F401258

General Info

Members Datasets Scaffolds Average Seq Length
311 181 303 266

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10834709|Ga0207702_108347091
Length 278
Sequence VRAVTAVGDGRGALRVSLVQGATRWLDLGGNRDYYAALIAPLRGQTDLVLLPETFTSGFSNEAIHQAETMDGATVAWLRDQARALDAAVTGSVQLRAGDGAGARVYNRLLFATPDGTIRHYDKRHLFRYAREHERYAAGGERVVVDWRGWRICPLVCYDLRFPVFVRNRYHGDAARFDYDLVLFVANWPSARRHAWRTLLRARAIENLTYCAGLNRVGVDGNDLHYAGDSAVIDFLGEPLVELGAQEQVVTTRLDAAALAAHRERFPAWMDADAFELR

Samples

Sample ID Description Type Environment
1 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
2 2643221593 Lysobacter sp. Root690 Isolate Unclassified
3 2643221695 Lysobacter sp. Root494 Isolate Unclassified
4 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
5 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
6 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
66 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
127 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
128 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
129 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
130 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
131 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
181 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 0
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.36
Nodule 0
Rhizoplane 3.22
Rhizosphere 77.17
Stem 0
Stem Tuber 0
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000774 3300003187 Bacteria 25902
2 JGI25151J46595_10014047 3300003187 Bacteria 3583
3 Ga0055526_1000071 3300003771 Bacteria 96766
4 Ga0055526_1017541 3300003771 Bacteria 2728
5 Ga0055537_1000376 3300003773 Bacteria 30050
6 Ga0055524_1000041 3300003775 Bacteria 156728
7 Ga0055524_1007439 3300003775 Bacteria 4646
8 Ga0055536_1001543 3300003781 Bacteria 13829
9 Ga0055536_1022028 3300003781 Bacteria 1913
10 Ga0055534_1000040 3300003784 Bacteria 104019
11 Ga0055528_1000017 3300003790 Bacteria 156728
12 Ga0055530_10008977 3300003791 Bacteria 3912
13 Ga0055531_10003012 3300003794 Bacteria 10935
14 Ga0055531_10004233 3300003794 Bacteria 8828
15 Ga0055531_10026160 3300003794 Bacteria 2091
16 Ga0055531_10033025 3300003794 Bacteria 1676
17 Ga0055531_10033308 3300003794 Bacteria 1662
18 Ga0055531_10057561 3300003794 Bacteria 973
19 Ga0065714_10017937 3300005288 Bacteria 2020
20 Ga0065715_10107973 3300005293 Bacteria 2743
21 Ga0065715_10132133 3300005293 Bacteria 1990
22 Ga0070658_10115895 3300005327 Bacteria 2223
23 Ga0068869_100037648 3300005334 Bacteria 3441
24 Ga0068869_100212415 3300005334 Bacteria 1530
25 Ga0070666_10000643 3300005335 Bacteria 21062
26 Ga0070666_10006812 3300005335 Bacteria 7040
27 Ga0070682_100279547 3300005337 Bacteria 1216
28 Ga0070660_100536108 3300005339 Bacteria 976
29 Ga0070661_100001611 3300005344 Bacteria 15612
30 Ga0070661_100016345 3300005344 Bacteria 5244
31 Ga0070661_100186137 3300005344 Bacteria 1582
32 Ga0070671_100029011 3300005355 Bacteria 4561
33 Ga0070659_100233103 3300005366 Bacteria 1521
34 Ga0070659_100327765 3300005366 Bacteria 1281
35 Ga0070667_100071346 3300005367 Bacteria 2958
36 Ga0070667_100120315 3300005367 Bacteria 2283
37 Ga0070679_100014507 3300005530 Bacteria 7569
38 Ga0070679_100084989 3300005530 Bacteria 3151
39 Ga0070679_100304560 3300005530 Bacteria 1544
40 Ga0068853_100010874 3300005539 Bacteria 7374
41 Ga0068853_100071311 3300005539 Bacteria 3025
42 Ga0068853_100415387 3300005539 Bacteria 1261
43 Ga0070672_100036187 3300005543 Bacteria 3759
44 Ga0070672_100047734 3300005543 Bacteria 3324
45 Ga0070696_100273988 3300005546 Bacteria 1284
46 Ga0068855_100004858 3300005563 Bacteria 16409
47 Ga0068855_100012573 3300005563 Bacteria 10217
48 Ga0068854_100014016 3300005578 Bacteria 5275
49 Ga0068854_100041884 3300005578 Bacteria 3238
50 Ga0068854_100367895 3300005578 Bacteria 1181
51 Ga0068856_100010785 3300005614 Bacteria 8875
52 Ga0068856_100753937 3300005614 Bacteria 993
53 Ga0068852_100016190 3300005616 Bacteria 5806
54 Ga0068852_100599054 3300005616 Bacteria 1106
55 Ga0068859_100087241 3300005617 Bacteria 3168
56 Ga0068859_100199736 3300005617 Bacteria 2084
57 Ga0068864_100017999 3300005618 Bacteria 5896
58 Ga0068866_10080735 3300005718 Bacteria 1745
59 Ga0068863_100000773 3300005841 Bacteria 32109
60 Ga0068863_100083687 3300005841 Bacteria 3023
61 Ga0068858_100423689 3300005842 Bacteria 1280
62 Ga0068860_100020581 3300005843 Bacteria 6391
63 Ga0068860_100027833 3300005843 Bacteria 5444
64 Ga0075364_10270179 3300006051 Bacteria 1156
65 Ga0068871_100172714 3300006358 Bacteria 1854
66 Ga0068865_100017242 3300006881 Bacteria 4641
67 Ga0097620_100087241 3300006931 Bacteria 3168
68 Ga0097620_100199742 3300006931 Bacteria 2084
69 Ga0105240_10096470 3300009093 Bacteria 3603
70 Ga0105240_10186505 3300009093 Bacteria 2443
71 Ga0105240_10209705 3300009093 Bacteria 2278
72 Ga0105241_10003106 3300009174 Bacteria 12356
73 Ga0105241_10012367 3300009174 Bacteria 6257
74 Ga0105241_10072803 3300009174 Bacteria 2672
75 Ga0105242_10012457 3300009176 Bacteria 6549
76 Ga0105248_10389457 3300009177 Bacteria 1569
77 Ga0105237_10002972 3300009545 Bacteria 20494
78 Ga0105237_10366938 3300009545 Bacteria 1445
79 Ga0105238_10010010 3300009551 Bacteria 9512
80 Ga0105238_10182572 3300009551 Bacteria 2075
81 Ga0105249_10036904 3300009553 Bacteria 4434
82 Ga0105249_10312277 3300009553 Bacteria 1581
83 Ga0105239_10011101 3300010375 Bacteria 10053
84 Ga0105239_10019741 3300010375 Bacteria 7439
85 Ga0105239_10044717 3300010375 Bacteria 4853
86 Ga0105239_10228018 3300010375 Bacteria 2090
87 Ga0105246_10013661 3300011119 Bacteria 5095
88 Ga0105246_10134381 3300011119 Bacteria 1852
89 Ga0157318_1002678 3300012482 Bacteria 987
90 Ga0157370_10065744 3300013104 Bacteria 3430
91 Ga0157370_10143335 3300013104 Bacteria 2225
92 Ga0157370_10385603 3300013104 Bacteria 1290
93 Ga0157369_10000028 3300013105 Bacteria 213910
94 Ga0157369_10033433 3300013105 Bacteria 5651
95 Ga0157369_10036296 3300013105 Bacteria 5401
96 Ga0157369_10250508 3300013105 Bacteria 1848
97 Ga0157369_10251179 3300013105 Bacteria 1846
98 Ga0157374_10250699 3300013296 Bacteria 1742
99 Ga0157378_10000742 3300013297 Bacteria 30520
100 Ga0157378_10070937 3300013297 Bacteria 3128
101 Ga0163162_10336833 3300013306 Bacteria 1641
102 Ga0157372_10000445 3300013307 Bacteria 45478
103 Ga0157372_10001622 3300013307 Bacteria 24395
104 Ga0157372_10007949 3300013307 Bacteria 11273
105 Ga0157372_10077499 3300013307 Bacteria 3754
106 Ga0157372_10148079 3300013307 Bacteria 2708
107 Ga0157375_10007115 3300013308 Bacteria 9774
108 Ga0157375_10027396 3300013308 Bacteria 5326
109 Ga0157375_10053416 3300013308 Bacteria 3975
110 Ga0163163_10000863 3300014325 Bacteria 25845
111 Ga0163163_10013489 3300014325 Bacteria 7486
112 Ga0157379_10004344 3300014968 Bacteria 12122
113 Ga0157376_10007777 3300014969 Bacteria 7684
114 Ga0157376_10023869 3300014969 Bacteria 4795
115 Ga0157376_10078336 3300014969 Bacteria 2830
116 Ga0183360_10001 3300015689 Bacteria 3943671
117 Ga0207425_1003211 3300025245 Bacteria 5341
118 Ga0209673_1030054 3300025273 Bacteria 1718
119 Ga0209130_1013549 3300025284 Bacteria 2083
120 Ga0209675_1015497 3300025291 Bacteria 2260
121 Ga0209675_1019894 3300025291 Bacteria 1834
122 Ga0209676_1000700 3300025292 Bacteria 46962
123 Ga0209676_1002544 3300025292 Bacteria 12688
124 Ga0209676_1003692 3300025292 Bacteria 9147
125 Ga0209676_1007721 3300025292 Bacteria 4967
126 Ga0209676_1008903 3300025292 Bacteria 4410
127 Ga0209676_1019170 3300025292 Bacteria 2362
128 Ga0209025_1000005 3300025294 Bacteria 1272149
129 Ga0209025_1003524 3300025294 Bacteria 14690
130 Ga0209025_1004601 3300025294 Bacteria 11811
131 Ga0209564_1024564 3300025295 Bacteria 2055
132 Ga0209564_1040682 3300025295 Bacteria 1259
133 Ga0209758_1013511 3300025297 Bacteria 4443
134 Ga0209758_1035672 3300025297 Bacteria 1956
135 Ga0209758_1047779 3300025297 Bacteria 1528
136 Ga0209050_1004106 3300025298 Bacteria 10168
137 Ga0209050_1045692 3300025298 Bacteria 1158
138 Ga0209256_1004239 3300025299 Bacteria 9189
139 Ga0209256_1005189 3300025299 Bacteria 7655
140 Ga0209256_1011181 3300025299 Bacteria 3627
141 Ga0209051_1016757 3300025303 Bacteria 3298
142 Ga0209257_1000570 3300025304 Bacteria 62283
143 Ga0209257_1000615 3300025304 Bacteria 58010
144 Ga0209257_1003026 3300025304 Bacteria 15212
145 Ga0209257_1003530 3300025304 Bacteria 13299
146 Ga0209257_1020074 3300025304 Bacteria 2486
147 Ga0209257_1026596 3300025304 Bacteria 1945
148 Ga0207680_10001160 3300025903 Bacteria 12418
149 Ga0207647_10005182 3300025904 Bacteria 9592
150 Ga0207647_10304572 3300025904 Bacteria 907
151 Ga0207654_10061694 3300025911 Bacteria 2194
152 Ga0207707_10000699 3300025912 Bacteria 33304
153 Ga0207695_10000094 3300025913 Bacteria 265779
154 Ga0207695_10119865 3300025913 Bacteria 2601
155 Ga0207671_10001138 3300025914 Bacteria 31946
156 Ga0207671_10007824 3300025914 Bacteria 9191
157 Ga0207671_10140133 3300025914 Bacteria 1863
158 Ga0207660_10050763 3300025917 Bacteria 2946
159 Ga0207657_10003945 3300025919 Bacteria 15757
160 Ga0207657_10005275 3300025919 Bacteria 13543
161 Ga0207657_10054008 3300025919 Bacteria 3477
162 Ga0207657_10329171 3300025919 Bacteria 1207
163 Ga0207649_10001479 3300025920 Bacteria 13790
164 Ga0207649_10103171 3300025920 Bacteria 1892
165 Ga0207652_10096250 3300025921 Bacteria 2608
166 Ga0207652_10192384 3300025921 Bacteria 1835
167 Ga0207681_10065078 3300025923 Bacteria 2519
168 Ga0207694_10010172 3300025924 Bacteria 7089
169 Ga0207659_10214991 3300025926 Bacteria 1543
170 Ga0207644_10235718 3300025931 Bacteria 1455
171 Ga0207690_10127698 3300025932 Bacteria 1856
172 Ga0207691_10000928 3300025940 Bacteria 29105
173 Ga0207691_10062331 3300025940 Bacteria 3384
174 Ga0207689_10024419 3300025942 Bacteria 5072
175 Ga0207661_10086656 3300025944 Bacteria 2599
176 Ga0207667_10007474 3300025949 Bacteria 13129
177 Ga0207667_10092266 3300025949 Bacteria 3128
178 Ga0207667_10195924 3300025949 Bacteria 2073
179 Ga0207712_10030014 3300025961 Bacteria 3653
180 Ga0207668_10360897 3300025972 Bacteria 1217
181 Ga0207703_10114740 3300026035 Bacteria 2304
182 Ga0207639_10001512 3300026041 Bacteria 15628
183 Ga0207639_10499142 3300026041 Bacteria 1111
184 Ga0207678_10025756 3300026067 Bacteria 5133
185 Ga0207702_10011594 3300026078 Bacteria 7345
186 Ga0207702_10834709 3300026078 Bacteria 912
187 Ga0207641_10075285 3300026088 Bacteria 2915
188 Ga0207641_10077854 3300026088 Bacteria 2870
189 Ga0207676_10182799 3300026095 Bacteria 1837
190 Ga0207674_10002112 3300026116 Bacteria 25126
191 Ga0207683_10521991 3300026121 Bacteria 1097
192 Ga0207698_10026723 3300026142 Bacteria 4086
193 Ga0207698_10549420 3300026142 Bacteria 1132
194 Ga0209981_1001761 3300027378 Bacteria 2738
195 Ga0209983_1018359 3300027665 Bacteria 1452
196 Ga0209974_10007408 3300027876 Bacteria 3782
197 Ga0268264_10018138 3300028381 Bacteria 5755
198 Ga0314311_1257047 3300030733 Bacteria 1480
199 Ga0307513_10024140 3300031456 Bacteria 7080
200 Ga0307405_10170446 3300031731 Bacteria 1552
201 Ga0307413_10003090 3300031824 Bacteria 6922
202 Ga0307406_10033911 3300031901 Bacteria 3128
203 Ga0307412_10563690 3300031911 Bacteria 959
204 Ga0307414_10002154 3300032004 Bacteria 10273
205 Ga0307414_10003875 3300032004 Bacteria 8055
206 Ga0307414_10215815 3300032004 Bacteria 1571
207 Ga0307414_10407455 3300032004 Bacteria 1182
208 Ga0307414_10438763 3300032004 Bacteria 1142
209 Ga0307411_10054578 3300032005 Bacteria 2624
210 Ga0373924_0107207 3300035410 Bacteria 1205
211 Ga0373933_0160098 3300035724 Bacteria 1429
212 Ga0395900_0112456 3300037418 Bacteria 2796
213 Ga0395900_0195915 3300037418 Bacteria 2047
214 Ga0395905_0109833 3300037471 Bacteria 2589
215 Ga0395905_0153241 3300037471 Bacteria 2168
216 Ga0395905_0182149 3300037471 Bacteria 1972
217 Ga0395901_0013851 3300038443 Bacteria 8204
218 Ga0436365_1878631 3300039437 Bacteria 1562
219 Ga0439436_0015465 3300041404 Bacteria 2296
220 Ga0439436_0036104 3300041404 Bacteria 1426
221 Ga0439439_0007082 3300041406 Bacteria 2614
222 Ga0439447_003418 3300041407 Bacteria 5645
223 Ga0451797_0268753 3300041453 Bacteria 1905
224 Ga0439449_0000868 3300042007 Bacteria 11796
225 Ga0439449_0027167 3300042007 Bacteria 2136
226 Ga0439449_0103892 3300042007 Bacteria 1051
227 Ga0439457_052547 3300042014 Bacteria 916
228 Ga0439462_0029848 3300042015 Bacteria 1442
229 Ga0495639_0213119 3300046475 Bacteria 948
230 Ga0495663_0002289 3300046525 Bacteria 5800
231 Ga0495663_0085679 3300046525 Bacteria 1021
232 Ga0495621_0036238 3300046539 Bacteria 1712
233 Ga0495621_0078773 3300046539 Bacteria 1226
234 Ga0495656_0003858 3300046615 Bacteria 5099
235 Ga0495656_0085157 3300046615 Bacteria 1435
236 Ga0495668_0032132 3300046616 Bacteria 2955
237 Ga0495668_0034812 3300046616 Bacteria 2824
238 Ga0495659_0129000 3300046664 Bacteria 1002
239 Ga0495647_0035116 3300046681 Bacteria 1881
240 Ga0495658_0020445 3300046683 Bacteria 3473
241 Ga0495604_0240819 3300047317 Bacteria 1237
242 Ga0495636_0000021 3300047318 Bacteria 72964
243 Ga0495636_0008386 3300047318 Bacteria 4079
244 Ga0495636_0017667 3300047318 Bacteria 2856
245 Ga0495677_0067744 3300047445 Bacteria 1328
246 Ga0496101_0033138 3300048904 Bacteria 3642
247 Ga0496101_0061834 3300048904 Bacteria 2721
248 Ga0496104_0000020 3300048907 Bacteria 247296
249 Ga0496105_0000015 3300048908 Bacteria 218758
250 Ga0496106_0054476 3300048909 Bacteria 3022
251 Ga0496107_0221489 3300048910 Bacteria 1408
252 Ga0496108_0053148 3300048911 Bacteria 3396
253 Ga0496112_0182305 3300048915 Bacteria 2063
254 Ga0496112_0276290 3300048915 Bacteria 1627
255 Ga0496121_0001610 3300048924 Bacteria 37474
256 Ga0501031_0009879 3300049568 Bacteria 6212
257 Ga0501031_0042227 3300049568 Bacteria 2977
258 Ga0501032_0004309 3300049569 Bacteria 10746
259 Ga0501032_0008307 3300049569 Bacteria 7565
260 Ga0501033_0000329 3300049570 Bacteria 45324
261 Ga0501034_0000498 3300049571 Bacteria 63644
262 Ga0501034_0019091 3300049571 Bacteria 7019
263 Ga0501034_0049790 3300049571 Bacteria 4227
264 Ga0501034_0109190 3300049571 Bacteria 2757
265 Ga0501036_0005648 3300049572 Bacteria 10147
266 Ga0501036_0043257 3300049572 Bacteria 3814
267 Ga0501037_0005330 3300049573 Bacteria 9354
268 Ga0501037_0007353 3300049573 Bacteria 8055
269 Ga0501038_0002332 3300049574 Bacteria 17683
270 Ga0501038_0020247 3300049574 Bacteria 5984
271 Ga0501039_0003401 3300049575 Bacteria 11893
272 Ga0501039_0033366 3300049575 Bacteria 3969
273 Ga0501040_0345137 3300049576 Bacteria 1066
274 Ga0501043_0009988 3300049579 Bacteria 7447
275 Ga0501043_0049867 3300049579 Bacteria 3291
276 Ga0501043_0103923 3300049579 Bacteria 2232
277 Ga0501047_0059703 3300049581 Bacteria 3682
278 Ga0501047_0060400 3300049581 Bacteria 3658
279 Ga0501048_0011325 3300049582 Bacteria 6651
280 Ga0501048_0408427 3300049582 Bacteria 971
281 Ga0501067_0155736 3300049583 Bacteria 1273
282 Ga0501068_0012805 3300049584 Bacteria 4762
283 Ga0501070_0012116 3300049586 Bacteria 7278
284 Ga0501071_0376941 3300049587 Bacteria 1081
285 Ga0501073_0006743 3300049589 Bacteria 8548
286 Ga0501073_0059684 3300049589 Bacteria 2663
287 Ga0501073_0124125 3300049589 Bacteria 1789
288 Ga0501074_0031601 3300049590 Bacteria 3835
289 Ga0501076_0123305 3300049592 Bacteria 2099
290 Ga0501079_0609037 3300049741 Bacteria 859
291 Ga0501080_0004696 3300049742 Bacteria 12187
292 Ga0501080_0027236 3300049742 Bacteria 5316
293 Ga0501035_0018283 3300049822 Bacteria 6457
294 Ga0501035_0028592 3300049822 Bacteria 5089
295 Ga0501035_0032477 3300049822 Bacteria 4749
296 Ga0501044_0006675 3300049823 Bacteria 12721
297 Ga0501044_0026247 3300049823 Bacteria 6168
298 Ga0501045_0098999 3300049824 Bacteria 2157
299 nmdc:mga00v17_184956_c1 3300050491 Bacteria 1345
300 nmdc:mga00v17_35399_c1 3300050491 Bacteria 2971
301 Ga0500651_0001442 3300053093 Bacteria 11965
302 Ga0500566_0156774 3300053094 Bacteria 1191
303 Ga0501084_0099702 3300054114 Bacteria 2439

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10170446 Ga0307405_101704461 236
2 3300035724 Ga0373933_0160098 Ga0373933_0160098_27_755 237
3 3300005293 Ga0065715_10107973 Ga0065715_101079732 250
4 3300048924 Ga0496121_0001610 Ga0496121_0001610_17640_18437 251
5 3300025294 Ga0209025_1003524 Ga0209025_10035248 253
6 3300032004 Ga0307414_10407455 Ga0307414_104074552 253
7 3300042007 Ga0439449_0000868 Ga0439449_0000868_8373_9170 253
8 3300027378 Ga0209981_1001761 Ga0209981_10017613 255
9 3300027665 Ga0209983_1018359 Ga0209983_10183591 255
10 3300041404 Ga0439436_0015465 Ga0439436_0015465_1109_1906 257
11 3300041406 Ga0439439_0007082 Ga0439439_0007082_1663_2460 257
12 3300042007 Ga0439449_0027167 Ga0439449_0027167_942_1739 257
13 3300042014 Ga0439457_052547 Ga0439457_052547_32_829 257
14 3300042015 Ga0439462_0029848 Ga0439462_0029848_109_906 257
15 3300005288 Ga0065714_10017937 Ga0065714_100179371 259
16 3300013297 Ga0157378_10000742 Ga0157378_1000074228 259
17 3300027876 Ga0209974_10007408 Ga0209974_100074083 259
18 3300005327 Ga0070658_10115895 Ga0070658_101158953 260
19 3300005334 Ga0068869_100037648 Ga0068869_1000376482 260
20 3300005335 Ga0070666_10000643 Ga0070666_100006436 260
21 3300005335 Ga0070666_10006812 Ga0070666_100068123 260
22 3300005344 Ga0070661_100001611 Ga0070661_1000016114 260
23 3300005344 Ga0070661_100016345 Ga0070661_1000163455 260
24 3300005366 Ga0070659_100233103 Ga0070659_1002331031 260
25 3300005367 Ga0070667_100120315 Ga0070667_1001203151 260
26 3300005530 Ga0070679_100084989 Ga0070679_1000849893 260
27 3300005539 Ga0068853_100010874 Ga0068853_1000108745 260
28 3300005539 Ga0068853_100071311 Ga0068853_1000713112 260
29 3300005563 Ga0068855_100004858 Ga0068855_1000048588 260
30 3300005578 Ga0068854_100041884 Ga0068854_1000418843 260
31 3300005614 Ga0068856_100010785 Ga0068856_1000107852 260
32 3300005614 Ga0068856_100753937 Ga0068856_1007539372 260
33 3300005616 Ga0068852_100016190 Ga0068852_1000161904 260
34 3300005617 Ga0068859_100087241 Ga0068859_1000872413 260
35 3300005618 Ga0068864_100017999 Ga0068864_1000179992 260
36 3300005841 Ga0068863_100000773 Ga0068863_10000077315 260
37 3300005842 Ga0068858_100423689 Ga0068858_1004236892 260
38 3300005843 Ga0068860_100027833 Ga0068860_1000278334 260
39 3300006358 Ga0068871_100172714 Ga0068871_1001727141 260
40 3300006931 Ga0097620_100087241 Ga0097620_1000872413 260
41 3300009093 Ga0105240_10096470 Ga0105240_100964703 260
42 3300009174 Ga0105241_10003106 Ga0105241_100031064 260
43 3300009174 Ga0105241_10072803 Ga0105241_100728032 260
44 3300009545 Ga0105237_10002972 Ga0105237_100029728 260
45 3300009545 Ga0105237_10366938 Ga0105237_103669383 260
46 3300009551 Ga0105238_10182572 Ga0105238_101825722 260
47 3300009553 Ga0105249_10312277 Ga0105249_103122772 260
48 3300010375 Ga0105239_10011101 Ga0105239_100111015 260
49 3300010375 Ga0105239_10044717 Ga0105239_100447174 260
50 3300010375 Ga0105239_10228018 Ga0105239_102280182 260
51 3300011119 Ga0105246_10013661 Ga0105246_100136615 260
52 3300013104 Ga0157370_10065744 Ga0157370_100657441 260
53 3300013105 Ga0157369_10033433 Ga0157369_100334335 260
54 3300013105 Ga0157369_10250508 Ga0157369_102505083 260
55 3300013306 Ga0163162_10336833 Ga0163162_103368332 260
56 3300013307 Ga0157372_10000445 Ga0157372_1000044527 260
57 3300013307 Ga0157372_10148079 Ga0157372_101480792 260
58 3300014325 Ga0163163_10000863 Ga0163163_100008634 260
59 3300014325 Ga0163163_10013489 Ga0163163_100134893 260
60 3300014968 Ga0157379_10004344 Ga0157379_100043445 260
61 3300025903 Ga0207680_10001160 Ga0207680_100011606 260
62 3300025904 Ga0207647_10005182 Ga0207647_100051825 260
63 3300025904 Ga0207647_10304572 Ga0207647_103045722 260
64 3300025913 Ga0207695_10000094 Ga0207695_1000009458 260
65 3300025914 Ga0207671_10007824 Ga0207671_100078244 260
66 3300025914 Ga0207671_10140133 Ga0207671_101401333 260
67 3300025919 Ga0207657_10005275 Ga0207657_100052753 260
68 3300025920 Ga0207649_10001479 Ga0207649_1000147911 260
69 3300025932 Ga0207690_10127698 Ga0207690_101276982 260
70 3300025944 Ga0207661_10086656 Ga0207661_100866562 260
71 3300025949 Ga0207667_10007474 Ga0207667_100074745 260
72 3300026035 Ga0207703_10114740 Ga0207703_101147402 260
73 3300026041 Ga0207639_10001512 Ga0207639_100015127 260
74 3300026041 Ga0207639_10499142 Ga0207639_104991422 260
75 3300026078 Ga0207702_10011594 Ga0207702_100115944 260
76 3300026088 Ga0207641_10077854 Ga0207641_100778542 260
77 3300026095 Ga0207676_10182799 Ga0207676_101827992 260
78 3300026116 Ga0207674_10002112 Ga0207674_1000211214 260
79 3300026121 Ga0207683_10521991 Ga0207683_105219912 260
80 3300026142 Ga0207698_10026723 Ga0207698_100267231 260
81 3300049568 Ga0501031_0009879 Ga0501031_0009879_3801_4625 260
82 3300049582 Ga0501048_0408427 Ga0501048_0408427_70_870 260
83 3300005530 Ga0070679_100014507 Ga0070679_1000145077 261
84 3300005546 Ga0070696_100273988 Ga0070696_1002739882 261
85 3300005563 Ga0068855_100012573 Ga0068855_1000125735 261
86 3300005578 Ga0068854_100014016 Ga0068854_1000140167 261
87 3300009177 Ga0105248_10389457 Ga0105248_103894573 261
88 3300013307 Ga0157372_10001622 Ga0157372_1000162218 261
89 3300025912 Ga0207707_10000699 Ga0207707_100006992 261
90 3300025917 Ga0207660_10050763 Ga0207660_100507632 261
91 3300025921 Ga0207652_10192384 Ga0207652_101923842 261
92 3300025949 Ga0207667_10092266 Ga0207667_100922663 261
93 3300026067 Ga0207678_10025756 Ga0207678_100257564 261
94 iso_pu_bacteria 2571042365 2572255108 261
95 iso_pu_bacteria 2643221593 2643976558 261
96 iso_pu_bacteria 2643221695 2644528935 261
97 iso_pu_bacteria 2894414249 2894415343 261
98 iso_pu_bacteria 2941489479 2941490598 261
99 iso_pu_bacteria 2995948881 2995951445 261
100 iso_pu_bacteria 8002869464 8002871792 261
101 iso_pu_bacteria 8003014200 8003014493 261
102 3300005616 Ga0068852_100599054 Ga0068852_1005990541 262
103 3300005617 Ga0068859_100199736 Ga0068859_1001997362 262
104 3300005841 Ga0068863_100083687 Ga0068863_1000836873 262
105 3300006931 Ga0097620_100199742 Ga0097620_1001997422 262
106 3300009551 Ga0105238_10010010 Ga0105238_100100106 262
107 3300011119 Ga0105246_10134381 Ga0105246_101343812 262
108 3300013297 Ga0157378_10070937 Ga0157378_100709373 262
109 3300013308 Ga0157375_10053416 Ga0157375_100534164 262
110 3300014969 Ga0157376_10023869 Ga0157376_100238694 262
111 3300025924 Ga0207694_10010172 Ga0207694_100101726 262
112 3300026088 Ga0207641_10075285 Ga0207641_100752853 262
113 3300026142 Ga0207698_10549420 Ga0207698_105494202 262
114 3300005367 Ga0070667_100071346 Ga0070667_1000713462 263
115 3300005539 Ga0068853_100415387 Ga0068853_1004153872 263
116 3300013104 Ga0157370_10143335 Ga0157370_101433352 263
117 3300013307 Ga0157372_10007949 Ga0157372_100079497 263
118 3300025919 Ga0207657_10329171 Ga0207657_103291712 263
119 3300025949 Ga0207667_10195924 Ga0207667_101959242 263
120 3300041453 Ga0451797_0268753 Ga0451797_0268753_570_1367 263
121 3300049569 Ga0501032_0004309 Ga0501032_0004309_980_1780 263
122 3300049570 Ga0501033_0000329 Ga0501033_0000329_1074_1874 263
123 3300049571 Ga0501034_0019091 Ga0501034_0019091_457_1257 263
124 3300049572 Ga0501036_0005648 Ga0501036_0005648_7982_8782 263
125 3300049573 Ga0501037_0007353 Ga0501037_0007353_3216_4016 263
126 3300049574 Ga0501038_0002332 Ga0501038_0002332_16416_17216 263
127 3300049575 Ga0501039_0003401 Ga0501039_0003401_724_1524 263
128 3300049576 Ga0501040_0345137 Ga0501040_0345137_159_959 263
129 3300049579 Ga0501043_0049867 Ga0501043_0049867_480_1280 263
130 3300049581 Ga0501047_0060400 Ga0501047_0060400_980_1780 263
131 3300049582 Ga0501048_0011325 Ga0501048_0011325_1554_2354 263
132 3300049584 Ga0501068_0012805 Ga0501068_0012805_1651_2451 263
133 3300049587 Ga0501071_0376941 Ga0501071_0376941_236_1036 263
134 3300049589 Ga0501073_0006743 Ga0501073_0006743_1879_2679 263
135 3300049589 Ga0501073_0124125 Ga0501073_0124125_725_1525 263
136 3300049590 Ga0501074_0031601 Ga0501074_0031601_2398_3198 263
137 3300049592 Ga0501076_0123305 Ga0501076_0123305_377_1177 263
138 3300049741 Ga0501079_0609037 Ga0501079_0609037_13_813 263
139 3300049742 Ga0501080_0027236 Ga0501080_0027236_4128_4928 263
140 3300049822 Ga0501035_0028592 Ga0501035_0028592_874_1674 263
141 3300049822 Ga0501035_0032477 Ga0501035_0032477_1643_2443 263
142 3300049823 Ga0501044_0006675 Ga0501044_0006675_10613_11413 263
143 3300049824 Ga0501045_0098999 Ga0501045_0098999_264_1064 263
144 3300053093 Ga0500651_0001442 Ga0500651_0001442_1476_2288 263
145 3300054114 Ga0501084_0099702 Ga0501084_0099702_1480_2280 263
146 3300005578 Ga0068854_100367895 Ga0068854_1003678951 264
147 3300005843 Ga0068860_100020581 Ga0068860_1000205817 264
148 3300006881 Ga0068865_100017242 Ga0068865_1000172423 264
149 3300009093 Ga0105240_10186505 Ga0105240_101865052 264
150 3300009093 Ga0105240_10209705 Ga0105240_102097052 264
151 3300009174 Ga0105241_10012367 Ga0105241_100123673 264
152 3300009176 Ga0105242_10012457 Ga0105242_100124575 264
153 3300009553 Ga0105249_10036904 Ga0105249_100369045 264
154 3300010375 Ga0105239_10019741 Ga0105239_100197411 264
155 3300013105 Ga0157369_10000028 Ga0157369_1000002861 264
156 3300013308 Ga0157375_10027396 Ga0157375_100273965 264
157 3300014969 Ga0157376_10007777 Ga0157376_100077772 264
158 3300014969 Ga0157376_10078336 Ga0157376_100783363 264
159 3300025911 Ga0207654_10061694 Ga0207654_100616942 264
160 3300025913 Ga0207695_10119865 Ga0207695_101198653 264
161 3300025914 Ga0207671_10001138 Ga0207671_100011385 264
162 3300025961 Ga0207712_10030014 Ga0207712_100300142 264
163 3300026078 Ga0207702_10834709 Ga0207702_108347091 264
164 3300028381 Ga0268264_10018138 Ga0268264_100181383 264
165 3300035410 Ga0373924_0107207 Ga0373924_0107207_204_1028 264
166 3300039437 Ga0436365_1878631 Ga0436365_1878631_577_1386 264
167 3300046475 Ga0495639_0213119 Ga0495639_0213119_79_903 264
168 3300046681 Ga0495647_0035116 Ga0495647_0035116_960_1784 264
169 3300046683 Ga0495658_0020445 Ga0495658_0020445_281_1105 264
170 3300047317 Ga0495604_0240819 Ga0495604_0240819_178_1002 264
171 3300048907 Ga0496104_0000020 Ga0496104_0000020_45822_46646 264
172 3300048908 Ga0496105_0000015 Ga0496105_0000015_13889_14713 264
173 3300053094 Ga0500566_0156774 Ga0500566_0156774_190_1014 264
174 3300003187 JGI25151J46595_10000774 JGI25151J46595_100007743 265
175 3300003187 JGI25151J46595_10014047 JGI25151J46595_100140472 265
176 3300003771 Ga0055526_1000071 Ga0055526_10000715 265
177 3300003771 Ga0055526_1017541 Ga0055526_10175413 265
178 3300003773 Ga0055537_1000376 Ga0055537_100037628 265
179 3300003775 Ga0055524_1000041 Ga0055524_10000415 265
180 3300003775 Ga0055524_1007439 Ga0055524_10074394 265
181 3300003781 Ga0055536_1001543 Ga0055536_10015439 265
182 3300003781 Ga0055536_1022028 Ga0055536_10220282 265
183 3300003784 Ga0055534_1000040 Ga0055534_1000040108 265
184 3300003790 Ga0055528_1000017 Ga0055528_10000175 265
185 3300003791 Ga0055530_10008977 Ga0055530_100089774 265
186 3300003794 Ga0055531_10003012 Ga0055531_100030129 265
187 3300003794 Ga0055531_10004233 Ga0055531_100042335 265
188 3300003794 Ga0055531_10026160 Ga0055531_100261602 265
189 3300003794 Ga0055531_10033025 Ga0055531_100330252 265
190 3300003794 Ga0055531_10033308 Ga0055531_100333081 265
191 3300003794 Ga0055531_10057561 Ga0055531_100575611 265
192 3300005293 Ga0065715_10132133 Ga0065715_101321332 265
193 3300005334 Ga0068869_100212415 Ga0068869_1002124152 265
194 3300005337 Ga0070682_100279547 Ga0070682_1002795471 265
195 3300005339 Ga0070660_100536108 Ga0070660_1005361081 265
196 3300005344 Ga0070661_100186137 Ga0070661_1001861372 265
197 3300005355 Ga0070671_100029011 Ga0070671_1000290113 265
198 3300005366 Ga0070659_100327765 Ga0070659_1003277652 265
199 3300005530 Ga0070679_100304560 Ga0070679_1003045602 265
200 3300005543 Ga0070672_100036187 Ga0070672_1000361872 265
201 3300005543 Ga0070672_100047734 Ga0070672_1000477342 265
202 3300005718 Ga0068866_10080735 Ga0068866_100807351 265
203 3300006051 Ga0075364_10270179 Ga0075364_102701792 265
204 3300012482 Ga0157318_1002678 Ga0157318_10026781 265
205 3300013104 Ga0157370_10385603 Ga0157370_103856032 265
206 3300013105 Ga0157369_10036296 Ga0157369_100362962 265
207 3300013105 Ga0157369_10251179 Ga0157369_102511792 265
208 3300013296 Ga0157374_10250699 Ga0157374_102506992 265
209 3300013307 Ga0157372_10077499 Ga0157372_100774994 265
210 3300013308 Ga0157375_10007115 Ga0157375_100071153 265
211 3300015689 Ga0183360_10001 Ga0183360_100011763 265
212 3300025245 Ga0207425_1003211 Ga0207425_10032115 265
213 3300025273 Ga0209673_1030054 Ga0209673_10300542 265
214 3300025284 Ga0209130_1013549 Ga0209130_10135492 265
215 3300025291 Ga0209675_1015497 Ga0209675_10154971 265
216 3300025291 Ga0209675_1019894 Ga0209675_10198941 265
217 3300025292 Ga0209676_1000700 Ga0209676_100070011 265
218 3300025292 Ga0209676_1002544 Ga0209676_10025442 265
219 3300025292 Ga0209676_1003692 Ga0209676_10036925 265
220 3300025292 Ga0209676_1007721 Ga0209676_10077213 265
221 3300025292 Ga0209676_1008903 Ga0209676_10089033 265
222 3300025292 Ga0209676_1019170 Ga0209676_10191702 265
223 3300025294 Ga0209025_1000005 Ga0209025_1000005489 265
224 3300025294 Ga0209025_1004601 Ga0209025_10046012 265
225 3300025295 Ga0209564_1024564 Ga0209564_10245642 265
226 3300025295 Ga0209564_1040682 Ga0209564_10406821 265
227 3300025297 Ga0209758_1013511 Ga0209758_10135113 265
228 3300025297 Ga0209758_1035672 Ga0209758_10356722 265
229 3300025297 Ga0209758_1047779 Ga0209758_10477791 265
230 3300025298 Ga0209050_1004106 Ga0209050_100410610 265
231 3300025298 Ga0209050_1045692 Ga0209050_10456921 265
232 3300025299 Ga0209256_1004239 Ga0209256_10042395 265
233 3300025299 Ga0209256_1005189 Ga0209256_10051895 265
234 3300025299 Ga0209256_1011181 Ga0209256_10111811 265
235 3300025303 Ga0209051_1016757 Ga0209051_10167572 265
236 3300025304 Ga0209257_1000570 Ga0209257_100057051 265
237 3300025304 Ga0209257_1000615 Ga0209257_10006154 265
238 3300025304 Ga0209257_1003026 Ga0209257_10030265 265
239 3300025304 Ga0209257_1003530 Ga0209257_10035304 265
240 3300025304 Ga0209257_1020074 Ga0209257_10200743 265
241 3300025304 Ga0209257_1026596 Ga0209257_10265962 265
242 3300025919 Ga0207657_10003945 Ga0207657_100039453 265
243 3300025919 Ga0207657_10054008 Ga0207657_100540083 265
244 3300025920 Ga0207649_10103171 Ga0207649_101031713 265
245 3300025921 Ga0207652_10096250 Ga0207652_100962502 265
246 3300025923 Ga0207681_10065078 Ga0207681_100650782 265
247 3300025926 Ga0207659_10214991 Ga0207659_102149912 265
248 3300025931 Ga0207644_10235718 Ga0207644_102357182 265
249 3300025940 Ga0207691_10000928 Ga0207691_100009285 265
250 3300025940 Ga0207691_10062331 Ga0207691_100623312 265
251 3300025942 Ga0207689_10024419 Ga0207689_100244193 265
252 3300025972 Ga0207668_10360897 Ga0207668_103608972 265
253 3300030733 Ga0314311_1257047 Ga0314311_12570471 265
254 3300031456 Ga0307513_10024140 Ga0307513_100241403 265
255 3300031824 Ga0307413_10003090 Ga0307413_100030903 265
256 3300031901 Ga0307406_10033911 Ga0307406_100339112 265
257 3300031911 Ga0307412_10563690 Ga0307412_105636901 265
258 3300032004 Ga0307414_10002154 Ga0307414_100021546 265
259 3300032004 Ga0307414_10003875 Ga0307414_100038758 265
260 3300032004 Ga0307414_10215815 Ga0307414_102158152 265
261 3300032004 Ga0307414_10438763 Ga0307414_104387632 265
262 3300032005 Ga0307411_10054578 Ga0307411_100545783 265
263 3300037418 Ga0395900_0112456 Ga0395900_0112456_1033_1863 265
264 3300037418 Ga0395900_0195915 Ga0395900_0195915_751_1548 265
265 3300037471 Ga0395905_0109833 Ga0395905_0109833_97_909 265
266 3300037471 Ga0395905_0153241 Ga0395905_0153241_191_994 265
267 3300037471 Ga0395905_0182149 Ga0395905_0182149_78_908 265
268 3300038443 Ga0395901_0013851 Ga0395901_0013851_541_1371 265
269 3300041404 Ga0439436_0036104 Ga0439436_0036104_225_1022 265
270 3300041407 Ga0439447_003418 Ga0439447_003418_4171_4968 265
271 3300042007 Ga0439449_0103892 Ga0439449_0103892_186_983 265
272 3300046525 Ga0495663_0002289 Ga0495663_0002289_1176_1973 265
273 3300046525 Ga0495663_0085679 Ga0495663_0085679_171_968 265
274 3300046539 Ga0495621_0036238 Ga0495621_0036238_710_1507 265
275 3300046539 Ga0495621_0078773 Ga0495621_0078773_150_965 265
276 3300046615 Ga0495656_0003858 Ga0495656_0003858_4205_5002 265
277 3300046615 Ga0495656_0085157 Ga0495656_0085157_76_873 265
278 3300046616 Ga0495668_0032132 Ga0495668_0032132_1310_2107 265
279 3300046616 Ga0495668_0034812 Ga0495668_0034812_525_1322 265
280 3300046664 Ga0495659_0129000 Ga0495659_0129000_192_989 265
281 3300047318 Ga0495636_0000021 Ga0495636_0000021_4941_5738 265
282 3300047318 Ga0495636_0008386 Ga0495636_0008386_2546_3343 265
283 3300047318 Ga0495636_0017667 Ga0495636_0017667_1137_1934 265
284 3300047445 Ga0495677_0067744 Ga0495677_0067744_63_860 265
285 3300048904 Ga0496101_0033138 Ga0496101_0033138_1625_2518 265
286 3300048904 Ga0496101_0061834 Ga0496101_0061834_339_1184 265
287 3300048909 Ga0496106_0054476 Ga0496106_0054476_1433_2230 265
288 3300048910 Ga0496107_0221489 Ga0496107_0221489_454_1251 265
289 3300048911 Ga0496108_0053148 Ga0496108_0053148_287_1180 265
290 3300048915 Ga0496112_0182305 Ga0496112_0182305_808_1701 265
291 3300048915 Ga0496112_0276290 Ga0496112_0276290_814_1611 265
292 3300049568 Ga0501031_0042227 Ga0501031_0042227_802_1602 265
293 3300049569 Ga0501032_0008307 Ga0501032_0008307_4761_5561 265
294 3300049571 Ga0501034_0000498 Ga0501034_0000498_46583_47392 265
295 3300049571 Ga0501034_0049790 Ga0501034_0049790_1504_2304 265
296 3300049571 Ga0501034_0109190 Ga0501034_0109190_1893_2690 265
297 3300049572 Ga0501036_0043257 Ga0501036_0043257_302_1102 265
298 3300049573 Ga0501037_0005330 Ga0501037_0005330_3806_4606 265
299 3300049574 Ga0501038_0020247 Ga0501038_0020247_820_1620 265
300 3300049575 Ga0501039_0033366 Ga0501039_0033366_146_946 265
301 3300049579 Ga0501043_0009988 Ga0501043_0009988_708_1505 265
302 3300049579 Ga0501043_0103923 Ga0501043_0103923_55_855 265
303 3300049581 Ga0501047_0059703 Ga0501047_0059703_1547_2347 265
304 3300049583 Ga0501067_0155736 Ga0501067_0155736_69_869 265
305 3300049586 Ga0501070_0012116 Ga0501070_0012116_3106_3906 265
306 3300049589 Ga0501073_0059684 Ga0501073_0059684_64_864 265
307 3300049742 Ga0501080_0004696 Ga0501080_0004696_6289_7089 265
308 3300049822 Ga0501035_0018283 Ga0501035_0018283_1243_2043 265
309 3300049823 Ga0501044_0026247 Ga0501044_0026247_1022_1822 265
310 3300050491 nmdc:mga00v17_184956_c1 nmdc:mga00v17_184956_c1_274_1092 265
311 3300050491 nmdc:mga00v17_35399_c1 nmdc:mga00v17_35399_c1_253_1071 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

15

264

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e11-assembly2.cif.gz_D the crystal structure of xc1258 from xanthomonas campestris: a cn-hydrolase superfamily protein with an arsenic adduct in the active site 0.9453 1 265
2w1v-assembly1.cif.gz_B crystal structure of mouse nitrilase-2 at 1.4a resolution 0.8782 1 254
3p8k-assembly1.cif.gz_B crystal structure of a putative carbon-nitrogen family hydrolase from staphylococcus aureus 0.8633 1 263
5h8j-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.8615 2 258
3p8k-assembly1.cif.gz_B crystal structure of a putative carbon-nitrogen family hydrolase from staphylococcus aureus 0.854 1 263
ID Description Score Start End Superfamily
2e11D00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9453 1 265 3.60.110.10
af_Q47679_3_256_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9233 4 265 3.60.110.10
af_Q47679_3_256_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9163 4 265 3.60.110.10
af_Q2FWM9_1_261_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8767 4 263 3.60.110.10
af_Q2FWM9_1_261_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8703 4 263 3.60.110.10
ID Description Score Start End GO Terms
AF-W1YL83-F1-model_v4 CN hydrolase domain-containing protein 0.9688 140 228 GO:0050152
GO:0106008
AF-A0A3C1WRE1-F1-model_v4 Nitrilase family protein 0.9488 131 265 GO:0050152
GO:0106008
AF-A0A3C0B9B8-F1-model_v4 Nitrilase family protein 0.9475 134 264 GO:0050152
GO:0106008
AF-A0A6N7K6E0-F1-model_v4 deleted 0.947 1 265
AF-A0A4Q6F7R3-F1-model_v4 deleted 0.9467 1 265

Feature Viewer

pLDDT pTM Quality
86.63 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map