0224712_10038617
378 Ga0209759_1022869
379 Ga0207655_1000022
380 Ga0207692_10010767
381 Ga0207643_10000449
382 Ga0207707_10062342
383 Ga0207707_10334879
384 Ga0207695_10060366
385 Ga0207695_10070546
386 Ga0207693_10000296
387 Ga0207693_10004019
388 Ga0207693_10200979
389 Ga0207663_10000507
390 Ga0207663_10000592
391 Ga0207660_10200737
392 Ga0207646_10055560
393 Ga0207687_10118049
394 Ga0207700_10093394
395 Ga0207664_10000247
396 Ga0207706_10002043
397 Ga0207711_10000833
398 Ga0207689_10054059
399 Ga0207661_10042502
400 Ga0207667_10032022
401 Ga0207668_10271336
402 Ga0207708_10000740
403 Ga0207674_10160223
404 Ga0207675_100269774
405 Ga0307517_10001451
406 Ga0307517_10002683
407 Ga0307517_10049263
408 Ga0307515_10002733
409 Ga0316181_1122414
410 Ga0265331_10010581
411 Ga0265327_10008946
412 Ga0307509_10082235
413 Ga0307408_100022656
414 Ga0307408_100180818
415 Ga0307508_10009853
416 Ga0307508_10024926
417 Ga0307413_10135043
418 Ga0307518_10010318
419 Ga0307410_10192896
420 Ga0307406_10023113
421 Ga0307406_10061655
422 Ga0307406_10116614
423 Ga0307406_10287227
424 Ga0307409_100070061
425 Ga0307416_100225775
426 Ga0307414_10060461
427 Ga0307411_10002538
428 Ga0307411_10031609
429 Ga0307415_100368467
430 Ga0307507_10004263
431 Ga0307507_10007202
432 Ga0307510_10007460
433 Ga0373946_0162676
434 Ga0373935_0000076
435 Ga0373927_0006543
436 Ga0373947_0000253
437 Ga0373937_0000943
438 Ga0373937_0341823
439 Ga0373937_0559614
440 Ga0373925_0009443
441 Ga0373925_0009516
442 Ga0373925_0015641
443 Ga0395899_0009532
444 Ga0395900_0013247
445 Ga0395905_0011887
446 Ga0451797_1177058
447 Ga0451853_0995190
448 Ga0439451_000027
449 Ga0439463_000544
450 Ga0439460_0007133
451 Ga0466969_0007099
452 Ga0466972_0005501
453 Ga0466970_0008706
454 Ga0466960_0048291
455 Ga0495592_0042134
456 Ga0495629_0003457
457 Ga0495651_0088685
458 Ga0495651_0280410
459 Ga0495607_0002686
460 Ga0495583_0021302
461 Ga0495608_0056424
462 Ga0495608_0223624
463 Ga0495618_0004895
464 Ga0495618_0030419
465 Ga0495628_0000706
466 Ga0495628_0046635
467 Ga0495630_0056629
468 Ga0495652_0031359
469 Ga0495652_0336512
470 Ga0495665_0002128
471 Ga0495645_0026601
472 Ga0495633_0014602
473 Ga0495625_0003469
474 Ga0495588_0012739
475 Ga0495657_0000638
476 Ga0495657_0002460
477 Ga0495613_0001146
478 Ga0495613_0041840
479 Ga0495624_0112734
480 Ga0495671_0005647
481 Ga0495649_0069150
482 Ga0495589_0023819
483 Ga0495636_0000355
484 Ga0495680_0002444
485 Ga0495680_0006066
486 Ga0495687_000506
487 Ga0495675_0041350
488 Ga0495685_000745
489 Ga0495681_0009439
490 Ga0495614_0004865
491 Ga0495614_0006537
492 Ga0496102_0104116
493 Ga0496106_0519528
494 Ga0496108_0142272
495 Ga0496112_0021607
496 Ga0496112_0040309
497 Ga0496113_0014460
498 Ga0496116_0083352
499 Ga0501034_0000158
500 Ga0501199_000932
501 Ga0501202_000996
502 Ga0501216_012948
503 Ga0501217_000553
504 Ga0501223_005500
505 Ga0501224_001986
506 Ga0501230_011891
507 Ga0501235_001303
508 Ga0501236_005312
509 Ga0501243_001951
510 Ga0501249_023562
511 Ga0501257_051811
512 Ga0501259_012441
513 Ga0501221_044231
514 Ga0501225_0018712
515 Ga0501234_001406
516 Ga0501245_008420
517 Ga0501268_009180
518 Ga0501273_003873
519 Ga0501279_011078
520 Ga0501226_000774
521 nmdc:mga00v17_49209_c1
522 nmdc:mga0yw44_45558_c1
523 nmdc:mga05p37_136607_c1
524 nmdc:mga09592_684423_c1
525 nmdc:mga0qj67_3384_c1
526 nmdc:mga06r32_317106_c1
527 nmdc:mga06r32_564962_c1
528 nmdc:mga06r32_564964_c1
529 nmdc:mga08y16_149742_c1
530 nmdc:mga0rr50_290282_c1
531 Ga0495601_0017702
532 Ga0500555_026985
533 Ga0500560_000118
534 Ga0500622_0058367
535 Ga0587070_023501
536 Ga0587073_0015148
537 Ga0587077_013672
538 Ga0587080_010958
539 Ga0587083_0013206
540 Ga0587088_010067
541 Ga0587091_010511
542 Ga0587106_008177
543 Ga0587067_013439
544 Ga0587076_010732
545 Ga0587102_003043
546 Ga0587107_006306
547 Ga0587071_016202
548 2501945559
549 2559432033
550 2599617031
551 2599946395
552 2599957666
553 2599986954
554 2599992317
555 2599997915
556 2600001504
557 2600039320
558 2600041010
559 2600050655
560 2600062844
561 2600067356
562 2643759626
563 2644013288
564 2644175602
565 2644283891
566 2644462959
567 2671130416
568 2784591472
569 2785373698
570 2808857402
571 2808926666
572 2808937474
573 2808948827
574 2808965852
575 2809000778
576 2854604752
577 2856863560
578 2870075499
579 2913040102
580 2919487369
581 2929147624
582 2947233836
583 2954388948
584 2954694153
585 2954694180
586 2954709263
587 2954709290
588 2954719836
589 2954719848
590 2954729869
591 2954729881
592 2954750864
593 2954750876
594 2988729332
595 649814675
596 8056123867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

