F401193
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 311 | 250 | 236 | 357 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10001389|Ga0157370_1000138919 |
| Length | 420 |
| Sequence | MKVGIARRGDEPGLPGFSVSRNFLQTFVILSYNISICAPEKERRMTPQSLELSGIGKGFGADDVLKEIDLSIRPGEFLSLVGMSGCGKSTLLRIIAGLETPDRGSVTIGGQDVTEIDPSDRNLAMVFQSYALYPHMSVRQNIATPLRMRRLPLAARLPLIGRFAAPAETLRQIDAAVEQAAETLQIAHLLDRKPAQLSGGQRQRVALARALVRSPAAFLMDEPLSNLDAKLRAHMREELAGLHRRLGATFIYVTHDQIEAMTMSDRIALMSEGRIEQLGTPDELYRKPATLTVARFIGTPSINLLPVEIHAGGKVTAFGRDLGVEASPATLGLRAEDLRPGAEGFAVRLTRSETHGADRFVNCRLLSDETVAITLRQAAGEVLGADENGVMNLGFAPERVHLFAADGLRRKTTVREMVPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 2 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 3 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 4 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 5 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 6 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 7 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 8 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 9 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 10 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 11 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 12 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 13 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 14 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 15 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 16 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 17 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 18 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 19 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 20 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 21 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 22 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 23 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 24 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 25 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 26 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 27 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 28 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 29 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 30 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 31 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 32 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 33 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 34 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 35 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 36 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 37 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 38 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 39 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 40 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 41 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 42 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 43 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 44 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 45 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 46 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 47 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 48 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 49 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 50 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 51 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 52 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 53 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 54 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 55 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 56 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 57 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 58 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 59 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 60 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 61 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 62 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 63 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 64 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 65 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 66 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 67 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 68 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 69 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 70 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 71 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 72 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 73 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 74 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 75 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 76 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 77 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 78 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 79 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 80 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 81 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 83 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 85 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 159 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 160 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 161 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 162 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 166 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 167 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 168 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 170 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 174 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 175 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 176 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 177 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 178 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 179 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 180 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 181 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 182 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 183 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 186 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 187 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 197 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 198 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 199 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 200 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 202 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 203 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 204 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 205 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 206 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 207 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 208 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 209 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 210 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 211 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 212 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 213 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 214 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 234 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 235 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 236 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 238 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 239 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 240 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 241 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 242 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 243 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 244 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 245 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 246 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 247 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 248 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 249 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 250 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.92 |
| Metatranscriptomes | 0.96 |
| Isolates | 24.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.96 |
| Bulb | 0 |
| Endosphere | 12.54 |
| Nodule | 9.97 |
| Rhizoplane | 4.82 |
| Rhizosphere | 54.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10000093 | 3300001989 | Bacteria | 26117 |
| 2 | JGI25155J39150_1000001 | 3300002704 | Bacteria | 354543 |
| 3 | JGI25156J39149_1000001 | 3300002705 | Bacteria | 354557 |
| 4 | JGI25154J39366_1000011 | 3300002738 | Bacteria | 296007 |
| 5 | JGI25154J39366_1001254 | 3300002738 | Bacteria | 9533 |
| 6 | JGI25157J39369_1000079 | 3300002741 | Bacteria | 86111 |
| 7 | JGI25152J39213_1002030 | 3300002773 | Bacteria | 7985 |
| 8 | JGI25151J46595_10035663 | 3300003187 | Bacteria | 1886 |
| 9 | JGI25165J46597_1000422 | 3300003214 | Bacteria | 43957 |
| 10 | JGI25165J46597_1007255 | 3300003214 | Bacteria | 1861 |
| 11 | rootL2_10014621 | 3300003322 | Bacteria | 30950 |
| 12 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 13 | JGI25161J50226_1000310 | 3300003374 | Bacteria | 27058 |
| 14 | Ga0055526_1000017 | 3300003771 | Bacteria | 210613 |
| 15 | Ga0058692_1000495 | 3300003856 | Bacteria | 17550 |
| 16 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 17 | Ga0065165_1000068 | 3300005262 | Bacteria | 170609 |
| 18 | Ga0070680_100259493 | 3300005336 | Bacteria | 1470 |
| 19 | Ga0070674_100098944 | 3300005356 | Bacteria | 2121 |
| 20 | Ga0070701_10098952 | 3300005438 | Bacteria | 1612 |
| 21 | Ga0070700_100066421 | 3300005441 | Bacteria | 2289 |
| 22 | Ga0070681_10016918 | 3300005458 | Bacteria | 7285 |
| 23 | Ga0070679_100151757 | 3300005530 | Bacteria | 2293 |
| 24 | Ga0068853_100009763 | 3300005539 | Bacteria | 7744 |
| 25 | Ga0068853_100068540 | 3300005539 | Bacteria | 3084 |
| 26 | Ga0070665_100002719 | 3300005548 | Bacteria | 19169 |
| 27 | Ga0070665_100033065 | 3300005548 | Bacteria | 5204 |
| 28 | Ga0070665_100173804 | 3300005548 | Bacteria | 2155 |
| 29 | Ga0068855_100080858 | 3300005563 | Bacteria | 3768 |
| 30 | Ga0070664_100236189 | 3300005564 | Bacteria | 1640 |
| 31 | Ga0068856_100016245 | 3300005614 | Bacteria | 7201 |
| 32 | Ga0068856_100173788 | 3300005614 | Bacteria | 2167 |
| 33 | Ga0068852_100272010 | 3300005616 | Bacteria | 1630 |
| 34 | Ga0081455_10133762 | 3300005937 | Bacteria | 1935 |
| 35 | Ga0081538_10039720 | 3300005981 | Bacteria | 3013 |
| 36 | Ga0081538_10056142 | 3300005981 | Bacteria | 2309 |
| 37 | Ga0081539_10003448 | 3300005985 | Bacteria | 19419 |
| 38 | Ga0075364_10003583 | 3300006051 | Bacteria | 8844 |
| 39 | Ga0075364_10201904 | 3300006051 | Bacteria | 1347 |
| 40 | Ga0075364_10229753 | 3300006051 | Bacteria | 1260 |
| 41 | Ga0075362_10008568 | 3300006177 | Bacteria | 3918 |
| 42 | Ga0075367_10013445 | 3300006178 | Bacteria | 4399 |
| 43 | Ga0075369_10091313 | 3300006186 | Bacteria | 1359 |
| 44 | Ga0075366_10010442 | 3300006195 | Bacteria | 5214 |
| 45 | Ga0075428_100172552 | 3300006844 | Bacteria | 2343 |
| 46 | Ga0075429_100115552 | 3300006880 | Bacteria | 2346 |
| 47 | Ga0099826_10000149 | 3300006948 | Bacteria | 29916 |
| 48 | Ga0099826_10024551 | 3300006948 | Bacteria | 4476 |
| 49 | Ga0105240_10000076 | 3300009093 | Bacteria | 198848 |
| 50 | Ga0111539_10069128 | 3300009094 | Bacteria | 4170 |
| 51 | Ga0111539_10201831 | 3300009094 | Bacteria | 2319 |
| 52 | Ga0105245_10161160 | 3300009098 | Bacteria | 2129 |
| 53 | Ga0114129_10846151 | 3300009147 | Bacteria | 1163 |
| 54 | Ga0105243_10163615 | 3300009148 | Bacteria | 1921 |
| 55 | Ga0105237_10001505 | 3300009545 | Bacteria | 30672 |
| 56 | Ga0105237_10389387 | 3300009545 | Bacteria | 1399 |
| 57 | Ga0105239_10006650 | 3300010375 | Bacteria | 13381 |
| 58 | Ga0157371_10000004 | 3300013102 | Bacteria | 512593 |
| 59 | Ga0157370_10000046 | 3300013104 | Bacteria | 125612 |
| 60 | Ga0157370_10001389 | 3300013104 | Bacteria | 29991 |
| 61 | Ga0157370_10035804 | 3300013104 | Bacteria | 4821 |
| 62 | Ga0157380_10032920 | 3300014326 | Bacteria | 3989 |
| 63 | Ga0206351_10775907 | 3300020077 | Bacteria | 6673 |
| 64 | Ga0154015_1087099 | 3300020610 | Bacteria | 7113 |
| 65 | Ga0213872_10012429 | 3300021361 | Bacteria | 4005 |
| 66 | Ga0209435_100012 | 3300025206 | Bacteria | 401621 |
| 67 | Ga0209672_104873 | 3300025228 | Bacteria | 2403 |
| 68 | Ga0209437_100047 | 3300025233 | Bacteria | 405163 |
| 69 | Ga0209646_1000026 | 3300025246 | Bacteria | 401621 |
| 70 | Ga0209026_1000014 | 3300025250 | Bacteria | 401621 |
| 71 | Ga0209677_100220 | 3300025253 | Bacteria | 41510 |
| 72 | Ga0209759_1000012 | 3300025256 | Bacteria | 401621 |
| 73 | Ga0209233_1000048 | 3300025261 | Bacteria | 453669 |
| 74 | Ga0209233_1000257 | 3300025261 | Bacteria | 80366 |
| 75 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 76 | Ga0209025_1000060 | 3300025294 | Bacteria | 305017 |
| 77 | Ga0209564_1000031 | 3300025295 | Bacteria | 494703 |
| 78 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 79 | Ga0207426_1010779 | 3300025302 | Bacteria | 3528 |
| 80 | Ga0209051_1005048 | 3300025303 | Bacteria | 7857 |
| 81 | Ga0207705_10088364 | 3300025909 | Bacteria | 2267 |
| 82 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 83 | Ga0207671_10001078 | 3300025914 | Bacteria | 33108 |
| 84 | Ga0207671_10195520 | 3300025914 | Bacteria | 1578 |
| 85 | Ga0207662_10126472 | 3300025918 | Bacteria | 1608 |
| 86 | Ga0207681_10080714 | 3300025923 | Bacteria | 2295 |
| 87 | Ga0207687_10111475 | 3300025927 | Bacteria | 2031 |
| 88 | Ga0207690_10081610 | 3300025932 | Bacteria | 2260 |
| 89 | Ga0207704_10066603 | 3300025938 | Bacteria | 2261 |
| 90 | Ga0207661_10158127 | 3300025944 | Bacteria | 1964 |
| 91 | Ga0207640_10018368 | 3300025981 | Bacteria | 4110 |
| 92 | Ga0207639_10218666 | 3300026041 | Bacteria | 1644 |
| 93 | Ga0207708_10024960 | 3300026075 | Bacteria | 4522 |
| 94 | Ga0207708_10047652 | 3300026075 | Bacteria | 3262 |
| 95 | Ga0207702_10008448 | 3300026078 | Bacteria | 8686 |
| 96 | Ga0207648_10169774 | 3300026089 | Bacteria | 1928 |
| 97 | Ga0207676_10414399 | 3300026095 | Bacteria | 1262 |
| 98 | Ga0207674_10165102 | 3300026116 | Bacteria | 2168 |
| 99 | Ga0207675_100108782 | 3300026118 | Bacteria | 2615 |
| 100 | Ga0207698_10085121 | 3300026142 | Bacteria | 2566 |
| 101 | Ga0207698_10177298 | 3300026142 | Bacteria | 1884 |
| 102 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 103 | Ga0209371_1001578 | 3300027312 | Bacteria | 14922 |
| 104 | Ga0209371_1004101 | 3300027312 | Bacteria | 6547 |
| 105 | Ga0209282_1000279 | 3300027666 | Bacteria | 25290 |
| 106 | Ga0209282_1042359 | 3300027666 | Bacteria | 2686 |
| 107 | Ga0207428_10025829 | 3300027907 | Bacteria | 4911 |
| 108 | Ga0268266_10106070 | 3300028379 | Bacteria | 2483 |
| 109 | Ga0268265_10201595 | 3300028380 | Bacteria | 1727 |
| 110 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 111 | Ga0268256_1002486 | 3300030500 | Bacteria | 9365 |
| 112 | Ga0268256_1006040 | 3300030500 | Bacteria | 4597 |
| 113 | Ga0307511_10003945 | 3300030521 | Bacteria | 15158 |
| 114 | Ga0307509_10189751 | 3300031507 | Bacteria | 1908 |
| 115 | Ga0307508_10001676 | 3300031616 | Bacteria | 24605 |
| 116 | Ga0307508_10316417 | 3300031616 | Bacteria | 1153 |
| 117 | Ga0316576_10000815 | 3300031727 | Bacteria | 15765 |
| 118 | Ga0316577_10028148 | 3300031733 | Bacteria | 3134 |
| 119 | Ga0307406_10115176 | 3300031901 | Bacteria | 1858 |
| 120 | Ga0307416_100447119 | 3300032002 | Bacteria | 1344 |
| 121 | Ga0307415_100043538 | 3300032126 | Bacteria | 2996 |
| 122 | Ga0307415_100328749 | 3300032126 | Bacteria | 1278 |
| 123 | Ga0316585_10013943 | 3300032137 | Bacteria | 2396 |
| 124 | Ga0316580_10002760 | 3300032139 | Bacteria | 4892 |
| 125 | Ga0316592_1000539 | 3300033524 | Bacteria | 5361 |
| 126 | Ga0316574_0021266 | 3300035398 | Bacteria | 3851 |
| 127 | Ga0373931_0008810 | 3300035691 | Bacteria | 4800 |
| 128 | Ga0395898_0024330 | 3300037466 | Bacteria | 6107 |
| 129 | Ga0395898_0092629 | 3300037466 | Bacteria | 2906 |
| 130 | Ga0395901_0063391 | 3300038443 | Bacteria | 3847 |
| 131 | Ga0436361_0064311 | 3300039447 | Bacteria | 6486 |
| 132 | Ga0436361_0332483 | 3300039447 | Bacteria | 5473 |
| 133 | Ga0451791_0220846 | 3300041451 | Bacteria | 2682 |
| 134 | Ga0439463_033262 | 3300042016 | Bacteria | 1304 |
| 135 | Ga0466969_0004140 | 3300044656 | Bacteria | 7700 |
| 136 | Ga0466965_0005413 | 3300044683 | Bacteria | 5752 |
| 137 | Ga0466966_0033538 | 3300044684 | Bacteria | 3324 |
| 138 | Ga0466966_0071752 | 3300044684 | Bacteria | 2169 |
| 139 | Ga0466961_0005863 | 3300044693 | Bacteria | 7782 |
| 140 | Ga0466964_0005324 | 3300044706 | Bacteria | 4777 |
| 141 | Ga0466971_0005129 | 3300044719 | Bacteria | 5673 |
| 142 | Ga0466968_0051505 | 3300044735 | Bacteria | 1759 |
| 143 | Ga0466970_0000910 | 3300044765 | Bacteria | 14307 |
| 144 | Ga0466957_0022322 | 3300044842 | Bacteria | 3733 |
| 145 | Ga0466960_0121332 | 3300044901 | Bacteria | 1369 |
| 146 | Ga0466959_0009180 | 3300045049 | Bacteria | 7023 |
| 147 | Ga0466959_0036167 | 3300045049 | Bacteria | 3648 |
| 148 | Ga0466958_0008426 | 3300045836 | Bacteria | 5717 |
| 149 | Ga0466967_0025827 | 3300045976 | Bacteria | 4850 |
| 150 | Ga0466967_0065211 | 3300045976 | Bacteria | 3241 |
| 151 | Ga0466967_0227109 | 3300045976 | Bacteria | 1776 |
| 152 | Ga0466967_0392843 | 3300045976 | Bacteria | 1348 |
| 153 | Ga0495585_0017377 | 3300046492 | Bacteria | 4155 |
| 154 | Ga0495596_0044553 | 3300046500 | Bacteria | 1746 |
| 155 | Ga0495620_0053825 | 3300046515 | Bacteria | 1703 |
| 156 | Ga0495632_0000050 | 3300046519 | Bacteria | 133944 |
| 157 | Ga0495588_0002214 | 3300046674 | Bacteria | 8322 |
| 158 | Ga0495686_0051723 | 3300047472 | Bacteria | 2577 |
| 159 | Ga0496101_0084897 | 3300048904 | Bacteria | 2345 |
| 160 | Ga0496102_0097892 | 3300048905 | Bacteria | 2721 |
| 161 | Ga0496103_0039162 | 3300048906 | Bacteria | 2912 |
| 162 | Ga0496104_0069888 | 3300048907 | Bacteria | 3338 |
| 163 | Ga0496104_0303323 | 3300048907 | Bacteria | 1509 |
| 164 | Ga0496106_0197843 | 3300048909 | Bacteria | 1599 |
| 165 | Ga0496109_0421888 | 3300048912 | Bacteria | 1260 |
| 166 | Ga0496110_0063171 | 3300048913 | Bacteria | 3272 |
| 167 | Ga0496112_0017248 | 3300048915 | Bacteria | 6780 |
| 168 | Ga0496114_0144072 | 3300048917 | Bacteria | 2065 |
| 169 | Ga0496116_0006287 | 3300048919 | Bacteria | 10818 |
| 170 | Ga0496116_0017180 | 3300048919 | Bacteria | 5628 |
| 171 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 172 | Ga0496117_0007307 | 3300048920 | Bacteria | 10841 |
| 173 | Ga0496117_0031406 | 3300048920 | Bacteria | 4055 |
| 174 | Ga0496118_0004084 | 3300048921 | Bacteria | 17702 |
| 175 | Ga0496118_0008214 | 3300048921 | Bacteria | 10841 |
| 176 | Ga0496118_0094058 | 3300048921 | Bacteria | 2051 |
| 177 | Ga0496119_0006497 | 3300048922 | Bacteria | 10797 |
| 178 | Ga0496119_0007380 | 3300048922 | Bacteria | 9924 |
| 179 | Ga0496119_0052424 | 3300048922 | Bacteria | 2498 |
| 180 | Ga0496120_0000034 | 3300048923 | Bacteria | 215228 |
| 181 | Ga0496120_0005309 | 3300048923 | Bacteria | 10330 |
| 182 | Ga0496121_0002466 | 3300048924 | Bacteria | 28236 |
| 183 | Ga0496121_0010119 | 3300048924 | Bacteria | 10690 |
| 184 | Ga0496121_0024195 | 3300048924 | Bacteria | 5818 |
| 185 | Ga0496121_0218520 | 3300048924 | Bacteria | 1344 |
| 186 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 187 | Ga0496122_0016043 | 3300048925 | Bacteria | 7118 |
| 188 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 189 | Ga0496123_0018485 | 3300048926 | Bacteria | 5543 |
| 190 | Ga0496124_0002103 | 3300048927 | Bacteria | 26893 |
| 191 | Ga0496124_0004043 | 3300048927 | Bacteria | 17416 |
| 192 | Ga0496124_0111074 | 3300048927 | Bacteria | 2206 |
| 193 | Ga0496125_0014988 | 3300048928 | Bacteria | 7527 |
| 194 | Ga0496125_0072083 | 3300048928 | Bacteria | 2694 |
| 195 | Ga0501031_0043253 | 3300049568 | Bacteria | 2940 |
| 196 | Ga0501031_0086397 | 3300049568 | Bacteria | 2045 |
| 197 | Ga0501036_0068582 | 3300049572 | Bacteria | 3001 |
| 198 | Ga0501037_0120368 | 3300049573 | Bacteria | 1888 |
| 199 | Ga0501038_0071120 | 3300049574 | Bacteria | 2952 |
| 200 | Ga0501039_0013277 | 3300049575 | Bacteria | 6298 |
| 201 | Ga0501040_0052418 | 3300049576 | Bacteria | 2792 |
| 202 | Ga0501041_0056669 | 3300049577 | Bacteria | 2395 |
| 203 | Ga0501043_0163475 | 3300049579 | Bacteria | 1739 |
| 204 | Ga0501046_0109325 | 3300049580 | Bacteria | 2113 |
| 205 | Ga0501070_0255915 | 3300049586 | Bacteria | 1432 |
| 206 | Ga0501071_0042140 | 3300049587 | Bacteria | 3269 |
| 207 | Ga0501071_0077312 | 3300049587 | Bacteria | 2431 |
| 208 | Ga0501071_0135028 | 3300049587 | Bacteria | 1835 |
| 209 | Ga0501071_0284174 | 3300049587 | Bacteria | 1252 |
| 210 | Ga0501072_0062823 | 3300049588 | Bacteria | 2929 |
| 211 | Ga0501072_0319205 | 3300049588 | Bacteria | 1234 |
| 212 | Ga0501074_0034103 | 3300049590 | Bacteria | 3690 |
| 213 | Ga0501076_0014567 | 3300049592 | Bacteria | 5927 |
| 214 | Ga0501076_0055033 | 3300049592 | Bacteria | 3155 |
| 215 | Ga0501076_0175727 | 3300049592 | Bacteria | 1745 |
| 216 | Ga0501079_0049811 | 3300049741 | Bacteria | 3233 |
| 217 | Ga0501080_0203452 | 3300049742 | Bacteria | 1817 |
| 218 | Ga0501081_0009316 | 3300049743 | Bacteria | 6398 |
| 219 | Ga0501081_0167318 | 3300049743 | Bacteria | 1586 |
| 220 | Ga0501035_0062813 | 3300049822 | Bacteria | 3304 |
| 221 | Ga0501045_0078103 | 3300049824 | Bacteria | 2440 |
| 222 | Ga0501045_0101319 | 3300049824 | Bacteria | 2132 |
| 223 | nmdc:mga00v17_302_c1 | 3300050491 | Bacteria | 28726 |
| 224 | nmdc:mga00v17_47217_c1 | 3300050491 | Bacteria | 2607 |
| 225 | nmdc:mga0k408_16333_c1 | 3300050493 | Bacteria | 4118 |
| 226 | nmdc:mga06z11_14908_c1 | 3300050494 | Bacteria | 3455 |
| 227 | nmdc:mga06z11_30123_c1 | 3300050494 | Bacteria | 2623 |
| 228 | nmdc:mga08y16_22313_c1 | 3300050511 | Bacteria | 6680 |
| 229 | nmdc:mga0sz30_208_c1 | 3300050516 | Bacteria | 22004 |
| 230 | Ga0500560_001568 | 3300053107 | Bacteria | 4029 |
| 231 | Ga0500618_000741 | 3300053125 | Bacteria | 18591 |
| 232 | Ga0500561_0000195 | 3300053137 | Bacteria | 10963 |
| 233 | Ga0500616_0009610 | 3300053153 | Bacteria | 5866 |
| 234 | Ga0500624_001156 | 3300053157 | Bacteria | 4825 |
| 235 | Ga0500634_0000016 | 3300053161 | Bacteria | 112185 |
| 236 | Ga0466962_0005184 | 3300061719 | Bacteria | 6271 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048904 | Ga0496101_0084897 | Ga0496101_0084897_55_939 | 281 |
| 2 | 3300048909 | Ga0496106_0197843 | Ga0496106_0197843_33_917 | 281 |
| 3 | 3300053125 | Ga0500618_000741 | Ga0500618_000741_17667_18551 | 281 |
| 4 | 3300026142 | Ga0207698_10085121 | Ga0207698_100851212 | 310 |
| 5 | 3300005539 | Ga0068853_100009763 | Ga0068853_1000097635 | 312 |
| 6 | 3300026041 | Ga0207639_10218666 | Ga0207639_102186662 | 312 |
| 7 | 3300005981 | Ga0081538_10039720 | Ga0081538_100397203 | 319 |
| 8 | iso_pu_bacteria | 2510917022 | 2511135287 | 324 |
| 9 | iso_pu_bacteria | 2513237138 | 2513865493 | 324 |
| 10 | iso_pu_bacteria | 2582581307 | 2585271023 | 324 |
| 11 | iso_pu_bacteria | 2582581308 | 2585277375 | 324 |
| 12 | iso_pu_bacteria | 2582581315 | 2585323449 | 324 |
| 13 | iso_pu_bacteria | 2582581316 | 2585331585 | 324 |
| 14 | iso_pu_bacteria | 2585427527 | 2585535002 | 324 |
| 15 | iso_pu_bacteria | 2585427530 | 2585555849 | 324 |
| 16 | iso_pu_bacteria | 2585427531 | 2585558747 | 324 |
| 17 | iso_pu_bacteria | 2585427590 | 2585822808 | 324 |
| 18 | iso_pu_bacteria | 2585427608 | 2585898143 | 324 |
| 19 | iso_pu_bacteria | 2585427609 | 2585904283 | 324 |
| 20 | iso_pu_bacteria | 2585428125 | 2587980600 | 324 |
| 21 | iso_pu_bacteria | 2615840626 | 2616308851 | 324 |
| 22 | iso_pu_bacteria | 2667528174 | 2671111548 | 324 |
| 23 | iso_pu_bacteria | 2775507266 | 2778175313 | 324 |
| 24 | iso_pu_bacteria | 2818991448 | 2819609036 | 324 |
| 25 | iso_pu_bacteria | 2818991453 | 2819637735 | 324 |
| 26 | iso_pu_bacteria | 2838029111 | 2838029919 | 324 |
| 27 | iso_pu_bacteria | 2842475841 | 2842476796 | 324 |
| 28 | iso_pu_bacteria | 2842482326 | 2842484670 | 324 |
| 29 | iso_pu_bacteria | 2842502639 | 2842503447 | 324 |
| 30 | iso_pu_bacteria | 2919408235 | 2919409872 | 324 |
| 31 | iso_pu_bacteria | 2923556063 | 2923558465 | 324 |
| 32 | iso_pu_bacteria | 3005416602 | 3005419930 | 324 |
| 33 | iso_pu_bacteria | 8005314921 | 8005316881 | 324 |
| 34 | iso_pu_bacteria | 8005484373 | 8005485319 | 324 |
| 35 | iso_pu_bacteria | 8005645114 | 8005649692 | 324 |
| 36 | 3300044765 | Ga0466970_0000910 | Ga0466970_0000910_13220_14245 | 327 |
| 37 | 3300002704 | JGI25155J39150_1000001 | JGI25155J39150_1000001186 | 328 |
| 38 | 3300002705 | JGI25156J39149_1000001 | JGI25156J39149_1000001147 | 328 |
| 39 | 3300002738 | JGI25154J39366_1000011 | JGI25154J39366_1000011237 | 328 |
| 40 | 3300002741 | JGI25157J39369_1000079 | JGI25157J39369_100007956 | 328 |
| 41 | 3300002773 | JGI25152J39213_1002030 | JGI25152J39213_10020303 | 328 |
| 42 | 3300003214 | JGI25165J46597_1000422 | JGI25165J46597_100042243 | 328 |
| 43 | 3300003214 | JGI25165J46597_1007255 | JGI25165J46597_10072552 | 328 |
| 44 | 3300003322 | rootL2_10014621 | rootL2_100146219 | 328 |
| 45 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001755 | 328 |
| 46 | 3300003374 | JGI25161J50226_1000310 | JGI25161J50226_10003109 | 328 |
| 47 | 3300004625 | Ga0055543_1000003 | Ga0055543_100000311 | 328 |
| 48 | 3300005262 | Ga0065165_1000068 | Ga0065165_1000068157 | 328 |
| 49 | 3300005548 | Ga0070665_100033065 | Ga0070665_1000330653 | 328 |
| 50 | 3300005563 | Ga0068855_100080858 | Ga0068855_1000808582 | 328 |
| 51 | 3300005614 | Ga0068856_100016245 | Ga0068856_1000162452 | 328 |
| 52 | 3300009093 | Ga0105240_10000076 | Ga0105240_1000007651 | 328 |
| 53 | 3300009545 | Ga0105237_10001505 | Ga0105237_1000150524 | 328 |
| 54 | 3300010375 | Ga0105239_10006650 | Ga0105239_100066505 | 328 |
| 55 | 3300013104 | Ga0157370_10000046 | Ga0157370_100000465 | 328 |
| 56 | 3300025206 | Ga0209435_100012 | Ga0209435_100012237 | 328 |
| 57 | 3300025228 | Ga0209672_104873 | Ga0209672_1048732 | 328 |
| 58 | 3300025233 | Ga0209437_100047 | Ga0209437_10004757 | 328 |
| 59 | 3300025246 | Ga0209646_1000026 | Ga0209646_1000026237 | 328 |
| 60 | 3300025250 | Ga0209026_1000014 | Ga0209026_1000014237 | 328 |
| 61 | 3300025253 | Ga0209677_100220 | Ga0209677_10022011 | 328 |
| 62 | 3300025256 | Ga0209759_1000012 | Ga0209759_1000012237 | 328 |
| 63 | 3300025261 | Ga0209233_1000048 | Ga0209233_1000048344 | 328 |
| 64 | 3300025261 | Ga0209233_1000257 | Ga0209233_10002575 | 328 |
| 65 | 3300025284 | Ga0209130_1000003 | Ga0209130_100000321 | 328 |
| 66 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011757 | 328 |
| 67 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011146 | 328 |
| 68 | 3300025914 | Ga0207671_10001078 | Ga0207671_1000107820 | 328 |
| 69 | 3300025981 | Ga0207640_10018368 | Ga0207640_100183683 | 328 |
| 70 | 3300026078 | Ga0207702_10008448 | Ga0207702_100084485 | 328 |
| 71 | 3300027312 | Ga0209371_1004101 | Ga0209371_10041013 | 328 |
| 72 | 3300030500 | Ga0268256_1002486 | Ga0268256_10024867 | 328 |
| 73 | 3300048905 | Ga0496102_0097892 | Ga0496102_0097892_1441_2472 | 328 |
| 74 | 3300048906 | Ga0496103_0039162 | Ga0496103_0039162_428_1459 | 328 |
| 75 | 3300048919 | Ga0496116_0006287 | Ga0496116_0006287_7165_8196 | 328 |
| 76 | 3300048920 | Ga0496117_0007307 | Ga0496117_0007307_5642_6673 | 328 |
| 77 | 3300048921 | Ga0496118_0008214 | Ga0496118_0008214_5642_6673 | 328 |
| 78 | 3300048922 | Ga0496119_0007380 | Ga0496119_0007380_5081_6112 | 328 |
| 79 | 3300048923 | Ga0496120_0005309 | Ga0496120_0005309_5487_6518 | 328 |
| 80 | 3300048924 | Ga0496121_0002466 | Ga0496121_0002466_15545_16576 | 328 |
| 81 | 3300048925 | Ga0496122_0016043 | Ga0496122_0016043_1654_2685 | 328 |
| 82 | 3300048926 | Ga0496123_0018485 | Ga0496123_0018485_392_1423 | 328 |
| 83 | 3300048927 | Ga0496124_0004043 | Ga0496124_0004043_13571_14602 | 328 |
| 84 | 3300048927 | Ga0496124_0111074 | Ga0496124_0111074_1117_2148 | 328 |
| 85 | 3300048928 | Ga0496125_0072083 | Ga0496125_0072083_1473_2504 | 328 |
| 86 | 3300048924 | Ga0496121_0010119 | Ga0496121_0010119_4995_6026 | 329 |
| 87 | 3300030521 | Ga0307511_10003945 | Ga0307511_100039454 | 336 |
| 88 | 3300044684 | Ga0466966_0071752 | Ga0466966_0071752_993_2066 | 336 |
| 89 | 3300044693 | Ga0466961_0005863 | Ga0466961_0005863_4360_5433 | 336 |
| 90 | 3300045049 | Ga0466959_0036167 | Ga0466959_0036167_301_1374 | 336 |
| 91 | iso_pu_bacteria | 2558860280 | 2559423986 | 336 |
| 92 | 3300021361 | Ga0213872_10012429 | Ga0213872_100124292 | 339 |
| 93 | 3300026142 | Ga0207698_10177298 | Ga0207698_101772982 | 339 |
| 94 | 3300039447 | Ga0436361_0064311 | Ga0436361_0064311_2959_3978 | 339 |
| 95 | 3300044656 | Ga0466969_0004140 | Ga0466969_0004140_3723_4742 | 339 |
| 96 | 3300044683 | Ga0466965_0005413 | Ga0466965_0005413_999_2018 | 339 |
| 97 | 3300044684 | Ga0466966_0033538 | Ga0466966_0033538_961_1980 | 339 |
| 98 | 3300044706 | Ga0466964_0005324 | Ga0466964_0005324_631_1650 | 339 |
| 99 | 3300044719 | Ga0466971_0005129 | Ga0466971_0005129_3714_4733 | 339 |
| 100 | 3300044735 | Ga0466968_0051505 | Ga0466968_0051505_620_1639 | 339 |
| 101 | 3300044842 | Ga0466957_0022322 | Ga0466957_0022322_1776_2795 | 339 |
| 102 | 3300045049 | Ga0466959_0009180 | Ga0466959_0009180_4236_5255 | 339 |
| 103 | 3300045836 | Ga0466958_0008426 | Ga0466958_0008426_1764_2783 | 339 |
| 104 | 3300045976 | Ga0466967_0227109 | Ga0466967_0227109_504_1523 | 339 |
| 105 | 3300045976 | Ga0466967_0392843 | Ga0466967_0392843_177_1196 | 339 |
| 106 | 3300061719 | Ga0466962_0005184 | Ga0466962_0005184_4616_5635 | 339 |
| 107 | 3300005336 | Ga0070680_100259493 | Ga0070680_1002594932 | 341 |
| 108 | 3300005458 | Ga0070681_10016918 | Ga0070681_100169184 | 341 |
| 109 | 3300005530 | Ga0070679_100151757 | Ga0070679_1001517572 | 341 |
| 110 | 3300009545 | Ga0105237_10389387 | Ga0105237_103893872 | 341 |
| 111 | 3300013104 | Ga0157370_10035804 | Ga0157370_100358043 | 341 |
| 112 | 3300025914 | Ga0207671_10195520 | Ga0207671_101955202 | 341 |
| 113 | 3300031507 | Ga0307509_10189751 | Ga0307509_101897512 | 341 |
| 114 | 3300031616 | Ga0307508_10316417 | Ga0307508_103164171 | 341 |
| 115 | 3300035691 | Ga0373931_0008810 | Ga0373931_0008810_531_1556 | 341 |
| 116 | 3300039447 | Ga0436361_0332483 | Ga0436361_0332483_1666_2766 | 341 |
| 117 | 3300045976 | Ga0466967_0025827 | Ga0466967_0025827_3570_4640 | 341 |
| 118 | 3300046492 | Ga0495585_0017377 | Ga0495585_0017377_2536_3561 | 341 |
| 119 | 3300046674 | Ga0495588_0002214 | Ga0495588_0002214_4748_5893 | 341 |
| 120 | 3300053107 | Ga0500560_001568 | Ga0500560_001568_987_2132 | 341 |
| 121 | 3300002738 | JGI25154J39366_1001254 | JGI25154J39366_10012547 | 342 |
| 122 | 3300005539 | Ga0068853_100068540 | Ga0068853_1000685401 | 342 |
| 123 | 3300006195 | Ga0075366_10010442 | Ga0075366_100104426 | 342 |
| 124 | 3300025909 | Ga0207705_10088364 | Ga0207705_100883642 | 342 |
| 125 | 3300025927 | Ga0207687_10111475 | Ga0207687_101114752 | 342 |
| 126 | 3300032002 | Ga0307416_100447119 | Ga0307416_1004471191 | 342 |
| 127 | 3300047472 | Ga0495686_0051723 | Ga0495686_0051723_413_1450 | 342 |
| 128 | 3300048907 | Ga0496104_0303323 | Ga0496104_0303323_96_1124 | 342 |
| 129 | 3300050493 | nmdc:mga0k408_16333_c1 | nmdc:mga0k408_16333_c1_1829_2857 | 342 |
| 130 | 3300025303 | Ga0209051_1005048 | Ga0209051_10050483 | 345 |
| 131 | 3300053157 | Ga0500624_001156 | Ga0500624_001156_2353_3498 | 345 |
| 132 | 3300006177 | Ga0075362_10008568 | Ga0075362_100085683 | 348 |
| 133 | 3300006186 | Ga0075369_10091313 | Ga0075369_100913132 | 348 |
| 134 | 3300013102 | Ga0157371_10000004 | Ga0157371_10000004321 | 348 |
| 135 | 3300050491 | nmdc:mga00v17_302_c1 | nmdc:mga00v17_302_c1_22640_23785 | 348 |
| 136 | 3300050516 | nmdc:mga0sz30_208_c1 | nmdc:mga0sz30_208_c1_1314_2459 | 348 |
| 137 | 3300053137 | Ga0500561_0000195 | Ga0500561_0000195_8592_9737 | 348 |
| 138 | 3300005548 | Ga0070665_100002719 | Ga0070665_10000271910 | 350 |
| 139 | 3300005985 | Ga0081539_10003448 | Ga0081539_100034485 | 350 |
| 140 | 3300013104 | Ga0157370_10001389 | Ga0157370_1000138919 | 350 |
| 141 | 3300025923 | Ga0207681_10080714 | Ga0207681_100807141 | 350 |
| 142 | 3300028379 | Ga0268266_10106070 | Ga0268266_101060702 | 350 |
| 143 | 3300048919 | Ga0496116_0017180 | Ga0496116_0017180_3164_4309 | 350 |
| 144 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_2139462_2140607 | 350 |
| 145 | 3300048921 | Ga0496118_0004084 | Ga0496118_0004084_14630_15775 | 350 |
| 146 | 3300048922 | Ga0496119_0052424 | Ga0496119_0052424_165_1310 | 350 |
| 147 | 3300048923 | Ga0496120_0000034 | Ga0496120_0000034_72769_73914 | 350 |
| 148 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_1510258_1511403 | 350 |
| 149 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_1513989_1515134 | 350 |
| 150 | 3300048927 | Ga0496124_0002103 | Ga0496124_0002103_20843_21988 | 350 |
| 151 | 3300050494 | nmdc:mga06z11_30123_c1 | nmdc:mga06z11_30123_c1_899_2176 | 350 |
| 152 | 3300005356 | Ga0070674_100098944 | Ga0070674_1000989442 | 351 |
| 153 | 3300005438 | Ga0070701_10098952 | Ga0070701_100989522 | 351 |
| 154 | 3300005441 | Ga0070700_100066421 | Ga0070700_1000664212 | 351 |
| 155 | 3300005548 | Ga0070665_100173804 | Ga0070665_1001738042 | 351 |
| 156 | 3300005564 | Ga0070664_100236189 | Ga0070664_1002361892 | 351 |
| 157 | 3300005614 | Ga0068856_100173788 | Ga0068856_1001737882 | 351 |
| 158 | 3300005616 | Ga0068852_100272010 | Ga0068852_1002720102 | 351 |
| 159 | 3300005937 | Ga0081455_10133762 | Ga0081455_101337621 | 351 |
| 160 | 3300005981 | Ga0081538_10056142 | Ga0081538_100561422 | 351 |
| 161 | 3300006844 | Ga0075428_100172552 | Ga0075428_1001725522 | 351 |
| 162 | 3300006880 | Ga0075429_100115552 | Ga0075429_1001155523 | 351 |
| 163 | 3300009094 | Ga0111539_10069128 | Ga0111539_100691282 | 351 |
| 164 | 3300009094 | Ga0111539_10201831 | Ga0111539_102018312 | 351 |
| 165 | 3300009098 | Ga0105245_10161160 | Ga0105245_101611602 | 351 |
| 166 | 3300009147 | Ga0114129_10846151 | Ga0114129_108461511 | 351 |
| 167 | 3300009148 | Ga0105243_10163615 | Ga0105243_101636152 | 351 |
| 168 | 3300014326 | Ga0157380_10032920 | Ga0157380_100329203 | 351 |
| 169 | 3300025918 | Ga0207662_10126472 | Ga0207662_101264722 | 351 |
| 170 | 3300025932 | Ga0207690_10081610 | Ga0207690_100816101 | 351 |
| 171 | 3300025938 | Ga0207704_10066603 | Ga0207704_100666032 | 351 |
| 172 | 3300025944 | Ga0207661_10158127 | Ga0207661_101581272 | 351 |
| 173 | 3300026075 | Ga0207708_10024960 | Ga0207708_100249605 | 351 |
| 174 | 3300026075 | Ga0207708_10047652 | Ga0207708_100476522 | 351 |
| 175 | 3300026089 | Ga0207648_10169774 | Ga0207648_101697742 | 351 |
| 176 | 3300026095 | Ga0207676_10414399 | Ga0207676_104143991 | 351 |
| 177 | 3300026116 | Ga0207674_10165102 | Ga0207674_101651022 | 351 |
| 178 | 3300026118 | Ga0207675_100108782 | Ga0207675_1001087823 | 351 |
| 179 | 3300027907 | Ga0207428_10025829 | Ga0207428_100258294 | 351 |
| 180 | 3300028380 | Ga0268265_10201595 | Ga0268265_102015952 | 351 |
| 181 | 3300031901 | Ga0307406_10115176 | Ga0307406_101151762 | 351 |
| 182 | 3300032126 | Ga0307415_100043538 | Ga0307415_1000435382 | 351 |
| 183 | 3300032126 | Ga0307415_100328749 | Ga0307415_1003287491 | 351 |
| 184 | 3300037466 | Ga0395898_0092629 | Ga0395898_0092629_298_1365 | 351 |
| 185 | 3300038443 | Ga0395901_0063391 | Ga0395901_0063391_1797_2864 | 351 |
| 186 | 3300041451 | Ga0451791_0220846 | Ga0451791_0220846_614_1681 | 351 |
| 187 | 3300042016 | Ga0439463_033262 | Ga0439463_033262_13_1080 | 351 |
| 188 | 3300044901 | Ga0466960_0121332 | Ga0466960_0121332_282_1352 | 351 |
| 189 | 3300045976 | Ga0466967_0065211 | Ga0466967_0065211_1894_2961 | 351 |
| 190 | 3300046500 | Ga0495596_0044553 | Ga0495596_0044553_163_1230 | 351 |
| 191 | 3300046515 | Ga0495620_0053825 | Ga0495620_0053825_309_1376 | 351 |
| 192 | 3300048912 | Ga0496109_0421888 | Ga0496109_0421888_165_1235 | 351 |
| 193 | 3300048913 | Ga0496110_0063171 | Ga0496110_0063171_1186_2253 | 351 |
| 194 | 3300048915 | Ga0496112_0017248 | Ga0496112_0017248_1247_2314 | 351 |
| 195 | 3300048917 | Ga0496114_0144072 | Ga0496114_0144072_435_1502 | 351 |
| 196 | 3300049568 | Ga0501031_0043253 | Ga0501031_0043253_150_1217 | 351 |
| 197 | 3300049568 | Ga0501031_0086397 | Ga0501031_0086397_251_1318 | 351 |
| 198 | 3300049572 | Ga0501036_0068582 | Ga0501036_0068582_1491_2558 | 351 |
| 199 | 3300049573 | Ga0501037_0120368 | Ga0501037_0120368_689_1756 | 351 |
| 200 | 3300049574 | Ga0501038_0071120 | Ga0501038_0071120_231_1298 | 351 |
| 201 | 3300049575 | Ga0501039_0013277 | Ga0501039_0013277_1898_2965 | 351 |
| 202 | 3300049576 | Ga0501040_0052418 | Ga0501040_0052418_895_1962 | 351 |
| 203 | 3300049577 | Ga0501041_0056669 | Ga0501041_0056669_328_1395 | 351 |
| 204 | 3300049579 | Ga0501043_0163475 | Ga0501043_0163475_514_1581 | 351 |
| 205 | 3300049580 | Ga0501046_0109325 | Ga0501046_0109325_152_1219 | 351 |
| 206 | 3300049586 | Ga0501070_0255915 | Ga0501070_0255915_183_1250 | 351 |
| 207 | 3300049587 | Ga0501071_0042140 | Ga0501071_0042140_36_1103 | 351 |
| 208 | 3300049587 | Ga0501071_0077312 | Ga0501071_0077312_508_1575 | 351 |
| 209 | 3300049587 | Ga0501071_0135028 | Ga0501071_0135028_67_1134 | 351 |
| 210 | 3300049587 | Ga0501071_0284174 | Ga0501071_0284174_114_1181 | 351 |
| 211 | 3300049588 | Ga0501072_0062823 | Ga0501072_0062823_1590_2657 | 351 |
| 212 | 3300049588 | Ga0501072_0319205 | Ga0501072_0319205_133_1200 | 351 |
| 213 | 3300049590 | Ga0501074_0034103 | Ga0501074_0034103_1209_2276 | 351 |
| 214 | 3300049592 | Ga0501076_0014567 | Ga0501076_0014567_4280_5347 | 351 |
| 215 | 3300049592 | Ga0501076_0055033 | Ga0501076_0055033_1186_2253 | 351 |
| 216 | 3300049592 | Ga0501076_0175727 | Ga0501076_0175727_151_1218 | 351 |
| 217 | 3300049741 | Ga0501079_0049811 | Ga0501079_0049811_1332_2399 | 351 |
| 218 | 3300049742 | Ga0501080_0203452 | Ga0501080_0203452_175_1242 | 351 |
| 219 | 3300049743 | Ga0501081_0009316 | Ga0501081_0009316_1583_2650 | 351 |
| 220 | 3300049743 | Ga0501081_0167318 | Ga0501081_0167318_133_1200 | 351 |
| 221 | 3300049822 | Ga0501035_0062813 | Ga0501035_0062813_1332_2399 | 351 |
| 222 | 3300049824 | Ga0501045_0078103 | Ga0501045_0078103_220_1287 | 351 |
| 223 | 3300049824 | Ga0501045_0101319 | Ga0501045_0101319_317_1384 | 351 |
| 224 | 3300050511 | nmdc:mga08y16_22313_c1 | nmdc:mga08y16_22313_c1_5513_6580 | 351 |
| 225 | 3300053161 | Ga0500634_0000016 | Ga0500634_0000016_65254_66321 | 351 |
| 226 | 3300020077 | Ga0206351_10775907 | Ga0206351_107759075 | 352 |
| 227 | 3300020610 | Ga0154015_1087099 | Ga0154015_10870992 | 352 |
| 228 | 3300048924 | Ga0496121_0024195 | Ga0496121_0024195_2727_3797 | 352 |
| 229 | 3300006051 | Ga0075364_10003583 | Ga0075364_100035835 | 353 |
| 230 | 3300050491 | nmdc:mga00v17_47217_c1 | nmdc:mga00v17_47217_c1_1199_2338 | 353 |
| 231 | iso_pu_bacteria | 2537561587 | 2537873323 | 353 |
| 232 | iso_pu_bacteria | 2554235003 | 2554246418 | 353 |
| 233 | iso_pu_bacteria | 2558860242 | 2559293640 | 353 |
| 234 | iso_pu_bacteria | 2582581304 | 2585258666 | 353 |
| 235 | iso_pu_bacteria | 2599185210 | 2599605787 | 353 |
| 236 | iso_pu_bacteria | 2600255279 | 2601609338 | 353 |
| 237 | iso_pu_bacteria | 2600255308 | 2601746113 | 353 |
| 238 | iso_pu_bacteria | 2643221582 | 2643920802 | 353 |
| 239 | iso_pu_bacteria | 2643221693 | 2644519393 | 353 |
| 240 | iso_pu_bacteria | 2808606387 | 2808986589 | 353 |
| 241 | iso_pu_bacteria | 2818991439 | 2819556660 | 353 |
| 242 | iso_pu_bacteria | 2838675328 | 2838677394 | 353 |
| 243 | iso_pu_bacteria | 2838714209 | 2838716282 | 353 |
| 244 | iso_pu_bacteria | 2838719591 | 2838719918 | 353 |
| 245 | iso_pu_bacteria | 2838724970 | 2838727034 | 353 |
| 246 | iso_pu_bacteria | 2841846520 | 2841846849 | 353 |
| 247 | iso_pu_bacteria | 2841859092 | 2841860622 | 353 |
| 248 | iso_pu_bacteria | 2842124991 | 2842127122 | 353 |
| 249 | iso_pu_bacteria | 2842130223 | 2842132287 | 353 |
| 250 | iso_pu_bacteria | 2842152218 | 2842152544 | 353 |
| 251 | iso_pu_bacteria | 2842170452 | 2842172527 | 353 |
| 252 | iso_pu_bacteria | 2842175837 | 2842176163 | 353 |
| 253 | iso_pu_bacteria | 2842187318 | 2842189389 | 353 |
| 254 | iso_pu_bacteria | 2842211629 | 2842213703 | 353 |
| 255 | iso_pu_bacteria | 2842224351 | 2842224679 | 353 |
| 256 | iso_pu_bacteria | 2842515876 | 2842517407 | 353 |
| 257 | iso_pu_bacteria | 2899792073 | 2899794586 | 353 |
| 258 | iso_pu_bacteria | 2899845264 | 2899845929 | 353 |
| 259 | iso_pu_bacteria | 2919114240 | 2919116486 | 353 |
| 260 | iso_pu_bacteria | 2926754445 | 2926754508 | 353 |
| 261 | iso_pu_bacteria | 2926760298 | 2926761681 | 353 |
| 262 | iso_pu_bacteria | 2933006813 | 2933007190 | 353 |
| 263 | iso_pu_bacteria | 2933011516 | 2933015219 | 353 |
| 264 | iso_pu_bacteria | 2933594066 | 2933594392 | 353 |
| 265 | iso_pu_bacteria | 2979089926 | 2979093056 | 353 |
| 266 | iso_pu_bacteria | 2979095461 | 2979099556 | 353 |
| 267 | iso_pu_bacteria | 2979100975 | 2979105026 | 353 |
| 268 | iso_pu_bacteria | 2984509177 | 2984513160 | 353 |
| 269 | iso_pu_bacteria | 2984537506 | 2984539767 | 353 |
| 270 | iso_pu_bacteria | 2984601300 | 2984601981 | 353 |
| 271 | iso_pu_bacteria | 650716007 | 650738881 | 353 |
| 272 | iso_pu_bacteria | 8003570095 | 8003572438 | 353 |
| 273 | iso_pu_bacteria | 3000017691 | 3000020265 | 354 |
| 274 | 3300003187 | JGI25151J46595_10035663 | JGI25151J46595_100356633 | 355 |
| 275 | 3300003771 | Ga0055526_1000017 | Ga0055526_100001788 | 355 |
| 276 | 3300006051 | Ga0075364_10201904 | Ga0075364_102019041 | 355 |
| 277 | 3300006051 | Ga0075364_10229753 | Ga0075364_102297531 | 355 |
| 278 | 3300006178 | Ga0075367_10013445 | Ga0075367_100134454 | 355 |
| 279 | 3300006948 | Ga0099826_10000149 | Ga0099826_1000014927 | 355 |
| 280 | 3300006948 | Ga0099826_10024551 | Ga0099826_100245514 | 355 |
| 281 | 3300025294 | Ga0209025_1000060 | Ga0209025_1000060181 | 355 |
| 282 | 3300025295 | Ga0209564_1000031 | Ga0209564_1000031119 | 355 |
| 283 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009676 | 355 |
| 284 | 3300027312 | Ga0209371_1001578 | Ga0209371_100157812 | 355 |
| 285 | 3300027666 | Ga0209282_1000279 | Ga0209282_10002794 | 355 |
| 286 | 3300027666 | Ga0209282_1042359 | Ga0209282_10423591 | 355 |
| 287 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010675 | 355 |
| 288 | 3300030500 | Ga0268256_1006040 | Ga0268256_10060405 | 355 |
| 289 | 3300046519 | Ga0495632_0000050 | Ga0495632_0000050_9806_10951 | 355 |
| 290 | 3300048907 | Ga0496104_0069888 | Ga0496104_0069888_590_1735 | 355 |
| 291 | 3300048920 | Ga0496117_0031406 | Ga0496117_0031406_431_1576 | 355 |
| 292 | 3300048921 | Ga0496118_0094058 | Ga0496118_0094058_777_1922 | 355 |
| 293 | 3300048922 | Ga0496119_0006497 | Ga0496119_0006497_8671_9816 | 355 |
| 294 | 3300048924 | Ga0496121_0218520 | Ga0496121_0218520_90_1235 | 355 |
| 295 | 3300048928 | Ga0496125_0014988 | Ga0496125_0014988_68_1213 | 355 |
| 296 | 3300050494 | nmdc:mga06z11_14908_c1 | nmdc:mga06z11_14908_c1_350_1495 | 355 |
| 297 | 3300053153 | Ga0500616_0009610 | Ga0500616_0009610_4422_5501 | 355 |
| 298 | 3300031727 | Ga0316576_10000815 | Ga0316576_1000081513 | 356 |
| 299 | 3300031733 | Ga0316577_10028148 | Ga0316577_100281484 | 356 |
| 300 | 3300032137 | Ga0316585_10013943 | Ga0316585_100139433 | 356 |
| 301 | 3300032139 | Ga0316580_10002760 | Ga0316580_100027605 | 356 |
| 302 | 3300033524 | Ga0316592_1000539 | Ga0316592_10005392 | 356 |
| 303 | 3300035398 | Ga0316574_0021266 | Ga0316574_0021266_1360_2472 | 356 |
| 304 | iso_pu_bacteria | 2524023210 | 2524468436 | 356 |
| 305 | iso_pu_bacteria | 8056681323 | 8056684858 | 356 |
| 306 | 3300031616 | Ga0307508_10001676 | Ga0307508_100016765 | 357 |
| 307 | 3300025302 | Ga0207426_1010779 | Ga0207426_10107793 | 359 |
| 308 | 3300037466 | Ga0395898_0024330 | Ga0395898_0024330_4409_5626 | 361 |
| 309 | iso_pu_bacteria | 2939602548 | 2939603234 | 363 |
| 310 | 3300001989 | JGI24739J22299_10000093 | JGI24739J22299_1000009310 | 367 |
| 311 | 3300003856 | Ga0058692_1000495 | Ga0058692_10004953 | 367 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9434 | 1 | 217 |
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.943 | 3 | 233 |
| 7ahc-assembly1.cif.gz_C | opua apo inward-facing | 0.9392 | 3 | 230 |
| 7ahe-assembly1.cif.gz_C | opua inhibited inward facing | 0.9388 | 3 | 233 |
| 8bmr-assembly1.cif.gz_A | cryo-em structure of the wild-type solitary ecf module in msp2n2 lipid nanodiscs in the atpase open and nucleotide-free conformation | 0.9385 | 1 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9864 | 4 | 215 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9784 | 2 | 217 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9727 | 4 | 233 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9652 | 2 | 217 | 3.40.50.300 |
| af_Q2G089_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9647 | 4 | 234 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E7V6G1-F1-model_v4 | Spermidine/putrescine ABC transporter ATP-binding protein | 0.9882 | 2 | 216 |
GO:0005524
GO:0016887 |
| AF-A0A382Y1F8-F1-model_v4 | ABC transporter domain-containing protein | 0.9878 | 1 | 199 |
GO:0001407
GO:0005524 GO:0008643 GO:0015794 GO:0016887 GO:0055052 GO:0140359 |
| AF-A0A519YL00-F1-model_v4 | deleted | 0.986 | 2 | 233 |
|
| AF-A0A6D0IIJ6-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9852 | 30 | 240 |
GO:0005524
GO:0008643 GO:0016887 GO:0055052 GO:0140359 |
| AF-A0A3M1A2L0-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9832 | 1 | 209 |
GO:0005524
GO:0015423 GO:0016887 GO:0055052 GO:1990060 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar