F401258
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 311 | 181 | 303 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300026078|Ga0207702_10834709|Ga0207702_108347091 |
| Length | 278 |
| Sequence | VRAVTAVGDGRGALRVSLVQGATRWLDLGGNRDYYAALIAPLRGQTDLVLLPETFTSGFSNEAIHQAETMDGATVAWLRDQARALDAAVTGSVQLRAGDGAGARVYNRLLFATPDGTIRHYDKRHLFRYAREHERYAAGGERVVVDWRGWRICPLVCYDLRFPVFVRNRYHGDAARFDYDLVLFVANWPSARRHAWRTLLRARAIENLTYCAGLNRVGVDGNDLHYAGDSAVIDFLGEPLVELGAQEQVVTTRLDAAALAAHRERFPAWMDADAFELR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 2 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 3 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 4 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 5 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 6 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 66 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 113 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 116 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 119 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 120 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 122 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 123 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 124 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 125 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 126 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 127 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 128 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 129 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 130 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 131 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 132 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 133 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 146 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 147 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 148 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 149 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 152 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 177 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 178 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 179 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 181 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.43 |
| Metatranscriptomes | 0 |
| Isolates | 2.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.36 |
| Nodule | 0 |
| Rhizoplane | 3.22 |
| Rhizosphere | 77.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000774 | 3300003187 | Bacteria | 25902 |
| 2 | JGI25151J46595_10014047 | 3300003187 | Bacteria | 3583 |
| 3 | Ga0055526_1000071 | 3300003771 | Bacteria | 96766 |
| 4 | Ga0055526_1017541 | 3300003771 | Bacteria | 2728 |
| 5 | Ga0055537_1000376 | 3300003773 | Bacteria | 30050 |
| 6 | Ga0055524_1000041 | 3300003775 | Bacteria | 156728 |
| 7 | Ga0055524_1007439 | 3300003775 | Bacteria | 4646 |
| 8 | Ga0055536_1001543 | 3300003781 | Bacteria | 13829 |
| 9 | Ga0055536_1022028 | 3300003781 | Bacteria | 1913 |
| 10 | Ga0055534_1000040 | 3300003784 | Bacteria | 104019 |
| 11 | Ga0055528_1000017 | 3300003790 | Bacteria | 156728 |
| 12 | Ga0055530_10008977 | 3300003791 | Bacteria | 3912 |
| 13 | Ga0055531_10003012 | 3300003794 | Bacteria | 10935 |
| 14 | Ga0055531_10004233 | 3300003794 | Bacteria | 8828 |
| 15 | Ga0055531_10026160 | 3300003794 | Bacteria | 2091 |
| 16 | Ga0055531_10033025 | 3300003794 | Bacteria | 1676 |
| 17 | Ga0055531_10033308 | 3300003794 | Bacteria | 1662 |
| 18 | Ga0055531_10057561 | 3300003794 | Bacteria | 973 |
| 19 | Ga0065714_10017937 | 3300005288 | Bacteria | 2020 |
| 20 | Ga0065715_10107973 | 3300005293 | Bacteria | 2743 |
| 21 | Ga0065715_10132133 | 3300005293 | Bacteria | 1990 |
| 22 | Ga0070658_10115895 | 3300005327 | Bacteria | 2223 |
| 23 | Ga0068869_100037648 | 3300005334 | Bacteria | 3441 |
| 24 | Ga0068869_100212415 | 3300005334 | Bacteria | 1530 |
| 25 | Ga0070666_10000643 | 3300005335 | Bacteria | 21062 |
| 26 | Ga0070666_10006812 | 3300005335 | Bacteria | 7040 |
| 27 | Ga0070682_100279547 | 3300005337 | Bacteria | 1216 |
| 28 | Ga0070660_100536108 | 3300005339 | Bacteria | 976 |
| 29 | Ga0070661_100001611 | 3300005344 | Bacteria | 15612 |
| 30 | Ga0070661_100016345 | 3300005344 | Bacteria | 5244 |
| 31 | Ga0070661_100186137 | 3300005344 | Bacteria | 1582 |
| 32 | Ga0070671_100029011 | 3300005355 | Bacteria | 4561 |
| 33 | Ga0070659_100233103 | 3300005366 | Bacteria | 1521 |
| 34 | Ga0070659_100327765 | 3300005366 | Bacteria | 1281 |
| 35 | Ga0070667_100071346 | 3300005367 | Bacteria | 2958 |
| 36 | Ga0070667_100120315 | 3300005367 | Bacteria | 2283 |
| 37 | Ga0070679_100014507 | 3300005530 | Bacteria | 7569 |
| 38 | Ga0070679_100084989 | 3300005530 | Bacteria | 3151 |
| 39 | Ga0070679_100304560 | 3300005530 | Bacteria | 1544 |
| 40 | Ga0068853_100010874 | 3300005539 | Bacteria | 7374 |
| 41 | Ga0068853_100071311 | 3300005539 | Bacteria | 3025 |
| 42 | Ga0068853_100415387 | 3300005539 | Bacteria | 1261 |
| 43 | Ga0070672_100036187 | 3300005543 | Bacteria | 3759 |
| 44 | Ga0070672_100047734 | 3300005543 | Bacteria | 3324 |
| 45 | Ga0070696_100273988 | 3300005546 | Bacteria | 1284 |
| 46 | Ga0068855_100004858 | 3300005563 | Bacteria | 16409 |
| 47 | Ga0068855_100012573 | 3300005563 | Bacteria | 10217 |
| 48 | Ga0068854_100014016 | 3300005578 | Bacteria | 5275 |
| 49 | Ga0068854_100041884 | 3300005578 | Bacteria | 3238 |
| 50 | Ga0068854_100367895 | 3300005578 | Bacteria | 1181 |
| 51 | Ga0068856_100010785 | 3300005614 | Bacteria | 8875 |
| 52 | Ga0068856_100753937 | 3300005614 | Bacteria | 993 |
| 53 | Ga0068852_100016190 | 3300005616 | Bacteria | 5806 |
| 54 | Ga0068852_100599054 | 3300005616 | Bacteria | 1106 |
| 55 | Ga0068859_100087241 | 3300005617 | Bacteria | 3168 |
| 56 | Ga0068859_100199736 | 3300005617 | Bacteria | 2084 |
| 57 | Ga0068864_100017999 | 3300005618 | Bacteria | 5896 |
| 58 | Ga0068866_10080735 | 3300005718 | Bacteria | 1745 |
| 59 | Ga0068863_100000773 | 3300005841 | Bacteria | 32109 |
| 60 | Ga0068863_100083687 | 3300005841 | Bacteria | 3023 |
| 61 | Ga0068858_100423689 | 3300005842 | Bacteria | 1280 |
| 62 | Ga0068860_100020581 | 3300005843 | Bacteria | 6391 |
| 63 | Ga0068860_100027833 | 3300005843 | Bacteria | 5444 |
| 64 | Ga0075364_10270179 | 3300006051 | Bacteria | 1156 |
| 65 | Ga0068871_100172714 | 3300006358 | Bacteria | 1854 |
| 66 | Ga0068865_100017242 | 3300006881 | Bacteria | 4641 |
| 67 | Ga0097620_100087241 | 3300006931 | Bacteria | 3168 |
| 68 | Ga0097620_100199742 | 3300006931 | Bacteria | 2084 |
| 69 | Ga0105240_10096470 | 3300009093 | Bacteria | 3603 |
| 70 | Ga0105240_10186505 | 3300009093 | Bacteria | 2443 |
| 71 | Ga0105240_10209705 | 3300009093 | Bacteria | 2278 |
| 72 | Ga0105241_10003106 | 3300009174 | Bacteria | 12356 |
| 73 | Ga0105241_10012367 | 3300009174 | Bacteria | 6257 |
| 74 | Ga0105241_10072803 | 3300009174 | Bacteria | 2672 |
| 75 | Ga0105242_10012457 | 3300009176 | Bacteria | 6549 |
| 76 | Ga0105248_10389457 | 3300009177 | Bacteria | 1569 |
| 77 | Ga0105237_10002972 | 3300009545 | Bacteria | 20494 |
| 78 | Ga0105237_10366938 | 3300009545 | Bacteria | 1445 |
| 79 | Ga0105238_10010010 | 3300009551 | Bacteria | 9512 |
| 80 | Ga0105238_10182572 | 3300009551 | Bacteria | 2075 |
| 81 | Ga0105249_10036904 | 3300009553 | Bacteria | 4434 |
| 82 | Ga0105249_10312277 | 3300009553 | Bacteria | 1581 |
| 83 | Ga0105239_10011101 | 3300010375 | Bacteria | 10053 |
| 84 | Ga0105239_10019741 | 3300010375 | Bacteria | 7439 |
| 85 | Ga0105239_10044717 | 3300010375 | Bacteria | 4853 |
| 86 | Ga0105239_10228018 | 3300010375 | Bacteria | 2090 |
| 87 | Ga0105246_10013661 | 3300011119 | Bacteria | 5095 |
| 88 | Ga0105246_10134381 | 3300011119 | Bacteria | 1852 |
| 89 | Ga0157318_1002678 | 3300012482 | Bacteria | 987 |
| 90 | Ga0157370_10065744 | 3300013104 | Bacteria | 3430 |
| 91 | Ga0157370_10143335 | 3300013104 | Bacteria | 2225 |
| 92 | Ga0157370_10385603 | 3300013104 | Bacteria | 1290 |
| 93 | Ga0157369_10000028 | 3300013105 | Bacteria | 213910 |
| 94 | Ga0157369_10033433 | 3300013105 | Bacteria | 5651 |
| 95 | Ga0157369_10036296 | 3300013105 | Bacteria | 5401 |
| 96 | Ga0157369_10250508 | 3300013105 | Bacteria | 1848 |
| 97 | Ga0157369_10251179 | 3300013105 | Bacteria | 1846 |
| 98 | Ga0157374_10250699 | 3300013296 | Bacteria | 1742 |
| 99 | Ga0157378_10000742 | 3300013297 | Bacteria | 30520 |
| 100 | Ga0157378_10070937 | 3300013297 | Bacteria | 3128 |
| 101 | Ga0163162_10336833 | 3300013306 | Bacteria | 1641 |
| 102 | Ga0157372_10000445 | 3300013307 | Bacteria | 45478 |
| 103 | Ga0157372_10001622 | 3300013307 | Bacteria | 24395 |
| 104 | Ga0157372_10007949 | 3300013307 | Bacteria | 11273 |
| 105 | Ga0157372_10077499 | 3300013307 | Bacteria | 3754 |
| 106 | Ga0157372_10148079 | 3300013307 | Bacteria | 2708 |
| 107 | Ga0157375_10007115 | 3300013308 | Bacteria | 9774 |
| 108 | Ga0157375_10027396 | 3300013308 | Bacteria | 5326 |
| 109 | Ga0157375_10053416 | 3300013308 | Bacteria | 3975 |
| 110 | Ga0163163_10000863 | 3300014325 | Bacteria | 25845 |
| 111 | Ga0163163_10013489 | 3300014325 | Bacteria | 7486 |
| 112 | Ga0157379_10004344 | 3300014968 | Bacteria | 12122 |
| 113 | Ga0157376_10007777 | 3300014969 | Bacteria | 7684 |
| 114 | Ga0157376_10023869 | 3300014969 | Bacteria | 4795 |
| 115 | Ga0157376_10078336 | 3300014969 | Bacteria | 2830 |
| 116 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 117 | Ga0207425_1003211 | 3300025245 | Bacteria | 5341 |
| 118 | Ga0209673_1030054 | 3300025273 | Bacteria | 1718 |
| 119 | Ga0209130_1013549 | 3300025284 | Bacteria | 2083 |
| 120 | Ga0209675_1015497 | 3300025291 | Bacteria | 2260 |
| 121 | Ga0209675_1019894 | 3300025291 | Bacteria | 1834 |
| 122 | Ga0209676_1000700 | 3300025292 | Bacteria | 46962 |
| 123 | Ga0209676_1002544 | 3300025292 | Bacteria | 12688 |
| 124 | Ga0209676_1003692 | 3300025292 | Bacteria | 9147 |
| 125 | Ga0209676_1007721 | 3300025292 | Bacteria | 4967 |
| 126 | Ga0209676_1008903 | 3300025292 | Bacteria | 4410 |
| 127 | Ga0209676_1019170 | 3300025292 | Bacteria | 2362 |
| 128 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 129 | Ga0209025_1003524 | 3300025294 | Bacteria | 14690 |
| 130 | Ga0209025_1004601 | 3300025294 | Bacteria | 11811 |
| 131 | Ga0209564_1024564 | 3300025295 | Bacteria | 2055 |
| 132 | Ga0209564_1040682 | 3300025295 | Bacteria | 1259 |
| 133 | Ga0209758_1013511 | 3300025297 | Bacteria | 4443 |
| 134 | Ga0209758_1035672 | 3300025297 | Bacteria | 1956 |
| 135 | Ga0209758_1047779 | 3300025297 | Bacteria | 1528 |
| 136 | Ga0209050_1004106 | 3300025298 | Bacteria | 10168 |
| 137 | Ga0209050_1045692 | 3300025298 | Bacteria | 1158 |
| 138 | Ga0209256_1004239 | 3300025299 | Bacteria | 9189 |
| 139 | Ga0209256_1005189 | 3300025299 | Bacteria | 7655 |
| 140 | Ga0209256_1011181 | 3300025299 | Bacteria | 3627 |
| 141 | Ga0209051_1016757 | 3300025303 | Bacteria | 3298 |
| 142 | Ga0209257_1000570 | 3300025304 | Bacteria | 62283 |
| 143 | Ga0209257_1000615 | 3300025304 | Bacteria | 58010 |
| 144 | Ga0209257_1003026 | 3300025304 | Bacteria | 15212 |
| 145 | Ga0209257_1003530 | 3300025304 | Bacteria | 13299 |
| 146 | Ga0209257_1020074 | 3300025304 | Bacteria | 2486 |
| 147 | Ga0209257_1026596 | 3300025304 | Bacteria | 1945 |
| 148 | Ga0207680_10001160 | 3300025903 | Bacteria | 12418 |
| 149 | Ga0207647_10005182 | 3300025904 | Bacteria | 9592 |
| 150 | Ga0207647_10304572 | 3300025904 | Bacteria | 907 |
| 151 | Ga0207654_10061694 | 3300025911 | Bacteria | 2194 |
| 152 | Ga0207707_10000699 | 3300025912 | Bacteria | 33304 |
| 153 | Ga0207695_10000094 | 3300025913 | Bacteria | 265779 |
| 154 | Ga0207695_10119865 | 3300025913 | Bacteria | 2601 |
| 155 | Ga0207671_10001138 | 3300025914 | Bacteria | 31946 |
| 156 | Ga0207671_10007824 | 3300025914 | Bacteria | 9191 |
| 157 | Ga0207671_10140133 | 3300025914 | Bacteria | 1863 |
| 158 | Ga0207660_10050763 | 3300025917 | Bacteria | 2946 |
| 159 | Ga0207657_10003945 | 3300025919 | Bacteria | 15757 |
| 160 | Ga0207657_10005275 | 3300025919 | Bacteria | 13543 |
| 161 | Ga0207657_10054008 | 3300025919 | Bacteria | 3477 |
| 162 | Ga0207657_10329171 | 3300025919 | Bacteria | 1207 |
| 163 | Ga0207649_10001479 | 3300025920 | Bacteria | 13790 |
| 164 | Ga0207649_10103171 | 3300025920 | Bacteria | 1892 |
| 165 | Ga0207652_10096250 | 3300025921 | Bacteria | 2608 |
| 166 | Ga0207652_10192384 | 3300025921 | Bacteria | 1835 |
| 167 | Ga0207681_10065078 | 3300025923 | Bacteria | 2519 |
| 168 | Ga0207694_10010172 | 3300025924 | Bacteria | 7089 |
| 169 | Ga0207659_10214991 | 3300025926 | Bacteria | 1543 |
| 170 | Ga0207644_10235718 | 3300025931 | Bacteria | 1455 |
| 171 | Ga0207690_10127698 | 3300025932 | Bacteria | 1856 |
| 172 | Ga0207691_10000928 | 3300025940 | Bacteria | 29105 |
| 173 | Ga0207691_10062331 | 3300025940 | Bacteria | 3384 |
| 174 | Ga0207689_10024419 | 3300025942 | Bacteria | 5072 |
| 175 | Ga0207661_10086656 | 3300025944 | Bacteria | 2599 |
| 176 | Ga0207667_10007474 | 3300025949 | Bacteria | 13129 |
| 177 | Ga0207667_10092266 | 3300025949 | Bacteria | 3128 |
| 178 | Ga0207667_10195924 | 3300025949 | Bacteria | 2073 |
| 179 | Ga0207712_10030014 | 3300025961 | Bacteria | 3653 |
| 180 | Ga0207668_10360897 | 3300025972 | Bacteria | 1217 |
| 181 | Ga0207703_10114740 | 3300026035 | Bacteria | 2304 |
| 182 | Ga0207639_10001512 | 3300026041 | Bacteria | 15628 |
| 183 | Ga0207639_10499142 | 3300026041 | Bacteria | 1111 |
| 184 | Ga0207678_10025756 | 3300026067 | Bacteria | 5133 |
| 185 | Ga0207702_10011594 | 3300026078 | Bacteria | 7345 |
| 186 | Ga0207702_10834709 | 3300026078 | Bacteria | 912 |
| 187 | Ga0207641_10075285 | 3300026088 | Bacteria | 2915 |
| 188 | Ga0207641_10077854 | 3300026088 | Bacteria | 2870 |
| 189 | Ga0207676_10182799 | 3300026095 | Bacteria | 1837 |
| 190 | Ga0207674_10002112 | 3300026116 | Bacteria | 25126 |
| 191 | Ga0207683_10521991 | 3300026121 | Bacteria | 1097 |
| 192 | Ga0207698_10026723 | 3300026142 | Bacteria | 4086 |
| 193 | Ga0207698_10549420 | 3300026142 | Bacteria | 1132 |
| 194 | Ga0209981_1001761 | 3300027378 | Bacteria | 2738 |
| 195 | Ga0209983_1018359 | 3300027665 | Bacteria | 1452 |
| 196 | Ga0209974_10007408 | 3300027876 | Bacteria | 3782 |
| 197 | Ga0268264_10018138 | 3300028381 | Bacteria | 5755 |
| 198 | Ga0314311_1257047 | 3300030733 | Bacteria | 1480 |
| 199 | Ga0307513_10024140 | 3300031456 | Bacteria | 7080 |
| 200 | Ga0307405_10170446 | 3300031731 | Bacteria | 1552 |
| 201 | Ga0307413_10003090 | 3300031824 | Bacteria | 6922 |
| 202 | Ga0307406_10033911 | 3300031901 | Bacteria | 3128 |
| 203 | Ga0307412_10563690 | 3300031911 | Bacteria | 959 |
| 204 | Ga0307414_10002154 | 3300032004 | Bacteria | 10273 |
| 205 | Ga0307414_10003875 | 3300032004 | Bacteria | 8055 |
| 206 | Ga0307414_10215815 | 3300032004 | Bacteria | 1571 |
| 207 | Ga0307414_10407455 | 3300032004 | Bacteria | 1182 |
| 208 | Ga0307414_10438763 | 3300032004 | Bacteria | 1142 |
| 209 | Ga0307411_10054578 | 3300032005 | Bacteria | 2624 |
| 210 | Ga0373924_0107207 | 3300035410 | Bacteria | 1205 |
| 211 | Ga0373933_0160098 | 3300035724 | Bacteria | 1429 |
| 212 | Ga0395900_0112456 | 3300037418 | Bacteria | 2796 |
| 213 | Ga0395900_0195915 | 3300037418 | Bacteria | 2047 |
| 214 | Ga0395905_0109833 | 3300037471 | Bacteria | 2589 |
| 215 | Ga0395905_0153241 | 3300037471 | Bacteria | 2168 |
| 216 | Ga0395905_0182149 | 3300037471 | Bacteria | 1972 |
| 217 | Ga0395901_0013851 | 3300038443 | Bacteria | 8204 |
| 218 | Ga0436365_1878631 | 3300039437 | Bacteria | 1562 |
| 219 | Ga0439436_0015465 | 3300041404 | Bacteria | 2296 |
| 220 | Ga0439436_0036104 | 3300041404 | Bacteria | 1426 |
| 221 | Ga0439439_0007082 | 3300041406 | Bacteria | 2614 |
| 222 | Ga0439447_003418 | 3300041407 | Bacteria | 5645 |
| 223 | Ga0451797_0268753 | 3300041453 | Bacteria | 1905 |
| 224 | Ga0439449_0000868 | 3300042007 | Bacteria | 11796 |
| 225 | Ga0439449_0027167 | 3300042007 | Bacteria | 2136 |
| 226 | Ga0439449_0103892 | 3300042007 | Bacteria | 1051 |
| 227 | Ga0439457_052547 | 3300042014 | Bacteria | 916 |
| 228 | Ga0439462_0029848 | 3300042015 | Bacteria | 1442 |
| 229 | Ga0495639_0213119 | 3300046475 | Bacteria | 948 |
| 230 | Ga0495663_0002289 | 3300046525 | Bacteria | 5800 |
| 231 | Ga0495663_0085679 | 3300046525 | Bacteria | 1021 |
| 232 | Ga0495621_0036238 | 3300046539 | Bacteria | 1712 |
| 233 | Ga0495621_0078773 | 3300046539 | Bacteria | 1226 |
| 234 | Ga0495656_0003858 | 3300046615 | Bacteria | 5099 |
| 235 | Ga0495656_0085157 | 3300046615 | Bacteria | 1435 |
| 236 | Ga0495668_0032132 | 3300046616 | Bacteria | 2955 |
| 237 | Ga0495668_0034812 | 3300046616 | Bacteria | 2824 |
| 238 | Ga0495659_0129000 | 3300046664 | Bacteria | 1002 |
| 239 | Ga0495647_0035116 | 3300046681 | Bacteria | 1881 |
| 240 | Ga0495658_0020445 | 3300046683 | Bacteria | 3473 |
| 241 | Ga0495604_0240819 | 3300047317 | Bacteria | 1237 |
| 242 | Ga0495636_0000021 | 3300047318 | Bacteria | 72964 |
| 243 | Ga0495636_0008386 | 3300047318 | Bacteria | 4079 |
| 244 | Ga0495636_0017667 | 3300047318 | Bacteria | 2856 |
| 245 | Ga0495677_0067744 | 3300047445 | Bacteria | 1328 |
| 246 | Ga0496101_0033138 | 3300048904 | Bacteria | 3642 |
| 247 | Ga0496101_0061834 | 3300048904 | Bacteria | 2721 |
| 248 | Ga0496104_0000020 | 3300048907 | Bacteria | 247296 |
| 249 | Ga0496105_0000015 | 3300048908 | Bacteria | 218758 |
| 250 | Ga0496106_0054476 | 3300048909 | Bacteria | 3022 |
| 251 | Ga0496107_0221489 | 3300048910 | Bacteria | 1408 |
| 252 | Ga0496108_0053148 | 3300048911 | Bacteria | 3396 |
| 253 | Ga0496112_0182305 | 3300048915 | Bacteria | 2063 |
| 254 | Ga0496112_0276290 | 3300048915 | Bacteria | 1627 |
| 255 | Ga0496121_0001610 | 3300048924 | Bacteria | 37474 |
| 256 | Ga0501031_0009879 | 3300049568 | Bacteria | 6212 |
| 257 | Ga0501031_0042227 | 3300049568 | Bacteria | 2977 |
| 258 | Ga0501032_0004309 | 3300049569 | Bacteria | 10746 |
| 259 | Ga0501032_0008307 | 3300049569 | Bacteria | 7565 |
| 260 | Ga0501033_0000329 | 3300049570 | Bacteria | 45324 |
| 261 | Ga0501034_0000498 | 3300049571 | Bacteria | 63644 |
| 262 | Ga0501034_0019091 | 3300049571 | Bacteria | 7019 |
| 263 | Ga0501034_0049790 | 3300049571 | Bacteria | 4227 |
| 264 | Ga0501034_0109190 | 3300049571 | Bacteria | 2757 |
| 265 | Ga0501036_0005648 | 3300049572 | Bacteria | 10147 |
| 266 | Ga0501036_0043257 | 3300049572 | Bacteria | 3814 |
| 267 | Ga0501037_0005330 | 3300049573 | Bacteria | 9354 |
| 268 | Ga0501037_0007353 | 3300049573 | Bacteria | 8055 |
| 269 | Ga0501038_0002332 | 3300049574 | Bacteria | 17683 |
| 270 | Ga0501038_0020247 | 3300049574 | Bacteria | 5984 |
| 271 | Ga0501039_0003401 | 3300049575 | Bacteria | 11893 |
| 272 | Ga0501039_0033366 | 3300049575 | Bacteria | 3969 |
| 273 | Ga0501040_0345137 | 3300049576 | Bacteria | 1066 |
| 274 | Ga0501043_0009988 | 3300049579 | Bacteria | 7447 |
| 275 | Ga0501043_0049867 | 3300049579 | Bacteria | 3291 |
| 276 | Ga0501043_0103923 | 3300049579 | Bacteria | 2232 |
| 277 | Ga0501047_0059703 | 3300049581 | Bacteria | 3682 |
| 278 | Ga0501047_0060400 | 3300049581 | Bacteria | 3658 |
| 279 | Ga0501048_0011325 | 3300049582 | Bacteria | 6651 |
| 280 | Ga0501048_0408427 | 3300049582 | Bacteria | 971 |
| 281 | Ga0501067_0155736 | 3300049583 | Bacteria | 1273 |
| 282 | Ga0501068_0012805 | 3300049584 | Bacteria | 4762 |
| 283 | Ga0501070_0012116 | 3300049586 | Bacteria | 7278 |
| 284 | Ga0501071_0376941 | 3300049587 | Bacteria | 1081 |
| 285 | Ga0501073_0006743 | 3300049589 | Bacteria | 8548 |
| 286 | Ga0501073_0059684 | 3300049589 | Bacteria | 2663 |
| 287 | Ga0501073_0124125 | 3300049589 | Bacteria | 1789 |
| 288 | Ga0501074_0031601 | 3300049590 | Bacteria | 3835 |
| 289 | Ga0501076_0123305 | 3300049592 | Bacteria | 2099 |
| 290 | Ga0501079_0609037 | 3300049741 | Bacteria | 859 |
| 291 | Ga0501080_0004696 | 3300049742 | Bacteria | 12187 |
| 292 | Ga0501080_0027236 | 3300049742 | Bacteria | 5316 |
| 293 | Ga0501035_0018283 | 3300049822 | Bacteria | 6457 |
| 294 | Ga0501035_0028592 | 3300049822 | Bacteria | 5089 |
| 295 | Ga0501035_0032477 | 3300049822 | Bacteria | 4749 |
| 296 | Ga0501044_0006675 | 3300049823 | Bacteria | 12721 |
| 297 | Ga0501044_0026247 | 3300049823 | Bacteria | 6168 |
| 298 | Ga0501045_0098999 | 3300049824 | Bacteria | 2157 |
| 299 | nmdc:mga00v17_184956_c1 | 3300050491 | Bacteria | 1345 |
| 300 | nmdc:mga00v17_35399_c1 | 3300050491 | Bacteria | 2971 |
| 301 | Ga0500651_0001442 | 3300053093 | Bacteria | 11965 |
| 302 | Ga0500566_0156774 | 3300053094 | Bacteria | 1191 |
| 303 | Ga0501084_0099702 | 3300054114 | Bacteria | 2439 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031731 | Ga0307405_10170446 | Ga0307405_101704461 | 236 |
| 2 | 3300035724 | Ga0373933_0160098 | Ga0373933_0160098_27_755 | 237 |
| 3 | 3300005293 | Ga0065715_10107973 | Ga0065715_101079732 | 250 |
| 4 | 3300048924 | Ga0496121_0001610 | Ga0496121_0001610_17640_18437 | 251 |
| 5 | 3300025294 | Ga0209025_1003524 | Ga0209025_10035248 | 253 |
| 6 | 3300032004 | Ga0307414_10407455 | Ga0307414_104074552 | 253 |
| 7 | 3300042007 | Ga0439449_0000868 | Ga0439449_0000868_8373_9170 | 253 |
| 8 | 3300027378 | Ga0209981_1001761 | Ga0209981_10017613 | 255 |
| 9 | 3300027665 | Ga0209983_1018359 | Ga0209983_10183591 | 255 |
| 10 | 3300041404 | Ga0439436_0015465 | Ga0439436_0015465_1109_1906 | 257 |
| 11 | 3300041406 | Ga0439439_0007082 | Ga0439439_0007082_1663_2460 | 257 |
| 12 | 3300042007 | Ga0439449_0027167 | Ga0439449_0027167_942_1739 | 257 |
| 13 | 3300042014 | Ga0439457_052547 | Ga0439457_052547_32_829 | 257 |
| 14 | 3300042015 | Ga0439462_0029848 | Ga0439462_0029848_109_906 | 257 |
| 15 | 3300005288 | Ga0065714_10017937 | Ga0065714_100179371 | 259 |
| 16 | 3300013297 | Ga0157378_10000742 | Ga0157378_1000074228 | 259 |
| 17 | 3300027876 | Ga0209974_10007408 | Ga0209974_100074083 | 259 |
| 18 | 3300005327 | Ga0070658_10115895 | Ga0070658_101158953 | 260 |
| 19 | 3300005334 | Ga0068869_100037648 | Ga0068869_1000376482 | 260 |
| 20 | 3300005335 | Ga0070666_10000643 | Ga0070666_100006436 | 260 |
| 21 | 3300005335 | Ga0070666_10006812 | Ga0070666_100068123 | 260 |
| 22 | 3300005344 | Ga0070661_100001611 | Ga0070661_1000016114 | 260 |
| 23 | 3300005344 | Ga0070661_100016345 | Ga0070661_1000163455 | 260 |
| 24 | 3300005366 | Ga0070659_100233103 | Ga0070659_1002331031 | 260 |
| 25 | 3300005367 | Ga0070667_100120315 | Ga0070667_1001203151 | 260 |
| 26 | 3300005530 | Ga0070679_100084989 | Ga0070679_1000849893 | 260 |
| 27 | 3300005539 | Ga0068853_100010874 | Ga0068853_1000108745 | 260 |
| 28 | 3300005539 | Ga0068853_100071311 | Ga0068853_1000713112 | 260 |
| 29 | 3300005563 | Ga0068855_100004858 | Ga0068855_1000048588 | 260 |
| 30 | 3300005578 | Ga0068854_100041884 | Ga0068854_1000418843 | 260 |
| 31 | 3300005614 | Ga0068856_100010785 | Ga0068856_1000107852 | 260 |
| 32 | 3300005614 | Ga0068856_100753937 | Ga0068856_1007539372 | 260 |
| 33 | 3300005616 | Ga0068852_100016190 | Ga0068852_1000161904 | 260 |
| 34 | 3300005617 | Ga0068859_100087241 | Ga0068859_1000872413 | 260 |
| 35 | 3300005618 | Ga0068864_100017999 | Ga0068864_1000179992 | 260 |
| 36 | 3300005841 | Ga0068863_100000773 | Ga0068863_10000077315 | 260 |
| 37 | 3300005842 | Ga0068858_100423689 | Ga0068858_1004236892 | 260 |
| 38 | 3300005843 | Ga0068860_100027833 | Ga0068860_1000278334 | 260 |
| 39 | 3300006358 | Ga0068871_100172714 | Ga0068871_1001727141 | 260 |
| 40 | 3300006931 | Ga0097620_100087241 | Ga0097620_1000872413 | 260 |
| 41 | 3300009093 | Ga0105240_10096470 | Ga0105240_100964703 | 260 |
| 42 | 3300009174 | Ga0105241_10003106 | Ga0105241_100031064 | 260 |
| 43 | 3300009174 | Ga0105241_10072803 | Ga0105241_100728032 | 260 |
| 44 | 3300009545 | Ga0105237_10002972 | Ga0105237_100029728 | 260 |
| 45 | 3300009545 | Ga0105237_10366938 | Ga0105237_103669383 | 260 |
| 46 | 3300009551 | Ga0105238_10182572 | Ga0105238_101825722 | 260 |
| 47 | 3300009553 | Ga0105249_10312277 | Ga0105249_103122772 | 260 |
| 48 | 3300010375 | Ga0105239_10011101 | Ga0105239_100111015 | 260 |
| 49 | 3300010375 | Ga0105239_10044717 | Ga0105239_100447174 | 260 |
| 50 | 3300010375 | Ga0105239_10228018 | Ga0105239_102280182 | 260 |
| 51 | 3300011119 | Ga0105246_10013661 | Ga0105246_100136615 | 260 |
| 52 | 3300013104 | Ga0157370_10065744 | Ga0157370_100657441 | 260 |
| 53 | 3300013105 | Ga0157369_10033433 | Ga0157369_100334335 | 260 |
| 54 | 3300013105 | Ga0157369_10250508 | Ga0157369_102505083 | 260 |
| 55 | 3300013306 | Ga0163162_10336833 | Ga0163162_103368332 | 260 |
| 56 | 3300013307 | Ga0157372_10000445 | Ga0157372_1000044527 | 260 |
| 57 | 3300013307 | Ga0157372_10148079 | Ga0157372_101480792 | 260 |
| 58 | 3300014325 | Ga0163163_10000863 | Ga0163163_100008634 | 260 |
| 59 | 3300014325 | Ga0163163_10013489 | Ga0163163_100134893 | 260 |
| 60 | 3300014968 | Ga0157379_10004344 | Ga0157379_100043445 | 260 |
| 61 | 3300025903 | Ga0207680_10001160 | Ga0207680_100011606 | 260 |
| 62 | 3300025904 | Ga0207647_10005182 | Ga0207647_100051825 | 260 |
| 63 | 3300025904 | Ga0207647_10304572 | Ga0207647_103045722 | 260 |
| 64 | 3300025913 | Ga0207695_10000094 | Ga0207695_1000009458 | 260 |
| 65 | 3300025914 | Ga0207671_10007824 | Ga0207671_100078244 | 260 |
| 66 | 3300025914 | Ga0207671_10140133 | Ga0207671_101401333 | 260 |
| 67 | 3300025919 | Ga0207657_10005275 | Ga0207657_100052753 | 260 |
| 68 | 3300025920 | Ga0207649_10001479 | Ga0207649_1000147911 | 260 |
| 69 | 3300025932 | Ga0207690_10127698 | Ga0207690_101276982 | 260 |
| 70 | 3300025944 | Ga0207661_10086656 | Ga0207661_100866562 | 260 |
| 71 | 3300025949 | Ga0207667_10007474 | Ga0207667_100074745 | 260 |
| 72 | 3300026035 | Ga0207703_10114740 | Ga0207703_101147402 | 260 |
| 73 | 3300026041 | Ga0207639_10001512 | Ga0207639_100015127 | 260 |
| 74 | 3300026041 | Ga0207639_10499142 | Ga0207639_104991422 | 260 |
| 75 | 3300026078 | Ga0207702_10011594 | Ga0207702_100115944 | 260 |
| 76 | 3300026088 | Ga0207641_10077854 | Ga0207641_100778542 | 260 |
| 77 | 3300026095 | Ga0207676_10182799 | Ga0207676_101827992 | 260 |
| 78 | 3300026116 | Ga0207674_10002112 | Ga0207674_1000211214 | 260 |
| 79 | 3300026121 | Ga0207683_10521991 | Ga0207683_105219912 | 260 |
| 80 | 3300026142 | Ga0207698_10026723 | Ga0207698_100267231 | 260 |
| 81 | 3300049568 | Ga0501031_0009879 | Ga0501031_0009879_3801_4625 | 260 |
| 82 | 3300049582 | Ga0501048_0408427 | Ga0501048_0408427_70_870 | 260 |
| 83 | 3300005530 | Ga0070679_100014507 | Ga0070679_1000145077 | 261 |
| 84 | 3300005546 | Ga0070696_100273988 | Ga0070696_1002739882 | 261 |
| 85 | 3300005563 | Ga0068855_100012573 | Ga0068855_1000125735 | 261 |
| 86 | 3300005578 | Ga0068854_100014016 | Ga0068854_1000140167 | 261 |
| 87 | 3300009177 | Ga0105248_10389457 | Ga0105248_103894573 | 261 |
| 88 | 3300013307 | Ga0157372_10001622 | Ga0157372_1000162218 | 261 |
| 89 | 3300025912 | Ga0207707_10000699 | Ga0207707_100006992 | 261 |
| 90 | 3300025917 | Ga0207660_10050763 | Ga0207660_100507632 | 261 |
| 91 | 3300025921 | Ga0207652_10192384 | Ga0207652_101923842 | 261 |
| 92 | 3300025949 | Ga0207667_10092266 | Ga0207667_100922663 | 261 |
| 93 | 3300026067 | Ga0207678_10025756 | Ga0207678_100257564 | 261 |
| 94 | iso_pu_bacteria | 2571042365 | 2572255108 | 261 |
| 95 | iso_pu_bacteria | 2643221593 | 2643976558 | 261 |
| 96 | iso_pu_bacteria | 2643221695 | 2644528935 | 261 |
| 97 | iso_pu_bacteria | 2894414249 | 2894415343 | 261 |
| 98 | iso_pu_bacteria | 2941489479 | 2941490598 | 261 |
| 99 | iso_pu_bacteria | 2995948881 | 2995951445 | 261 |
| 100 | iso_pu_bacteria | 8002869464 | 8002871792 | 261 |
| 101 | iso_pu_bacteria | 8003014200 | 8003014493 | 261 |
| 102 | 3300005616 | Ga0068852_100599054 | Ga0068852_1005990541 | 262 |
| 103 | 3300005617 | Ga0068859_100199736 | Ga0068859_1001997362 | 262 |
| 104 | 3300005841 | Ga0068863_100083687 | Ga0068863_1000836873 | 262 |
| 105 | 3300006931 | Ga0097620_100199742 | Ga0097620_1001997422 | 262 |
| 106 | 3300009551 | Ga0105238_10010010 | Ga0105238_100100106 | 262 |
| 107 | 3300011119 | Ga0105246_10134381 | Ga0105246_101343812 | 262 |
| 108 | 3300013297 | Ga0157378_10070937 | Ga0157378_100709373 | 262 |
| 109 | 3300013308 | Ga0157375_10053416 | Ga0157375_100534164 | 262 |
| 110 | 3300014969 | Ga0157376_10023869 | Ga0157376_100238694 | 262 |
| 111 | 3300025924 | Ga0207694_10010172 | Ga0207694_100101726 | 262 |
| 112 | 3300026088 | Ga0207641_10075285 | Ga0207641_100752853 | 262 |
| 113 | 3300026142 | Ga0207698_10549420 | Ga0207698_105494202 | 262 |
| 114 | 3300005367 | Ga0070667_100071346 | Ga0070667_1000713462 | 263 |
| 115 | 3300005539 | Ga0068853_100415387 | Ga0068853_1004153872 | 263 |
| 116 | 3300013104 | Ga0157370_10143335 | Ga0157370_101433352 | 263 |
| 117 | 3300013307 | Ga0157372_10007949 | Ga0157372_100079497 | 263 |
| 118 | 3300025919 | Ga0207657_10329171 | Ga0207657_103291712 | 263 |
| 119 | 3300025949 | Ga0207667_10195924 | Ga0207667_101959242 | 263 |
| 120 | 3300041453 | Ga0451797_0268753 | Ga0451797_0268753_570_1367 | 263 |
| 121 | 3300049569 | Ga0501032_0004309 | Ga0501032_0004309_980_1780 | 263 |
| 122 | 3300049570 | Ga0501033_0000329 | Ga0501033_0000329_1074_1874 | 263 |
| 123 | 3300049571 | Ga0501034_0019091 | Ga0501034_0019091_457_1257 | 263 |
| 124 | 3300049572 | Ga0501036_0005648 | Ga0501036_0005648_7982_8782 | 263 |
| 125 | 3300049573 | Ga0501037_0007353 | Ga0501037_0007353_3216_4016 | 263 |
| 126 | 3300049574 | Ga0501038_0002332 | Ga0501038_0002332_16416_17216 | 263 |
| 127 | 3300049575 | Ga0501039_0003401 | Ga0501039_0003401_724_1524 | 263 |
| 128 | 3300049576 | Ga0501040_0345137 | Ga0501040_0345137_159_959 | 263 |
| 129 | 3300049579 | Ga0501043_0049867 | Ga0501043_0049867_480_1280 | 263 |
| 130 | 3300049581 | Ga0501047_0060400 | Ga0501047_0060400_980_1780 | 263 |
| 131 | 3300049582 | Ga0501048_0011325 | Ga0501048_0011325_1554_2354 | 263 |
| 132 | 3300049584 | Ga0501068_0012805 | Ga0501068_0012805_1651_2451 | 263 |
| 133 | 3300049587 | Ga0501071_0376941 | Ga0501071_0376941_236_1036 | 263 |
| 134 | 3300049589 | Ga0501073_0006743 | Ga0501073_0006743_1879_2679 | 263 |
| 135 | 3300049589 | Ga0501073_0124125 | Ga0501073_0124125_725_1525 | 263 |
| 136 | 3300049590 | Ga0501074_0031601 | Ga0501074_0031601_2398_3198 | 263 |
| 137 | 3300049592 | Ga0501076_0123305 | Ga0501076_0123305_377_1177 | 263 |
| 138 | 3300049741 | Ga0501079_0609037 | Ga0501079_0609037_13_813 | 263 |
| 139 | 3300049742 | Ga0501080_0027236 | Ga0501080_0027236_4128_4928 | 263 |
| 140 | 3300049822 | Ga0501035_0028592 | Ga0501035_0028592_874_1674 | 263 |
| 141 | 3300049822 | Ga0501035_0032477 | Ga0501035_0032477_1643_2443 | 263 |
| 142 | 3300049823 | Ga0501044_0006675 | Ga0501044_0006675_10613_11413 | 263 |
| 143 | 3300049824 | Ga0501045_0098999 | Ga0501045_0098999_264_1064 | 263 |
| 144 | 3300053093 | Ga0500651_0001442 | Ga0500651_0001442_1476_2288 | 263 |
| 145 | 3300054114 | Ga0501084_0099702 | Ga0501084_0099702_1480_2280 | 263 |
| 146 | 3300005578 | Ga0068854_100367895 | Ga0068854_1003678951 | 264 |
| 147 | 3300005843 | Ga0068860_100020581 | Ga0068860_1000205817 | 264 |
| 148 | 3300006881 | Ga0068865_100017242 | Ga0068865_1000172423 | 264 |
| 149 | 3300009093 | Ga0105240_10186505 | Ga0105240_101865052 | 264 |
| 150 | 3300009093 | Ga0105240_10209705 | Ga0105240_102097052 | 264 |
| 151 | 3300009174 | Ga0105241_10012367 | Ga0105241_100123673 | 264 |
| 152 | 3300009176 | Ga0105242_10012457 | Ga0105242_100124575 | 264 |
| 153 | 3300009553 | Ga0105249_10036904 | Ga0105249_100369045 | 264 |
| 154 | 3300010375 | Ga0105239_10019741 | Ga0105239_100197411 | 264 |
| 155 | 3300013105 | Ga0157369_10000028 | Ga0157369_1000002861 | 264 |
| 156 | 3300013308 | Ga0157375_10027396 | Ga0157375_100273965 | 264 |
| 157 | 3300014969 | Ga0157376_10007777 | Ga0157376_100077772 | 264 |
| 158 | 3300014969 | Ga0157376_10078336 | Ga0157376_100783363 | 264 |
| 159 | 3300025911 | Ga0207654_10061694 | Ga0207654_100616942 | 264 |
| 160 | 3300025913 | Ga0207695_10119865 | Ga0207695_101198653 | 264 |
| 161 | 3300025914 | Ga0207671_10001138 | Ga0207671_100011385 | 264 |
| 162 | 3300025961 | Ga0207712_10030014 | Ga0207712_100300142 | 264 |
| 163 | 3300026078 | Ga0207702_10834709 | Ga0207702_108347091 | 264 |
| 164 | 3300028381 | Ga0268264_10018138 | Ga0268264_100181383 | 264 |
| 165 | 3300035410 | Ga0373924_0107207 | Ga0373924_0107207_204_1028 | 264 |
| 166 | 3300039437 | Ga0436365_1878631 | Ga0436365_1878631_577_1386 | 264 |
| 167 | 3300046475 | Ga0495639_0213119 | Ga0495639_0213119_79_903 | 264 |
| 168 | 3300046681 | Ga0495647_0035116 | Ga0495647_0035116_960_1784 | 264 |
| 169 | 3300046683 | Ga0495658_0020445 | Ga0495658_0020445_281_1105 | 264 |
| 170 | 3300047317 | Ga0495604_0240819 | Ga0495604_0240819_178_1002 | 264 |
| 171 | 3300048907 | Ga0496104_0000020 | Ga0496104_0000020_45822_46646 | 264 |
| 172 | 3300048908 | Ga0496105_0000015 | Ga0496105_0000015_13889_14713 | 264 |
| 173 | 3300053094 | Ga0500566_0156774 | Ga0500566_0156774_190_1014 | 264 |
| 174 | 3300003187 | JGI25151J46595_10000774 | JGI25151J46595_100007743 | 265 |
| 175 | 3300003187 | JGI25151J46595_10014047 | JGI25151J46595_100140472 | 265 |
| 176 | 3300003771 | Ga0055526_1000071 | Ga0055526_10000715 | 265 |
| 177 | 3300003771 | Ga0055526_1017541 | Ga0055526_10175413 | 265 |
| 178 | 3300003773 | Ga0055537_1000376 | Ga0055537_100037628 | 265 |
| 179 | 3300003775 | Ga0055524_1000041 | Ga0055524_10000415 | 265 |
| 180 | 3300003775 | Ga0055524_1007439 | Ga0055524_10074394 | 265 |
| 181 | 3300003781 | Ga0055536_1001543 | Ga0055536_10015439 | 265 |
| 182 | 3300003781 | Ga0055536_1022028 | Ga0055536_10220282 | 265 |
| 183 | 3300003784 | Ga0055534_1000040 | Ga0055534_1000040108 | 265 |
| 184 | 3300003790 | Ga0055528_1000017 | Ga0055528_10000175 | 265 |
| 185 | 3300003791 | Ga0055530_10008977 | Ga0055530_100089774 | 265 |
| 186 | 3300003794 | Ga0055531_10003012 | Ga0055531_100030129 | 265 |
| 187 | 3300003794 | Ga0055531_10004233 | Ga0055531_100042335 | 265 |
| 188 | 3300003794 | Ga0055531_10026160 | Ga0055531_100261602 | 265 |
| 189 | 3300003794 | Ga0055531_10033025 | Ga0055531_100330252 | 265 |
| 190 | 3300003794 | Ga0055531_10033308 | Ga0055531_100333081 | 265 |
| 191 | 3300003794 | Ga0055531_10057561 | Ga0055531_100575611 | 265 |
| 192 | 3300005293 | Ga0065715_10132133 | Ga0065715_101321332 | 265 |
| 193 | 3300005334 | Ga0068869_100212415 | Ga0068869_1002124152 | 265 |
| 194 | 3300005337 | Ga0070682_100279547 | Ga0070682_1002795471 | 265 |
| 195 | 3300005339 | Ga0070660_100536108 | Ga0070660_1005361081 | 265 |
| 196 | 3300005344 | Ga0070661_100186137 | Ga0070661_1001861372 | 265 |
| 197 | 3300005355 | Ga0070671_100029011 | Ga0070671_1000290113 | 265 |
| 198 | 3300005366 | Ga0070659_100327765 | Ga0070659_1003277652 | 265 |
| 199 | 3300005530 | Ga0070679_100304560 | Ga0070679_1003045602 | 265 |
| 200 | 3300005543 | Ga0070672_100036187 | Ga0070672_1000361872 | 265 |
| 201 | 3300005543 | Ga0070672_100047734 | Ga0070672_1000477342 | 265 |
| 202 | 3300005718 | Ga0068866_10080735 | Ga0068866_100807351 | 265 |
| 203 | 3300006051 | Ga0075364_10270179 | Ga0075364_102701792 | 265 |
| 204 | 3300012482 | Ga0157318_1002678 | Ga0157318_10026781 | 265 |
| 205 | 3300013104 | Ga0157370_10385603 | Ga0157370_103856032 | 265 |
| 206 | 3300013105 | Ga0157369_10036296 | Ga0157369_100362962 | 265 |
| 207 | 3300013105 | Ga0157369_10251179 | Ga0157369_102511792 | 265 |
| 208 | 3300013296 | Ga0157374_10250699 | Ga0157374_102506992 | 265 |
| 209 | 3300013307 | Ga0157372_10077499 | Ga0157372_100774994 | 265 |
| 210 | 3300013308 | Ga0157375_10007115 | Ga0157375_100071153 | 265 |
| 211 | 3300015689 | Ga0183360_10001 | Ga0183360_100011763 | 265 |
| 212 | 3300025245 | Ga0207425_1003211 | Ga0207425_10032115 | 265 |
| 213 | 3300025273 | Ga0209673_1030054 | Ga0209673_10300542 | 265 |
| 214 | 3300025284 | Ga0209130_1013549 | Ga0209130_10135492 | 265 |
| 215 | 3300025291 | Ga0209675_1015497 | Ga0209675_10154971 | 265 |
| 216 | 3300025291 | Ga0209675_1019894 | Ga0209675_10198941 | 265 |
| 217 | 3300025292 | Ga0209676_1000700 | Ga0209676_100070011 | 265 |
| 218 | 3300025292 | Ga0209676_1002544 | Ga0209676_10025442 | 265 |
| 219 | 3300025292 | Ga0209676_1003692 | Ga0209676_10036925 | 265 |
| 220 | 3300025292 | Ga0209676_1007721 | Ga0209676_10077213 | 265 |
| 221 | 3300025292 | Ga0209676_1008903 | Ga0209676_10089033 | 265 |
| 222 | 3300025292 | Ga0209676_1019170 | Ga0209676_10191702 | 265 |
| 223 | 3300025294 | Ga0209025_1000005 | Ga0209025_1000005489 | 265 |
| 224 | 3300025294 | Ga0209025_1004601 | Ga0209025_10046012 | 265 |
| 225 | 3300025295 | Ga0209564_1024564 | Ga0209564_10245642 | 265 |
| 226 | 3300025295 | Ga0209564_1040682 | Ga0209564_10406821 | 265 |
| 227 | 3300025297 | Ga0209758_1013511 | Ga0209758_10135113 | 265 |
| 228 | 3300025297 | Ga0209758_1035672 | Ga0209758_10356722 | 265 |
| 229 | 3300025297 | Ga0209758_1047779 | Ga0209758_10477791 | 265 |
| 230 | 3300025298 | Ga0209050_1004106 | Ga0209050_100410610 | 265 |
| 231 | 3300025298 | Ga0209050_1045692 | Ga0209050_10456921 | 265 |
| 232 | 3300025299 | Ga0209256_1004239 | Ga0209256_10042395 | 265 |
| 233 | 3300025299 | Ga0209256_1005189 | Ga0209256_10051895 | 265 |
| 234 | 3300025299 | Ga0209256_1011181 | Ga0209256_10111811 | 265 |
| 235 | 3300025303 | Ga0209051_1016757 | Ga0209051_10167572 | 265 |
| 236 | 3300025304 | Ga0209257_1000570 | Ga0209257_100057051 | 265 |
| 237 | 3300025304 | Ga0209257_1000615 | Ga0209257_10006154 | 265 |
| 238 | 3300025304 | Ga0209257_1003026 | Ga0209257_10030265 | 265 |
| 239 | 3300025304 | Ga0209257_1003530 | Ga0209257_10035304 | 265 |
| 240 | 3300025304 | Ga0209257_1020074 | Ga0209257_10200743 | 265 |
| 241 | 3300025304 | Ga0209257_1026596 | Ga0209257_10265962 | 265 |
| 242 | 3300025919 | Ga0207657_10003945 | Ga0207657_100039453 | 265 |
| 243 | 3300025919 | Ga0207657_10054008 | Ga0207657_100540083 | 265 |
| 244 | 3300025920 | Ga0207649_10103171 | Ga0207649_101031713 | 265 |
| 245 | 3300025921 | Ga0207652_10096250 | Ga0207652_100962502 | 265 |
| 246 | 3300025923 | Ga0207681_10065078 | Ga0207681_100650782 | 265 |
| 247 | 3300025926 | Ga0207659_10214991 | Ga0207659_102149912 | 265 |
| 248 | 3300025931 | Ga0207644_10235718 | Ga0207644_102357182 | 265 |
| 249 | 3300025940 | Ga0207691_10000928 | Ga0207691_100009285 | 265 |
| 250 | 3300025940 | Ga0207691_10062331 | Ga0207691_100623312 | 265 |
| 251 | 3300025942 | Ga0207689_10024419 | Ga0207689_100244193 | 265 |
| 252 | 3300025972 | Ga0207668_10360897 | Ga0207668_103608972 | 265 |
| 253 | 3300030733 | Ga0314311_1257047 | Ga0314311_12570471 | 265 |
| 254 | 3300031456 | Ga0307513_10024140 | Ga0307513_100241403 | 265 |
| 255 | 3300031824 | Ga0307413_10003090 | Ga0307413_100030903 | 265 |
| 256 | 3300031901 | Ga0307406_10033911 | Ga0307406_100339112 | 265 |
| 257 | 3300031911 | Ga0307412_10563690 | Ga0307412_105636901 | 265 |
| 258 | 3300032004 | Ga0307414_10002154 | Ga0307414_100021546 | 265 |
| 259 | 3300032004 | Ga0307414_10003875 | Ga0307414_100038758 | 265 |
| 260 | 3300032004 | Ga0307414_10215815 | Ga0307414_102158152 | 265 |
| 261 | 3300032004 | Ga0307414_10438763 | Ga0307414_104387632 | 265 |
| 262 | 3300032005 | Ga0307411_10054578 | Ga0307411_100545783 | 265 |