45

277

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fcv-assembly1.cif.gz_A syrb2 with fe(ii), bromide, and alpha-ketoglutarate 0.9845 9 314
2fcv-assembly2.cif.gz_B syrb2 with fe(ii), bromide, and alpha-ketoglutarate 0.9803 8 314
2fcv-assembly2.cif.gz_B syrb2 with fe(ii), bromide, and alpha-ketoglutarate 0.9771 8 314
2fcv-assembly1.cif.gz_A syrb2 with fe(ii), bromide, and alpha-ketoglutarate 0.9749 9 314
2fcu-assembly2.cif.gz_B syrb2 with alpha-ketoglutarate 0.9677 9 314
ID Description Score Start End Superfamily
2fcvA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9845 9 314 2.60.120.620
2fcvA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9749 9 314 2.60.120.620
3gjbB00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8951 9 314 2.60.120.620
3gjbB00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8731 9 314 2.60.120.620
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7768 104 258 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1V3WEG5-F1-model_v4 Syringomycin biosynthesis enzyme 2 0.9923 163 314
AF-A0A836ZL33-F1-model_v4 deleted 0.9895 83 253
AF-B1H6J1-F1-model_v4 deleted 0.9858 8 314
AF-A0A1V3WEG5-F1-model_v4 Syringomycin biosynthesis enzyme 2 0.9795 163 314
AF-Q6GWT3-F1-model_v4 DysB1 0.9759 9 299 GO:0005506
GO:0016706

Map