F401273

General Info

Members Datasets Scaffolds Average Seq Length
311 162 622 303

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10027517|Ga0265331_100275173
Length 317
Sequence MTLRLAFLGTPDFAVPTLAELIGQGHDIACVYSQPPRPKGRGLGTEPSPVHALALAHKIAVRTPASLKGAAEQAEFAALNLDAAIVVAYGLILPKPILDAPRLGCFNLHGSLLPRWRGAAPIQRAIMAGDAQTGVMTMRMEEGLDTGPVLMAERTPIARKTYGELHDELARLGADLMARTLAALERGSVTETPQSAEGVTYAKKILKEETRIDWSRPAHEIDCLIRGLSPAPGAWSEAKGERIKVLNCTPVSGSGLPGTIIDDALTVACGPASSSEAVGQTEKTGLRLTRLQRPGKSAMDATELLRGFALPAGTIFV

Samples

Sample ID Description Type Environment
1 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
157 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
158 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
159 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0
Rhizoplane 0.32
Rhizosphere 94.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265331_10027517 3300031250 Bacteria 2849
2 JGI25153J46596_10000812 3300003215 Bacteria 19097
3 rootH2_10006890 3300003320 Bacteria 23032
4 Ga0070690_100081777 3300005330 Bacteria 2114
5 Ga0070680_100000332 3300005336 Bacteria 31618
6 Ga0068868_100098636 3300005338 Bacteria 2362
7 Ga0070671_100421082 3300005355 Bacteria 1144
8 Ga0070709_10092233 3300005434 Bacteria 2000
9 Ga0070714_100003461 3300005435 Bacteria 11767
10 Ga0070714_100041533 3300005435 Bacteria 3882
11 Ga0070713_100000006 3300005436 Bacteria 190565
12 Ga0070713_100083878 3300005436 Bacteria 2725
13 Ga0070711_100077287 3300005439 Bacteria 2362
14 Ga0070678_100059713 3300005456 Bacteria 2804
15 Ga0070681_10000123 3300005458 Bacteria 57938
16 Ga0068867_100008764 3300005459 Bacteria 7142
17 Ga0070685_10014107 3300005466 Bacteria 4226
18 Ga0070699_100545560 3300005518 Bacteria 1055
19 Ga0070679_100000490 3300005530 Bacteria 33743
20 Ga0070679_100068194 3300005530 Bacteria 3548
21 Ga0070665_100043121 3300005548 Bacteria 4535
22 Ga0070665_100043691 3300005548 Bacteria 4502
23 Ga0070665_100060645 3300005548 Bacteria 3792
24 Ga0070665_100337983 3300005548 Bacteria 1510
25 Ga0068855_100000529 3300005563 Bacteria 46748
26 Ga0068855_100107220 3300005563 Bacteria 3210
27 Ga0068855_100107743 3300005563 Bacteria 3201
28 Ga0068856_100000280 3300005614 Bacteria 55488
29 Ga0068852_100085023 3300005616 Bacteria 2817
30 Ga0068852_100124144 3300005616 Bacteria 2368
31 Ga0068859_100622302 3300005617 Bacteria 1172
32 Ga0068864_100530568 3300005618 Bacteria 1136
33 Ga0068858_100008268 3300005842 Bacteria 10001
34 Ga0068858_100017472 3300005842 Bacteria 6729
35 Ga0068860_100044968 3300005843 Bacteria 4208
36 Ga0068860_100090247 3300005843 Bacteria 2919
37 Ga0068862_100082008 3300005844 Bacteria 2798
38 Ga0070715_10096392 3300006163 Bacteria 1371
39 Ga0070716_100018499 3300006173 Bacteria 3632
40 Ga0070712_100000528 3300006175 Bacteria 22081
41 Ga0070712_100050085 3300006175 Bacteria 2904
42 Ga0097621_100000267 3300006237 Bacteria 35345
43 Ga0097621_100008216 3300006237 Bacteria 7507
44 Ga0097621_100115090 3300006237 Bacteria 2276
45 Ga0068871_100002164 3300006358 Bacteria 13334
46 Ga0068871_100003594 3300006358 Bacteria 10654
47 Ga0068871_100005709 3300006358 Bacteria 8736
48 Ga0068871_100031940 3300006358 Bacteria 4154
49 Ga0068871_100079996 3300006358 Bacteria 2705
50 Ga0068871_100480233 3300006358 Bacteria 1118
51 Ga0075428_100040069 3300006844 Bacteria 5155
52 Ga0075430_100059850 3300006846 Bacteria 3201
53 Ga0075431_100045135 3300006847 Bacteria 4544
54 Ga0075434_100033117 3300006871 Bacteria 5099
55 Ga0075429_100045890 3300006880 Bacteria 3801
56 Ga0068865_100005263 3300006881 Bacteria 7824
57 Ga0075436_100000054 3300006914 Bacteria 68580
58 Ga0097620_100622417 3300006931 Bacteria 1172
59 Ga0075435_100059834 3300007076 Bacteria 3088
60 Ga0105240_10000055 3300009093 Bacteria 225380
61 Ga0105240_10029678 3300009093 Bacteria 7117
62 Ga0105240_10093873 3300009093 Bacteria 3661
63 Ga0111539_10004331 3300009094 Bacteria 18575
64 Ga0111539_10158633 3300009094 Bacteria 2647
65 Ga0111539_10424651 3300009094 Bacteria 1548
66 Ga0114129_10080440 3300009147 Bacteria 4529
67 Ga0105241_10010268 3300009174 Bacteria 6877
68 Ga0105241_10015241 3300009174 Bacteria 5629
69 Ga0105241_10074868 3300009174 Bacteria 2637
70 Ga0105241_10192385 3300009174 Bacteria 1699
71 Ga0105241_10300994 3300009174 Bacteria 1376
72 Ga0105242_10075479 3300009176 Bacteria 2807
73 Ga0105242_10176788 3300009176 Bacteria 1880
74 Ga0105242_10423633 3300009176 Bacteria 1248
75 Ga0105248_10151260 3300009177 Bacteria 2618
76 Ga0105248_10600522 3300009177 Bacteria 1242
77 Ga0105237_10013620 3300009545 Bacteria 8518
78 Ga0105237_10076913 3300009545 Bacteria 3327
79 Ga0105237_10203045 3300009545 Bacteria 1982
80 Ga0105238_10042693 3300009551 Bacteria 4591
81 Ga0105238_10056673 3300009551 Bacteria 3931
82 Ga0105249_10127696 3300009553 Bacteria 2423
83 Ga0105239_10003373 3300010375 Bacteria 19598
84 Ga0105239_10012800 3300010375 Bacteria 9333
85 Ga0105239_10029869 3300010375 Bacteria 5994
86 Ga0105239_10116855 3300010375 Bacteria 2960
87 Ga0157371_10180849 3300013102 Bacteria 1508
88 Ga0157370_10037455 3300013104 Bacteria 4701
89 Ga0157369_10004952 3300013105 Bacteria 15601
90 Ga0157369_10012565 3300013105 Bacteria 9606
91 Ga0157369_10359592 3300013105 Bacteria 1512
92 Ga0157374_10330936 3300013296 Bacteria 1511
93 Ga0157372_10048506 3300013307 Bacteria 4721
94 Ga0157372_10064258 3300013307 Bacteria 4118
95 Ga0157372_10160721 3300013307 Bacteria 2596
96 Ga0157375_10007944 3300013308 Bacteria 9288
97 Ga0157379_10000304 3300014968 Bacteria 38893
98 Ga0157379_10003277 3300014968 Bacteria 13713
99 Ga0157379_10047178 3300014968 Bacteria 3843
100 Ga0157379_10210254 3300014968 Bacteria 1761
101 Ga0157376_10012134 3300014969 Bacteria 6383
102 Ga0157376_10229636 3300014969 Bacteria 1723
103 Ga0157376_10388635 3300014969 Bacteria 1346
104 Ga0213872_10081819 3300021361 Bacteria 1450
105 Ga0213876_10000322 3300021384 Bacteria 41914
106 Ga0213876_10161752 3300021384 Bacteria 1191
107 Ga0209758_1000008 3300025297 Bacteria 1215263
108 Ga0207680_10010864 3300025903 Bacteria 4574
109 Ga0207685_10064476 3300025905 Bacteria 1463
110 Ga0207699_10007037 3300025906 Bacteria 5480
111 Ga0207699_10244801 3300025906 Bacteria 1234
112 Ga0207643_10040115 3300025908 Bacteria 2635
113 Ga0207705_10000039 3300025909 Bacteria 193592
114 Ga0207705_10004807 3300025909 Bacteria 10169
115 Ga0207705_10398455 3300025909 Bacteria 1064
116 Ga0207654_10016400 3300025911 Bacteria 3858
117 Ga0207654_10066821 3300025911 Bacteria 2122
118 Ga0207707_10000002 3300025912 Bacteria 1142054
119 Ga0207707_10045222 3300025912 Bacteria 3837
120 Ga0207695_10000012 3300025913 Bacteria 840961
121 Ga0207695_10021214 3300025913 Bacteria 7418
122 Ga0207695_10056927 3300025913 Bacteria 4065
123 Ga0207695_10066090 3300025913 Bacteria 3716
124 Ga0207695_10104727 3300025913 Bacteria 2817
125 Ga0207671_10049711 3300025914 Bacteria 3104
126 Ga0207693_10001101 3300025915 Bacteria 24280
127 Ga0207693_10118085 3300025915 Bacteria 2083
128 Ga0207660_10001154 3300025917 Bacteria 17638
129 Ga0207660_10108556 3300025917 Bacteria 2084
130 Ga0207657_10001376 3300025919 Bacteria 25943
131 Ga0207657_10132438 3300025919 Bacteria 2043
132 Ga0207652_10000197 3300025921 Bacteria 63525
133 Ga0207652_10106033 3300025921 Bacteria 2487
134 Ga0207652_10152077 3300025921 Bacteria 2073
135 Ga0207694_10000006 3300025924 Bacteria 631109
136 Ga0207694_10233105 3300025924 Bacteria 1504
137 Ga0207700_10000199 3300025928 Bacteria 35835
138 Ga0207664_10005455 3300025929 Bacteria 8697
139 Ga0207664_10031986 3300025929 Bacteria 4030
140 Ga0207686_10001631 3300025934 Bacteria 12536
141 Ga0207686_10005045 3300025934 Bacteria 7104
142 Ga0207686_10057844 3300025934 Bacteria 2442
143 Ga0207704_10003734 3300025938 Bacteria 6930
144 Ga0207665_10010411 3300025939 Bacteria 6108
145 Ga0207711_10012518 3300025941 Bacteria 7050
146 Ga0207711_10083611 3300025941 Bacteria 2792
147 Ga0207689_10087738 3300025942 Bacteria 2555
148 Ga0207667_10000026 3300025949 Bacteria 343713
149 Ga0207667_10076870 3300025949 Bacteria 3463
150 Ga0207667_10184057 3300025949 Bacteria 2145
151 Ga0207667_10357920 3300025949 Bacteria 1488
152 Ga0207712_10087745 3300025961 Bacteria 2282
153 Ga0207703_10009085 3300026035 Bacteria 7825
154 Ga0207703_10026856 3300026035 Bacteria 4534
155 Ga0207639_10002226 3300026041 Bacteria 13061
156 Ga0207702_10000030 3300026078 Bacteria 178718
157 Ga0207648_10017453 3300026089 Bacteria 6530
158 Ga0207676_10062505 3300026095 Bacteria 2954
159 Ga0207676_10081269 3300026095 Bacteria 2633
160 Ga0207674_10410342 3300026116 Bacteria 1309
161 Ga0207683_10004248 3300026121 Bacteria 12363
162 Ga0207698_10020614 3300026142 Bacteria 4541
163 Ga0207698_10315013 3300026142 Bacteria 1463
164 Ga0207428_10010133 3300027907 Bacteria 8429
165 Ga0268266_10001271 3300028379 Bacteria 30810
166 Ga0268266_10018413 3300028379 Bacteria 5951
167 Ga0268266_10023951 3300028379 Bacteria 5195
168 Ga0268266_10417342 3300028379 Bacteria 1271
169 Ga0268265_10079847 3300028380 Bacteria 2578
170 Ga0265337_1005006 3300028556 Bacteria 5372
171 Ga0265334_10000673 3300028573 Bacteria 17152
172 Ga0265318_10000388 3300028577 Bacteria 34328
173 Ga0265338_10000011 3300028800 Bacteria 433370
174 Ga0265338_10053861 3300028800 Bacteria 3594
175 Ga0265338_10054811 3300028800 Bacteria 3552
176 Ga0265338_10116885 3300028800 Bacteria 2135
177 Ga0265332_10023683 3300031238 Bacteria 2707
178 Ga0265332_10031076 3300031238 Bacteria 2330
179 Ga0265320_10000123 3300031240 Bacteria 67449
180 Ga0265325_10000002 3300031241 Bacteria 396758
181 Ga0265325_10000027 3300031241 Bacteria 106598
182 Ga0265325_10003234 3300031241 Bacteria 10725
183 Ga0265325_10012113 3300031241 Bacteria 4938
184 Ga0265340_10001015 3300031247 Bacteria 15989
185 Ga0265340_10024675 3300031247 Bacteria 3052
186 Ga0265339_10001651 3300031249 Bacteria 16451
187 Ga0265339_10002449 3300031249 Bacteria 13290
188 Ga0265339_10006481 3300031249 Bacteria 7675
189 Ga0265331_10000049 3300031250 Bacteria 182618
190 Ga0265331_10000303 3300031250 Bacteria 53811
191 Ga0265331_10001113 3300031250 Bacteria 20686
192 Ga0265331_10108658 3300031250 Bacteria 1273
193 Ga0265327_10000007 3300031251 Bacteria 678515
194 Ga0265316_10001218 3300031344 Bacteria 27729
195 Ga0265316_10021855 3300031344 Bacteria 5409
196 Ga0265316_10258948 3300031344 Bacteria 1276
197 Ga0265313_10000335 3300031595 Bacteria 51231
198 Ga0265313_10002380 3300031595 Bacteria 16332
199 Ga0265313_10030370 3300031595 Bacteria 2783
200 Ga0265313_10035577 3300031595 Bacteria 2507
201 Ga0265313_10086523 3300031595 Bacteria 1414
202 Ga0265314_10006838 3300031711 Bacteria 9992
203 Ga0265314_10068020 3300031711 Bacteria 2396
204 Ga0265314_10167057 3300031711 Bacteria 1332
205 Ga0265342_10005469 3300031712 Bacteria 9668
206 Ga0307516_10015652 3300031730 Bacteria 7973
207 Ga0307516_10032700 3300031730 Bacteria 5238
208 Ga0307516_10060168 3300031730 Bacteria 3691
209 Ga0373931_0023557 3300035691 Bacteria 3110
210 Ga0373931_0032643 3300035691 Bacteria 2695
211 Ga0373933_0207712 3300035724 Bacteria 1254
212 Ga0373937_0000338 3300036401 Bacteria 44355
213 Ga0373937_0028314 3300036401 Bacteria 5069
214 Ga0373937_0136946 3300036401 Bacteria 2290
215 Ga0436365_0618382 3300039437 Bacteria 4182
216 Ga0436363_0468218 3300039450 Bacteria 2878
217 Ga0436363_1184338 3300039450 Bacteria 22162
218 Ga0439441_034981 3300042001 Bacteria 988
219 Ga0466967_0220465 3300045976 Bacteria 1802
220 Ga0495654_0060887 3300046530 Bacteria 1814
221 Ga0495658_0063790 3300046683 Bacteria 2121
222 Ga0495624_0062346 3300046690 Bacteria 2333
223 Ga0495672_0003016 3300047320 Bacteria 14808
224 Ga0496107_0212188 3300048910 Bacteria 1440
225 Ga0496126_0001104 3300048929 Bacteria 45291
226 Ga0501032_0045954 3300049569 Bacteria 2952
227 Ga0501033_0028926 3300049570 Bacteria 4164
228 Ga0501033_0057077 3300049570 Bacteria 2886
229 Ga0501033_0139260 3300049570 Bacteria 1755
230 Ga0501034_0056365 3300049571 Bacteria 3954
231 Ga0501034_0183114 3300049571 Bacteria 2059
232 Ga0501036_0014554 3300049572 Bacteria 6550
233 Ga0501036_0189156 3300049572 Bacteria 1732
234 Ga0501036_0252466 3300049572 Bacteria 1478
235 Ga0501036_0293245 3300049572 Bacteria 1361
236 Ga0501037_0007669 3300049573 Bacteria 7898
237 Ga0501037_0223685 3300049573 Bacteria 1323
238 Ga0501037_0274489 3300049573 Bacteria 1176
239 Ga0501038_0015099 3300049574 Bacteria 7028
240 Ga0501038_0043065 3300049574 Bacteria 3928
241 Ga0501038_0061785 3300049574 Bacteria 3203
242 Ga0501038_0215671 3300049574 Bacteria 1533
243 Ga0501039_0018692 3300049575 Bacteria 5319
244 Ga0501039_0049833 3300049575 Bacteria 3239
245 Ga0501043_0026016 3300049579 Bacteria 4591
246 Ga0501043_0092184 3300049579 Bacteria 2382
247 Ga0501043_0416990 3300049579 Bacteria 1013
248 Ga0501046_0045826 3300049580 Bacteria 3471
249 Ga0501046_0070170 3300049580 Bacteria 2725
250 Ga0501047_0003568 3300049581 Bacteria 14687
251 Ga0501047_0036811 3300049581 Bacteria 4730
252 Ga0501047_0054946 3300049581 Bacteria 3851
253 Ga0501047_0088235 3300049581 Bacteria 2978
254 Ga0501047_0133864 3300049581 Bacteria 2359
255 Ga0501047_0231831 3300049581 Bacteria 1699
256 Ga0501048_0024593 3300049582 Bacteria 4395
257 Ga0501048_0078181 3300049582 Bacteria 2335
258 Ga0501067_0006462 3300049583 Bacteria 6497
259 Ga0501067_0095220 3300049583 Bacteria 1653
260 Ga0501068_0068097 3300049584 Bacteria 2170
261 Ga0501068_0148979 3300049584 Bacteria 1470
262 Ga0501069_0005609 3300049585 Bacteria 6529
263 Ga0501070_0000018 3300049586 Bacteria 172755
264 Ga0501070_0044975 3300049586 Bacteria 3672
265 Ga0501070_0045991 3300049586 Bacteria 3629
266 Ga0501070_0114696 3300049586 Bacteria 2226
267 Ga0501072_0031353 3300049588 Bacteria 4160
268 Ga0501072_0131012 3300049588 Bacteria 1999
269 Ga0501073_0051241 3300049589 Bacteria 2891
270 Ga0501073_0181284 3300049589 Bacteria 1457
271 Ga0501074_0028145 3300049590 Bacteria 4072
272 Ga0501074_0299351 3300049590 Bacteria 1142
273 Ga0501079_0009469 3300049741 Bacteria 7383
274 Ga0501079_0029462 3300049741 Bacteria 4214
275 Ga0501080_0001258 3300049742 Bacteria 21102
276 Ga0501080_0001754 3300049742 Bacteria 18597
277 Ga0501080_0134223 3300049742 Bacteria 2291
278 Ga0501080_0166510 3300049742 Bacteria 2033
279 Ga0501083_0044373 3300049744 Bacteria 3009
280 Ga0501083_0059666 3300049744 Bacteria 2551
281 Ga0501083_0132470 3300049744 Bacteria 1634
282 Ga0501035_0003074 3300049822 Bacteria 16014
283 Ga0501035_0078651 3300049822 Bacteria 2913
284 Ga0501035_0086439 3300049822 Bacteria 2763
285 Ga0501035_0192088 3300049822 Bacteria 1755
286 Ga0501044_0000644 3300049823 Bacteria 42176
287 Ga0501044_0002729 3300049823 Bacteria 20088
288 Ga0501044_0035468 3300049823 Bacteria 5223
289 Ga0501044_0185818 3300049823 Bacteria 2043
290 Ga0501045_0034096 3300049824 Bacteria 3694
291 nmdc:mga05p37_17193_c1 3300050507 Bacteria 8725
292 nmdc:mga09592_80050_c1 3300050508 Bacteria 2782
293 nmdc:mga0qj67_15205_c1 3300050509 Bacteria 5824
294 nmdc:mga06r32_72810_c1 3300050510 Bacteria 3327
295 nmdc:mga08y16_160487_c1 3300050511 Bacteria 2336
296 nmdc:mga08y16_2609_c1 3300050511 Bacteria 18511
297 nmdc:mga0n895_26558_c1 3300050512 Bacteria 5486
298 nmdc:mga0rr50_48811_c1 3300050513 Bacteria 3131
299 nmdc:mga08x19_249_c1 3300050514 Bacteria 40899
300 Ga0500595_000852 3300053119 Bacteria 17399
301 Ga0500595_015574 3300053119 Bacteria 2852
302 Ga0500559_0027670 3300053136 Bacteria 2420
303 Ga0500573_0000032 3300053140 Bacteria 131098
304 Ga0500639_066791 3300053163 Bacteria 1842
305 Ga0501084_0001862 3300054114 Bacteria 16810
306 Ga0501084_0058918 3300054114 Bacteria 3214
307 Ga0501084_0386451 3300054114 Bacteria 1183
308 Ga0501082_0060435 3300060353 Bacteria 3263
309 Ga0501082_0101660 3300060353 Bacteria 2487
310 Ga0501082_0144395 3300060353 Bacteria 2065
311 2883578320 2883577096 Bacteria 4709178
312 Ga0265331_10027517
313 JGI25153J46596_10000812
314 rootH2_10006890
315 Ga0070690_100081777
316 Ga0070680_100000332
317 Ga0068868_100098636
318 Ga0070671_100421082
319 Ga0070709_10092233
320 Ga0070714_100003461
321 Ga0070714_100041533
322 Ga0070713_100000006
323 Ga0070713_100083878
324 Ga0070711_100077287
325 Ga0070678_100059713
326 Ga0070681_10000123
327 Ga0068867_100008764
328 Ga0070685_10014107
329 Ga0070699_100545560
330 Ga0070679_100000490
331 Ga0070679_100068194
332 Ga0070665_100043121
333 Ga0070665_100043691
334 Ga0070665_100060645
335 Ga0070665_100337983
336 Ga0068855_100000529
337 Ga0068855_100107220
338 Ga0068855_100107743
339 Ga0068856_100000280
340 Ga0068852_100085023
341 Ga0068852_100124144
342 Ga0068859_100622302
343 Ga0068864_100530568
344 Ga0068858_100008268
345 Ga0068858_100017472
346 Ga0068860_100044968
347 Ga0068860_100090247
348 Ga0068862_100082008
349 Ga0070715_10096392
350 Ga0070716_100018499
351 Ga0070712_100000528
352 Ga0070712_100050085
353 Ga0097621_100000267
354 Ga0097621_100008216
355 Ga0097621_100115090
356 Ga0068871_100002164
357 Ga0068871_100003594
358 Ga0068871_100005709
359 Ga0068871_100031940
360 Ga0068871_100079996
361 Ga0068871_100480233
362 Ga0075428_100040069
363 Ga0075430_100059850
364 Ga0075431_100045135
365 Ga0075434_100033117
366 Ga0075429_100045890
367 Ga0068865_100005263
368 Ga0075436_100000054
369 Ga0097620_100622417
370 Ga0075435_100059834
371 Ga0105240_10000055
372 Ga0105240_10029678
373 Ga0105240_10093873
374 Ga0111539_10004331
375 Ga0111539_10158633
376 Ga0111539_10424651
377 Ga0114129_10080440
378 Ga0105241_10010268
379 Ga0105241_10015241
380 Ga0105241_10074868
381 Ga0105241_10192385
382 Ga0105241_10300994
383 Ga0105242_10075479
384 Ga0105242_10176788
385 Ga0105242_10423633
386 Ga0105248_10151260
387 Ga0105248_10600522
388 Ga0105237_10013620
389 Ga0105237_10076913
390 Ga0105237_10203045
391 Ga0105238_10042693
392 Ga0105238_10056673
393 Ga0105249_10127696
394 Ga0105239_10003373
395 Ga0105239_10012800
396 Ga0105239_10029869
397 Ga0105239_10116855
398 Ga0157371_10180849
399 Ga0157370_10037455
400 Ga0157369_10004952
401 Ga0157369_10012565
402 Ga0157369_10359592
403 Ga0157374_10330936
404 Ga0157372_10048506
405 Ga0157372_10064258
406 Ga0157372_10160721
407 Ga0157375_10007944
408 Ga0157379_10000304
409 Ga0157379_10003277
410 Ga0157379_10047178
411 Ga0157379_10210254
412 Ga0157376_10012134
413 Ga0157376_10229636
414 Ga0157376_10388635
415 Ga0213872_10081819
416 Ga0213876_10000322
417 Ga0213876_10161752
418 Ga0209758_1000008
419 Ga0207680_10010864
420 Ga0207685_10064476
421 Ga0207699_10007037
422 Ga0207699_10244801
423 Ga0207643_10040115
424 Ga0207705_10000039
425 Ga0207705_10004807
426 Ga0207705_10398455
427 Ga0207654_10016400
428 Ga0207654_10066821
429 Ga0207707_10000002
430 Ga0207707_10045222
431 Ga0207695_10000012
432 Ga0207695_10021214
433 Ga0207695_10056927
434 Ga0207695_10066090
435 Ga0207695_10104727
436 Ga0207671_10049711
437 Ga0207693_10001101
438 Ga0207693_10118085
439 Ga0207660_10001154
440 Ga0207660_10108556
441 Ga0207657_10001376
442 Ga0207657_10132438
443 Ga0207652_10000197
444 Ga0207652_10106033
445 Ga0207652_10152077
446 Ga0207694_10000006
447 Ga0207694_10233105
448 Ga0207700_10000199
449 Ga0207664_10005455
450 Ga0207664_10031986
451 Ga0207686_10001631
452 Ga0207686_10005045
453 Ga0207686_10057844
454 Ga0207704_10003734
455 Ga0207665_10010411
456 Ga0207711_10012518
457 Ga0207711_10083611
458 Ga0207689_10087738
459 Ga0207667_10000026
460 Ga0207667_10076870
461 Ga0207667_10184057
462 Ga0207667_10357920
463 Ga0207712_10087745
464 Ga0207703_10009085
465 Ga0207703_10026856
466 Ga0207639_10002226
467 Ga0207702_10000030
468 Ga0207648_10017453
469 Ga0207676_10062505
470 Ga0207676_10081269
471 Ga0207674_10410342
472 Ga0207683_10004248
473 Ga0207698_10020614
474 Ga0207698_10315013
475 Ga0207428_10010133
476 Ga0268266_10001271
477 Ga0268266_10018413
478 Ga0268266_10023951
479 Ga0268266_10417342
480 Ga0268265_10079847
481 Ga0265337_1005006
482 Ga0265334_10000673
483 Ga0265318_10000388
484 Ga0265338_10000011
485 Ga0265338_10053861
486 Ga0265338_10054811
487 Ga0265338_10116885
488 Ga0265332_10023683
489 Ga0265332_10031076
490 Ga0265320_10000123
491 Ga0265325_10000002
492 Ga0265325_10000027
493 Ga0265325_10003234
494 Ga0265325_10012113
495 Ga0265340_10001015
496 Ga0265340_10024675
497 Ga0265339_10001651
498 Ga0265339_10002449
499 Ga0265339_10006481
500 Ga0265331_10000049
501 Ga0265331_10000303
502 Ga0265331_10001113
503 Ga0265331_10108658
504 Ga0265327_10000007
505 Ga0265316_10001218
506 Ga0265316_10021855
507 Ga0265316_10258948
508 Ga0265313_10000335
509 Ga0265313_10002380
510 Ga0265313_10030370
511 Ga0265313_10035577
512 Ga0265313_10086523
513 Ga0265314_10006838
514 Ga0265314_10068020
515 Ga0265314_10167057
516 Ga0265342_10005469
517 Ga0307516_10015652
518 Ga0307516_10032700
519 Ga0307516_10060168
520 Ga0373931_0023557
521 Ga0373931_0032643
522 Ga0373933_0207712
523 Ga0373937_0000338
524 Ga0373937_0028314
525 Ga0373937_0136946
526 Ga0436365_0618382
527 Ga0436363_0468218
528 Ga0436363_1184338
529 Ga0439441_034981
530 Ga0466967_0220465
531 Ga0495654_0060887
532 Ga0495658_0063790
533 Ga0495624_0062346
534 Ga0495672_0003016
535 Ga0496107_0212188
536 Ga0496126_0001104
537 Ga0501032_0045954
538 Ga0501033_0028926
539 Ga0501033_0057077
540 Ga0501033_0139260
541 Ga0501034_0056365
542 Ga0501034_0183114
543 Ga0501036_0014554
544 Ga0501036_0189156
545 Ga0501036_0252466
546 Ga0501036_0293245
547 Ga0501037_0007669
548 Ga0501037_0223685
549 Ga0501037_0274489
550 Ga0501038_0015099
551 Ga0501038_0043065
552 Ga0501038_0061785
553 Ga0501038_0215671
554 Ga0501039_0018692
555 Ga0501039_0049833
556 Ga0501043_0026016
557 Ga0501043_0092184
558 Ga0501043_0416990
559 Ga0501046_0045826
560 Ga0501046_0070170
561 Ga0501047_0003568
562 Ga0501047_0036811
563 Ga0501047_0054946
564 Ga0501047_0088235
565 Ga0501047_0133864
566 Ga0501047_0231831
567 Ga0501048_0024593
568 Ga0501048_0078181
569 Ga0501067_0006462
570 Ga0501067_0095220
571 Ga0501068_0068097
572 Ga0501068_0148979
573 Ga0501069_0005609
574 Ga0501070_0000018
575 Ga0501070_0044975
576 Ga0501070_0045991
577 Ga0501070_0114696
578 Ga0501072_0031353
579 Ga0501072_0131012
580 Ga0501073_0051241
581 Ga0501073_0181284
582 Ga0501074_0028145
583 Ga0501074_0299351
584 Ga0501079_0009469
585 Ga0501079_0029462
586 Ga0501080_0001258
587 Ga0501080_0001754
588 Ga0501080_0134223
589 Ga0501080_0166510
590 Ga0501083_0044373
591 Ga0501083_0059666
592 Ga0501083_0132470
593 Ga0501035_0003074
594 Ga0501035_0078651
595 Ga0501035_0086439
596 Ga0501035_0192088
597 Ga0501044_0000644
598 Ga0501044_0002729
599 Ga0501044_0035468
600 Ga0501044_0185818
601 Ga0501045_0034096
602 nmdc:mga05p37_17193_c1
603 nmdc:mga09592_80050_c1
604 nmdc:mga0qj67_15205_c1
605 nmdc:mga06r32_72810_c1
606 nmdc:mga08y16_160487_c1
607 nmdc:mga08y16_2609_c1
608 nmdc:mga0n895_26558_c1
609 nmdc:mga0rr50_48811_c1
610 nmdc:mga08x19_249_c1
611 Ga0500595_000852
612 Ga0500595_015574
613 Ga0500559_0027670
614 Ga0500573_0000032
615 Ga0500639_066791
616 Ga0501084_0001862
617 Ga0501084_0058918
618 Ga0501084_0386451
619 Ga0501082_0060435
620 Ga0501082_0101660
621 Ga0501082_0144395
622 2883578320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

3

181

0.94

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

204

309

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9374 2 306
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9315 2 306
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9284 1 306
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9255 1 306
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9227 3 305
ID Description Score Start End Superfamily
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.97 2 207 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.965 2 207 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.953 3 207 3.40.50.170
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9403 1 207 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9349 3 207 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A2V7K666-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9829 3 127 GO:0004479
GO:0005829
AF-A0A7U9WVT5-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9794 3 120 GO:0004479
GO:0005829
AF-A0A258BH43-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9769 1 130 GO:0004479
GO:0005829
AF-D8FIG2-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9764 3 207 GO:0004479
GO:0005829
AF-A0A2V7GRZ1-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9724 3 250 GO:0004479
GO:0005829

Map