| 263 | 3300037418 | Ga0395900_0112456 | Ga0395900_0112456_1033_1863 | 265 |
| 264 | 3300037418 | Ga0395900_0195915 | Ga0395900_0195915_751_1548 | 265 |
| 265 | 3300037471 | Ga0395905_0109833 | Ga0395905_0109833_97_909 | 265 |
| 266 | 3300037471 | Ga0395905_0153241 | Ga0395905_0153241_191_994 | 265 |
| 267 | 3300037471 | Ga0395905_0182149 | Ga0395905_0182149_78_908 | 265 |
| 268 | 3300038443 | Ga0395901_0013851 | Ga0395901_0013851_541_1371 | 265 |
| 269 | 3300041404 | Ga0439436_0036104 | Ga0439436_0036104_225_1022 | 265 |
| 270 | 3300041407 | Ga0439447_003418 | Ga0439447_003418_4171_4968 | 265 |
| 271 | 3300042007 | Ga0439449_0103892 | Ga0439449_0103892_186_983 | 265 |
| 272 | 3300046525 | Ga0495663_0002289 | Ga0495663_0002289_1176_1973 | 265 |
| 273 | 3300046525 | Ga0495663_0085679 | Ga0495663_0085679_171_968 | 265 |
| 274 | 3300046539 | Ga0495621_0036238 | Ga0495621_0036238_710_1507 | 265 |
| 275 | 3300046539 | Ga0495621_0078773 | Ga0495621_0078773_150_965 | 265 |
| 276 | 3300046615 | Ga0495656_0003858 | Ga0495656_0003858_4205_5002 | 265 |
| 277 | 3300046615 | Ga0495656_0085157 | Ga0495656_0085157_76_873 | 265 |
| 278 | 3300046616 | Ga0495668_0032132 | Ga0495668_0032132_1310_2107 | 265 |
| 279 | 3300046616 | Ga0495668_0034812 | Ga0495668_0034812_525_1322 | 265 |
| 280 | 3300046664 | Ga0495659_0129000 | Ga0495659_0129000_192_989 | 265 |
| 281 | 3300047318 | Ga0495636_0000021 | Ga0495636_0000021_4941_5738 | 265 |
| 282 | 3300047318 | Ga0495636_0008386 | Ga0495636_0008386_2546_3343 | 265 |
| 283 | 3300047318 | Ga0495636_0017667 | Ga0495636_0017667_1137_1934 | 265 |
| 284 | 3300047445 | Ga0495677_0067744 | Ga0495677_0067744_63_860 | 265 |
| 285 | 3300048904 | Ga0496101_0033138 | Ga0496101_0033138_1625_2518 | 265 |
| 286 | 3300048904 | Ga0496101_0061834 | Ga0496101_0061834_339_1184 | 265 |
| 287 | 3300048909 | Ga0496106_0054476 | Ga0496106_0054476_1433_2230 | 265 |
| 288 | 3300048910 | Ga0496107_0221489 | Ga0496107_0221489_454_1251 | 265 |
| 289 | 3300048911 | Ga0496108_0053148 | Ga0496108_0053148_287_1180 | 265 |
| 290 | 3300048915 | Ga0496112_0182305 | Ga0496112_0182305_808_1701 | 265 |
| 291 | 3300048915 | Ga0496112_0276290 | Ga0496112_0276290_814_1611 | 265 |
| 292 | 3300049568 | Ga0501031_0042227 | Ga0501031_0042227_802_1602 | 265 |
| 293 | 3300049569 | Ga0501032_0008307 | Ga0501032_0008307_4761_5561 | 265 |
| 294 | 3300049571 | Ga0501034_0000498 | Ga0501034_0000498_46583_47392 | 265 |
| 295 | 3300049571 | Ga0501034_0049790 | Ga0501034_0049790_1504_2304 | 265 |
| 296 | 3300049571 | Ga0501034_0109190 | Ga0501034_0109190_1893_2690 | 265 |
| 297 | 3300049572 | Ga0501036_0043257 | Ga0501036_0043257_302_1102 | 265 |
| 298 | 3300049573 | Ga0501037_0005330 | Ga0501037_0005330_3806_4606 | 265 |
| 299 | 3300049574 | Ga0501038_0020247 | Ga0501038_0020247_820_1620 | 265 |
| 300 | 3300049575 | Ga0501039_0033366 | Ga0501039_0033366_146_946 | 265 |
| 301 | 3300049579 | Ga0501043_0009988 | Ga0501043_0009988_708_1505 | 265 |
| 302 | 3300049579 | Ga0501043_0103923 | Ga0501043_0103923_55_855 | 265 |
| 303 | 3300049581 | Ga0501047_0059703 | Ga0501047_0059703_1547_2347 | 265 |
| 304 | 3300049583 | Ga0501067_0155736 | Ga0501067_0155736_69_869 | 265 |
| 305 | 3300049586 | Ga0501070_0012116 | Ga0501070_0012116_3106_3906 | 265 |
| 306 | 3300049589 | Ga0501073_0059684 | Ga0501073_0059684_64_864 | 265 |
| 307 | 3300049742 | Ga0501080_0004696 | Ga0501080_0004696_6289_7089 | 265 |
| 308 | 3300049822 | Ga0501035_0018283 | Ga0501035_0018283_1243_2043 | 265 |
| 309 | 3300049823 | Ga0501044_0026247 | Ga0501044_0026247_1022_1822 | 265 |
| 310 | 3300050491 | nmdc:mga00v17_184956_c1 | nmdc:mga00v17_184956_c1_274_1092 | 265 |
| 311 | 3300050491 | nmdc:mga00v17_35399_c1 | nmdc:mga00v17_35399_c1_253_1071 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2e11-assembly2.cif.gz_D | the crystal structure of xc1258 from xanthomonas campestris: a cn-hydrolase superfamily protein with an arsenic adduct in the active site | 0.9453 | 1 | 265 |
| 2w1v-assembly1.cif.gz_B | crystal structure of mouse nitrilase-2 at 1.4a resolution | 0.8782 | 1 | 254 |
| 3p8k-assembly1.cif.gz_B | crystal structure of a putative carbon-nitrogen family hydrolase from staphylococcus aureus | 0.8633 | 1 | 263 |
| 5h8j-assembly1.cif.gz_H | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine | 0.8615 | 2 | 258 |
| 3p8k-assembly1.cif.gz_B | crystal structure of a putative carbon-nitrogen family hydrolase from staphylococcus aureus | 0.854 | 1 | 263 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2e11D00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9453 | 1 | 265 | 3.60.110.10 |
| af_Q47679_3_256_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9233 | 4 | 265 | 3.60.110.10 |
| af_Q47679_3_256_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9163 | 4 | 265 | 3.60.110.10 |
| af_Q2FWM9_1_261_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.8767 | 4 | 263 | 3.60.110.10 |
| af_Q2FWM9_1_261_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.8703 | 4 | 263 | 3.60.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W1YL83-F1-model_v4 | CN hydrolase domain-containing protein | 0.9688 | 140 | 228 |
GO:0050152
GO:0106008 |
| AF-A0A3C1WRE1-F1-model_v4 | Nitrilase family protein | 0.9488 | 131 | 265 |
GO:0050152
GO:0106008 |
| AF-A0A3C0B9B8-F1-model_v4 | Nitrilase family protein | 0.9475 | 134 | 264 |
GO:0050152
GO:0106008 |
| AF-A0A6N7K6E0-F1-model_v4 | deleted | 0.947 | 1 | 265 |
|
| AF-A0A4Q6F7R3-F1-model_v4 | deleted | 0.9467 | 1 | 265 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar