F401193

General Info

Members Datasets Scaffolds Average Seq Length
311 250 236 357

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10001389|Ga0157370_1000138919
Length 420
Sequence MKVGIARRGDEPGLPGFSVSRNFLQTFVILSYNISICAPEKERRMTPQSLELSGIGKGFGADDVLKEIDLSIRPGEFLSLVGMSGCGKSTLLRIIAGLETPDRGSVTIGGQDVTEIDPSDRNLAMVFQSYALYPHMSVRQNIATPLRMRRLPLAARLPLIGRFAAPAETLRQIDAAVEQAAETLQIAHLLDRKPAQLSGGQRQRVALARALVRSPAAFLMDEPLSNLDAKLRAHMREELAGLHRRLGATFIYVTHDQIEAMTMSDRIALMSEGRIEQLGTPDELYRKPATLTVARFIGTPSINLLPVEIHAGGKVTAFGRDLGVEASPATLGLRAEDLRPGAEGFAVRLTRSETHGADRFVNCRLLSDETVAITLRQAAGEVLGADENGVMNLGFAPERVHLFAADGLRRKTTVREMVPA

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
3 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
4 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
5 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
6 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
7 2558860280 Kutzneria sp. 744 Isolate Unclassified
8 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
9 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
10 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
11 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
12 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
13 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
14 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
15 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
16 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
17 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
18 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
19 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
20 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
21 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
22 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
23 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
24 2643221582 Rhizobium sp. Root651 Isolate Unclassified
25 2643221693 Rhizobium sp. Root491 Isolate Unclassified
26 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
27 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
28 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
29 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
30 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
31 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
32 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
33 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
34 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
35 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
36 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
37 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
38 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
39 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
40 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
41 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
42 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
43 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
44 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
45 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
46 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
47 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
48 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
49 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
50 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
51 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
52 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
53 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
54 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
55 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
56 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
57 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
58 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
59 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
60 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
61 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
62 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
63 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
64 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
65 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
66 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
67 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
68 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
69 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
70 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
71 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
72 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
73 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
74 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
75 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
76 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
77 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
78 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
79 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
80 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
81 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
82 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
83 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
84 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
85 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
86 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
87 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
88 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
89 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
90 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
122 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
125 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
126 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
167 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
168 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
175 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
239 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
240 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
243 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
246 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
247 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
248 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
249 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
250 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.92
Metatranscriptomes 0.96
Isolates 24.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.96
Bulb 0
Endosphere 12.54
Nodule 9.97
Rhizoplane 4.82
Rhizosphere 54.02
Stem 0
Stem Tuber 0
Unclassified 17.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000093 3300001989 Bacteria 26117
2 JGI25155J39150_1000001 3300002704 Bacteria 354543
3 JGI25156J39149_1000001 3300002705 Bacteria 354557
4 JGI25154J39366_1000011 3300002738 Bacteria 296007
5 JGI25154J39366_1001254 3300002738 Bacteria 9533
6 JGI25157J39369_1000079 3300002741 Bacteria 86111
7 JGI25152J39213_1002030 3300002773 Bacteria 7985
8 JGI25151J46595_10035663 3300003187 Bacteria 1886
9 JGI25165J46597_1000422 3300003214 Bacteria 43957
10 JGI25165J46597_1007255 3300003214 Bacteria 1861
11 rootL2_10014621 3300003322 Bacteria 30950
12 JGI25160J50197_1000001 3300003354 Bacteria 782301
13 JGI25161J50226_1000310 3300003374 Bacteria 27058
14 Ga0055526_1000017 3300003771 Bacteria 210613
15 Ga0058692_1000495 3300003856 Bacteria 17550
16 Ga0055543_1000003 3300004625 Bacteria 358656
17 Ga0065165_1000068 3300005262 Bacteria 170609
18 Ga0070680_100259493 3300005336 Bacteria 1470
19 Ga0070674_100098944 3300005356 Bacteria 2121
20 Ga0070701_10098952 3300005438 Bacteria 1612
21 Ga0070700_100066421 3300005441 Bacteria 2289
22 Ga0070681_10016918 3300005458 Bacteria 7285
23 Ga0070679_100151757 3300005530 Bacteria 2293
24 Ga0068853_100009763 3300005539 Bacteria 7744
25 Ga0068853_100068540 3300005539 Bacteria 3084
26 Ga0070665_100002719 3300005548 Bacteria 19169
27 Ga0070665_100033065 3300005548 Bacteria 5204
28 Ga0070665_100173804 3300005548 Bacteria 2155
29 Ga0068855_100080858 3300005563 Bacteria 3768
30 Ga0070664_100236189 3300005564 Bacteria 1640
31 Ga0068856_100016245 3300005614 Bacteria 7201
32 Ga0068856_100173788 3300005614 Bacteria 2167
33 Ga0068852_100272010 3300005616 Bacteria 1630
34 Ga0081455_10133762 3300005937 Bacteria 1935
35 Ga0081538_10039720 3300005981 Bacteria 3013
36 Ga0081538_10056142 3300005981 Bacteria 2309
37 Ga0081539_10003448 3300005985 Bacteria 19419
38 Ga0075364_10003583 3300006051 Bacteria 8844
39 Ga0075364_10201904 3300006051 Bacteria 1347
40 Ga0075364_10229753 3300006051 Bacteria 1260
41 Ga0075362_10008568 3300006177 Bacteria 3918
42 Ga0075367_10013445 3300006178 Bacteria 4399
43 Ga0075369_10091313 3300006186 Bacteria 1359
44 Ga0075366_10010442 3300006195 Bacteria 5214
45 Ga0075428_100172552 3300006844 Bacteria 2343
46 Ga0075429_100115552 3300006880 Bacteria 2346
47 Ga0099826_10000149 3300006948 Bacteria 29916
48 Ga0099826_10024551 3300006948 Bacteria 4476
49 Ga0105240_10000076 3300009093 Bacteria 198848
50 Ga0111539_10069128 3300009094 Bacteria 4170
51 Ga0111539_10201831 3300009094 Bacteria 2319
52 Ga0105245_10161160 3300009098 Bacteria 2129
53 Ga0114129_10846151 3300009147 Bacteria 1163
54 Ga0105243_10163615 3300009148 Bacteria 1921
55 Ga0105237_10001505 3300009545 Bacteria 30672
56 Ga0105237_10389387 3300009545 Bacteria 1399
57 Ga0105239_10006650 3300010375 Bacteria 13381
58 Ga0157371_10000004 3300013102 Bacteria 512593
59 Ga0157370_10000046 3300013104 Bacteria 125612
60 Ga0157370_10001389 3300013104 Bacteria 29991
61 Ga0157370_10035804 3300013104 Bacteria 4821
62 Ga0157380_10032920 3300014326 Bacteria 3989
63 Ga0206351_10775907 3300020077 Bacteria 6673
64 Ga0154015_1087099 3300020610 Bacteria 7113
65 Ga0213872_10012429 3300021361 Bacteria 4005
66 Ga0209435_100012 3300025206 Bacteria 401621
67 Ga0209672_104873 3300025228 Bacteria 2403
68 Ga0209437_100047 3300025233 Bacteria 405163
69 Ga0209646_1000026 3300025246 Bacteria 401621
70 Ga0209026_1000014 3300025250 Bacteria 401621
71 Ga0209677_100220 3300025253 Bacteria 41510
72 Ga0209759_1000012 3300025256 Bacteria 401621
73 Ga0209233_1000048 3300025261 Bacteria 453669
74 Ga0209233_1000257 3300025261 Bacteria 80366
75 Ga0209130_1000003 3300025284 Bacteria 677988
76 Ga0209025_1000060 3300025294 Bacteria 305017
77 Ga0209564_1000031 3300025295 Bacteria 494703
78 Ga0207426_1000011 3300025302 Bacteria 791203
79 Ga0207426_1010779 3300025302 Bacteria 3528
80 Ga0209051_1005048 3300025303 Bacteria 7857
81 Ga0207705_10088364 3300025909 Bacteria 2267
82 Ga0207695_10000011 3300025913 Bacteria 910221
83 Ga0207671_10001078 3300025914 Bacteria 33108
84 Ga0207671_10195520 3300025914 Bacteria 1578
85 Ga0207662_10126472 3300025918 Bacteria 1608
86 Ga0207681_10080714 3300025923 Bacteria 2295
87 Ga0207687_10111475 3300025927 Bacteria 2031
88 Ga0207690_10081610 3300025932 Bacteria 2260
89 Ga0207704_10066603 3300025938 Bacteria 2261
90 Ga0207661_10158127 3300025944 Bacteria 1964
91 Ga0207640_10018368 3300025981 Bacteria 4110
92 Ga0207639_10218666 3300026041 Bacteria 1644
93 Ga0207708_10024960 3300026075 Bacteria 4522
94 Ga0207708_10047652 3300026075 Bacteria 3262
95 Ga0207702_10008448 3300026078 Bacteria 8686
96 Ga0207648_10169774 3300026089 Bacteria 1928
97 Ga0207676_10414399 3300026095 Bacteria 1262
98 Ga0207674_10165102 3300026116 Bacteria 2168
99 Ga0207675_100108782 3300026118 Bacteria 2615
100 Ga0207698_10085121 3300026142 Bacteria 2566
101 Ga0207698_10177298 3300026142 Bacteria 1884
102 Ga0209371_1000009 3300027312 Bacteria 963030
103 Ga0209371_1001578 3300027312 Bacteria 14922
104 Ga0209371_1004101 3300027312 Bacteria 6547
105 Ga0209282_1000279 3300027666 Bacteria 25290
106 Ga0209282_1042359 3300027666 Bacteria 2686
107 Ga0207428_10025829 3300027907 Bacteria 4911
108 Ga0268266_10106070 3300028379 Bacteria 2483
109 Ga0268265_10201595 3300028380 Bacteria 1727
110 Ga0268256_1000010 3300030500 Bacteria 963034
111 Ga0268256_1002486 3300030500 Bacteria 9365
112 Ga0268256_1006040 3300030500 Bacteria 4597
113 Ga0307511_10003945 3300030521 Bacteria 15158
114 Ga0307509_10189751 3300031507 Bacteria 1908
115 Ga0307508_10001676 3300031616 Bacteria 24605
116 Ga0307508_10316417 3300031616 Bacteria 1153
117 Ga0316576_10000815 3300031727 Bacteria 15765
118 Ga0316577_10028148 3300031733 Bacteria 3134
119 Ga0307406_10115176 3300031901 Bacteria 1858
120 Ga0307416_100447119 3300032002 Bacteria 1344
121 Ga0307415_100043538 3300032126 Bacteria 2996
122 Ga0307415_100328749 3300032126 Bacteria 1278
123 Ga0316585_10013943 3300032137 Bacteria 2396
124 Ga0316580_10002760 3300032139 Bacteria 4892
125 Ga0316592_1000539 3300033524 Bacteria 5361
126 Ga0316574_0021266 3300035398 Bacteria 3851
127 Ga0373931_0008810 3300035691 Bacteria 4800
128 Ga0395898_0024330 3300037466 Bacteria 6107
129 Ga0395898_0092629 3300037466 Bacteria 2906
130 Ga0395901_0063391 3300038443 Bacteria 3847
131 Ga0436361_0064311 3300039447 Bacteria 6486
132 Ga0436361_0332483 3300039447 Bacteria 5473
133 Ga0451791_0220846 3300041451 Bacteria 2682
134 Ga0439463_033262 3300042016 Bacteria 1304
135 Ga0466969_0004140 3300044656 Bacteria 7700
136 Ga0466965_0005413 3300044683 Bacteria 5752
137 Ga0466966_0033538 3300044684 Bacteria 3324
138 Ga0466966_0071752 3300044684 Bacteria 2169
139 Ga0466961_0005863 3300044693 Bacteria 7782
140 Ga0466964_0005324 3300044706 Bacteria 4777
141 Ga0466971_0005129 3300044719 Bacteria 5673
142 Ga0466968_0051505 3300044735 Bacteria 1759
143 Ga0466970_0000910 3300044765 Bacteria 14307
144 Ga0466957_0022322 3300044842 Bacteria 3733
145 Ga0466960_0121332 3300044901 Bacteria 1369
146 Ga0466959_0009180 3300045049 Bacteria 7023
147 Ga0466959_0036167 3300045049 Bacteria 3648
148 Ga0466958_0008426 3300045836 Bacteria 5717
149 Ga0466967_0025827 3300045976 Bacteria 4850
150 Ga0466967_0065211 3300045976 Bacteria 3241
151 Ga0466967_0227109 3300045976 Bacteria 1776
152 Ga0466967_0392843 3300045976 Bacteria 1348
153 Ga0495585_0017377 3300046492 Bacteria 4155
154 Ga0495596_0044553 3300046500 Bacteria 1746
155 Ga0495620_0053825 3300046515 Bacteria 1703
156 Ga0495632_0000050 3300046519 Bacteria 133944
157 Ga0495588_0002214 3300046674 Bacteria 8322
158 Ga0495686_0051723 3300047472 Bacteria 2577
159 Ga0496101_0084897 3300048904 Bacteria 2345
160 Ga0496102_0097892 3300048905 Bacteria 2721
161 Ga0496103_0039162 3300048906 Bacteria 2912
162 Ga0496104_0069888 3300048907 Bacteria 3338
163 Ga0496104_0303323 3300048907 Bacteria 1509
164 Ga0496106_0197843 3300048909 Bacteria 1599
165 Ga0496109_0421888 3300048912 Bacteria 1260
166 Ga0496110_0063171 3300048913 Bacteria 3272
167 Ga0496112_0017248 3300048915 Bacteria 6780
168 Ga0496114_0144072 3300048917 Bacteria 2065
169 Ga0496116_0006287 3300048919 Bacteria 10818
170 Ga0496116_0017180 3300048919 Bacteria 5628
171 Ga0496117_0000002 3300048920 Bacteria 2483758
172 Ga0496117_0007307 3300048920 Bacteria 10841
173 Ga0496117_0031406 3300048920 Bacteria 4055
174 Ga0496118_0004084 3300048921 Bacteria 17702
175 Ga0496118_0008214 3300048921 Bacteria 10841
176 Ga0496118_0094058 3300048921 Bacteria 2051
177 Ga0496119_0006497 3300048922 Bacteria 10797
178 Ga0496119_0007380 3300048922 Bacteria 9924
179 Ga0496119_0052424 3300048922 Bacteria 2498
180 Ga0496120_0000034 3300048923 Bacteria 215228
181 Ga0496120_0005309 3300048923 Bacteria 10330
182 Ga0496121_0002466 3300048924 Bacteria 28236
183 Ga0496121_0010119 3300048924 Bacteria 10690
184 Ga0496121_0024195 3300048924 Bacteria 5818
185 Ga0496121_0218520 3300048924 Bacteria 1344
186 Ga0496122_0000001 3300048925 Bacteria 1827766
187 Ga0496122_0016043 3300048925 Bacteria 7118
188 Ga0496123_0000001 3300048926 Bacteria 1831497
189 Ga0496123_0018485 3300048926 Bacteria 5543
190 Ga0496124_0002103 3300048927 Bacteria 26893
191 Ga0496124_0004043 3300048927 Bacteria 17416
192 Ga0496124_0111074 3300048927 Bacteria 2206
193 Ga0496125_0014988 3300048928 Bacteria 7527
194 Ga0496125_0072083 3300048928 Bacteria 2694
195 Ga0501031_0043253 3300049568 Bacteria 2940
196 Ga0501031_0086397 3300049568 Bacteria 2045
197 Ga0501036_0068582 3300049572 Bacteria 3001
198 Ga0501037_0120368 3300049573 Bacteria 1888
199 Ga0501038_0071120 3300049574 Bacteria 2952
200 Ga0501039_0013277 3300049575 Bacteria 6298
201 Ga0501040_0052418 3300049576 Bacteria 2792
202 Ga0501041_0056669 3300049577 Bacteria 2395
203 Ga0501043_0163475 3300049579 Bacteria 1739
204 Ga0501046_0109325 3300049580 Bacteria 2113
205 Ga0501070_0255915 3300049586 Bacteria 1432
206 Ga0501071_0042140 3300049587 Bacteria 3269
207 Ga0501071_0077312 3300049587 Bacteria 2431
208 Ga0501071_0135028 3300049587 Bacteria 1835
209 Ga0501071_0284174 3300049587 Bacteria 1252
210 Ga0501072_0062823 3300049588 Bacteria 2929
211 Ga0501072_0319205 3300049588 Bacteria 1234
212 Ga0501074_0034103 3300049590 Bacteria 3690
213 Ga0501076_0014567 3300049592 Bacteria 5927
214 Ga0501076_0055033 3300049592 Bacteria 3155
215 Ga0501076_0175727 3300049592 Bacteria 1745
216 Ga0501079_0049811 3300049741 Bacteria 3233
217 Ga0501080_0203452 3300049742 Bacteria 1817
218 Ga0501081_0009316 3300049743 Bacteria 6398
219 Ga0501081_0167318 3300049743 Bacteria 1586
220 Ga0501035_0062813 3300049822 Bacteria 3304
221 Ga0501045_0078103 3300049824 Bacteria 2440
222 Ga0501045_0101319 3300049824 Bacteria 2132
223 nmdc:mga00v17_302_c1 3300050491 Bacteria 28726
224 nmdc:mga00v17_47217_c1 3300050491 Bacteria 2607
225 nmdc:mga0k408_16333_c1 3300050493 Bacteria 4118
226 nmdc:mga06z11_14908_c1 3300050494 Bacteria 3455
227 nmdc:mga06z11_30123_c1 3300050494 Bacteria 2623
228 nmdc:mga08y16_22313_c1 3300050511 Bacteria 6680
229 nmdc:mga0sz30_208_c1 3300050516 Bacteria 22004
230 Ga0500560_001568 3300053107 Bacteria 4029
231 Ga0500618_000741 3300053125 Bacteria 18591
232 Ga0500561_0000195 3300053137 Bacteria 10963
233 Ga0500616_0009610 3300053153 Bacteria 5866
234 Ga0500624_001156 3300053157 Bacteria 4825
235 Ga0500634_0000016 3300053161 Bacteria 112185
236 Ga0466962_0005184 3300061719 Bacteria 6271

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_0084897 Ga0496101_0084897_55_939 281
2 3300048909 Ga0496106_0197843 Ga0496106_0197843_33_917 281
3 3300053125 Ga0500618_000741 Ga0500618_000741_17667_18551 281
4 3300026142 Ga0207698_10085121 Ga0207698_100851212 310
5 3300005539 Ga0068853_100009763 Ga0068853_1000097635 312
6 3300026041 Ga0207639_10218666 Ga0207639_102186662 312
7 3300005981 Ga0081538_10039720 Ga0081538_100397203 319
8 iso_pu_bacteria 2510917022 2511135287 324
9 iso_pu_bacteria 2513237138 2513865493 324
10 iso_pu_bacteria 2582581307 2585271023 324
11 iso_pu_bacteria 2582581308 2585277375 324
12 iso_pu_bacteria 2582581315 2585323449 324
13 iso_pu_bacteria 2582581316 2585331585 324
14 iso_pu_bacteria 2585427527 2585535002 324
15 iso_pu_bacteria 2585427530 2585555849 324
16 iso_pu_bacteria 2585427531 2585558747 324
17 iso_pu_bacteria 2585427590 2585822808 324
18 iso_pu_bacteria 2585427608 2585898143 324
19 iso_pu_bacteria 2585427609 2585904283 324
20 iso_pu_bacteria 2585428125 2587980600 324
21 iso_pu_bacteria 2615840626 2616308851 324
22 iso_pu_bacteria 2667528174 2671111548 324
23 iso_pu_bacteria 2775507266 2778175313 324
24 iso_pu_bacteria 2818991448 2819609036 324
25 iso_pu_bacteria 2818991453 2819637735 324
26 iso_pu_bacteria 2838029111 2838029919 324
27 iso_pu_bacteria 2842475841 2842476796 324
28 iso_pu_bacteria 2842482326 2842484670 324
29 iso_pu_bacteria 2842502639 2842503447 324
30 iso_pu_bacteria 2919408235 2919409872 324
31 iso_pu_bacteria 2923556063 2923558465 324
32 iso_pu_bacteria 3005416602 3005419930 324
33 iso_pu_bacteria 8005314921 8005316881 324
34 iso_pu_bacteria 8005484373 8005485319 324
35 iso_pu_bacteria 8005645114 8005649692 324
36 3300044765 Ga0466970_0000910 Ga0466970_0000910_13220_14245 327
37 3300002704 JGI25155J39150_1000001 JGI25155J39150_1000001186 328
38 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001147 328
39 3300002738 JGI25154J39366_1000011 JGI25154J39366_1000011237 328
40 3300002741 JGI25157J39369_1000079 JGI25157J39369_100007956 328
41 3300002773 JGI25152J39213_1002030 JGI25152J39213_10020303 328
42 3300003214 JGI25165J46597_1000422 JGI25165J46597_100042243 328
43 3300003214 JGI25165J46597_1007255 JGI25165J46597_10072552 328
44 3300003322 rootL2_10014621 rootL2_100146219 328
45 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001755 328
46 3300003374 JGI25161J50226_1000310 JGI25161J50226_10003109 328
47 3300004625 Ga0055543_1000003 Ga0055543_100000311 328
48 3300005262 Ga0065165_1000068 Ga0065165_1000068157 328
49 3300005548 Ga0070665_100033065 Ga0070665_1000330653 328
50 3300005563 Ga0068855_100080858 Ga0068855_1000808582 328
51 3300005614 Ga0068856_100016245 Ga0068856_1000162452 328
52 3300009093 Ga0105240_10000076 Ga0105240_1000007651 328
53 3300009545 Ga0105237_10001505 Ga0105237_1000150524 328
54 3300010375 Ga0105239_10006650 Ga0105239_100066505 328
55 3300013104 Ga0157370_10000046 Ga0157370_100000465 328
56 3300025206 Ga0209435_100012 Ga0209435_100012237 328
57 3300025228 Ga0209672_104873 Ga0209672_1048732 328
58 3300025233 Ga0209437_100047 Ga0209437_10004757 328
59 3300025246 Ga0209646_1000026 Ga0209646_1000026237 328
60 3300025250 Ga0209026_1000014 Ga0209026_1000014237 328
61 3300025253 Ga0209677_100220 Ga0209677_10022011 328
62 3300025256 Ga0209759_1000012 Ga0209759_1000012237 328
63 3300025261 Ga0209233_1000048 Ga0209233_1000048344 328
64 3300025261 Ga0209233_1000257 Ga0209233_10002575 328
65 3300025284 Ga0209130_1000003 Ga0209130_100000321 328
66 3300025302 Ga0207426_1000011 Ga0207426_1000011757 328
67 3300025913 Ga0207695_10000011 Ga0207695_10000011146 328
68 3300025914 Ga0207671_10001078 Ga0207671_1000107820 328
69 3300025981 Ga0207640_10018368 Ga0207640_100183683 328
70 3300026078 Ga0207702_10008448 Ga0207702_100084485 328
71 3300027312 Ga0209371_1004101 Ga0209371_10041013 328
72 3300030500 Ga0268256_1002486 Ga0268256_10024867 328
73 3300048905 Ga0496102_0097892 Ga0496102_0097892_1441_2472 328
74 3300048906 Ga0496103_0039162 Ga0496103_0039162_428_1459 328
75 3300048919 Ga0496116_0006287 Ga0496116_0006287_7165_8196 328
76 3300048920 Ga0496117_0007307 Ga0496117_0007307_5642_6673 328
77 3300048921 Ga0496118_0008214 Ga0496118_0008214_5642_6673 328
78 3300048922 Ga0496119_0007380 Ga0496119_0007380_5081_6112 328
79 3300048923 Ga0496120_0005309 Ga0496120_0005309_5487_6518 328
80 3300048924 Ga0496121_0002466 Ga0496121_0002466_15545_16576 328
81 3300048925 Ga0496122_0016043 Ga0496122_0016043_1654_2685 328
82 3300048926 Ga0496123_0018485 Ga0496123_0018485_392_1423 328
83 3300048927 Ga0496124_0004043 Ga0496124_0004043_13571_14602 328
84 3300048927 Ga0496124_0111074 Ga0496124_0111074_1117_2148 328
85 3300048928 Ga0496125_0072083 Ga0496125_0072083_1473_2504 328
86 3300048924 Ga0496121_0010119 Ga0496121_0010119_4995_6026 329
87 3300030521 Ga0307511_10003945 Ga0307511_100039454 336
88 3300044684 Ga0466966_0071752 Ga0466966_0071752_993_2066 336
89 3300044693 Ga0466961_0005863 Ga0466961_0005863_4360_5433 336
90 3300045049 Ga0466959_0036167 Ga0466959_0036167_301_1374 336
91 iso_pu_bacteria 2558860280 2559423986 336
92 3300021361 Ga0213872_10012429 Ga0213872_100124292 339
93 3300026142 Ga0207698_10177298 Ga0207698_101772982 339
94 3300039447 Ga0436361_0064311 Ga0436361_0064311_2959_3978 339
95 3300044656 Ga0466969_0004140 Ga0466969_0004140_3723_4742 339
96 3300044683 Ga0466965_0005413 Ga0466965_0005413_999_2018 339
97 3300044684 Ga0466966_0033538 Ga0466966_0033538_961_1980 339
98 3300044706 Ga0466964_0005324 Ga0466964_0005324_631_1650 339
99 3300044719 Ga0466971_0005129 Ga0466971_0005129_3714_4733 339
100 3300044735 Ga0466968_0051505 Ga0466968_0051505_620_1639 339
101 3300044842 Ga0466957_0022322 Ga0466957_0022322_1776_2795 339
102 3300045049 Ga0466959_0009180 Ga0466959_0009180_4236_5255 339
103 3300045836 Ga0466958_0008426 Ga0466958_0008426_1764_2783 339
104 3300045976 Ga0466967_0227109 Ga0466967_0227109_504_1523 339
105 3300045976 Ga0466967_0392843 Ga0466967_0392843_177_1196 339
106 3300061719 Ga0466962_0005184 Ga0466962_0005184_4616_5635 339
107 3300005336 Ga0070680_100259493 Ga0070680_1002594932 341
108 3300005458 Ga0070681_10016918 Ga0070681_100169184 341
109 3300005530 Ga0070679_100151757 Ga0070679_1001517572 341
110 3300009545 Ga0105237_10389387 Ga0105237_103893872 341
111 3300013104 Ga0157370_10035804 Ga0157370_100358043 341
112 3300025914 Ga0207671_10195520 Ga0207671_101955202 341
113 3300031507 Ga0307509_10189751 Ga0307509_101897512 341
114 3300031616 Ga0307508_10316417 Ga0307508_103164171 341
115 3300035691 Ga0373931_0008810 Ga0373931_0008810_531_1556 341
116 3300039447 Ga0436361_0332483 Ga0436361_0332483_1666_2766 341
117 3300045976 Ga0466967_0025827 Ga0466967_0025827_3570_4640 341
118 3300046492 Ga0495585_0017377 Ga0495585_0017377_2536_3561 341
119 3300046674 Ga0495588_0002214 Ga0495588_0002214_4748_5893 341
120 3300053107 Ga0500560_001568 Ga0500560_001568_987_2132 341
121 3300002738 JGI25154J39366_1001254 JGI25154J39366_10012547 342
122 3300005539 Ga0068853_100068540 Ga0068853_1000685401 342
123 3300006195 Ga0075366_10010442 Ga0075366_100104426 342
124 3300025909 Ga0207705_10088364 Ga0207705_100883642 342
125 3300025927 Ga0207687_10111475 Ga0207687_101114752 342
126 3300032002 Ga0307416_100447119 Ga0307416_1004471191 342
127 3300047472 Ga0495686_0051723 Ga0495686_0051723_413_1450 342
128 3300048907 Ga0496104_0303323 Ga0496104_0303323_96_1124 342
129 3300050493 nmdc:mga0k408_16333_c1 nmdc:mga0k408_16333_c1_1829_2857 342
130 3300025303 Ga0209051_1005048 Ga0209051_10050483 345
131 3300053157 Ga0500624_001156 Ga0500624_001156_2353_3498 345
132 3300006177 Ga0075362_10008568 Ga0075362_100085683 348
133 3300006186 Ga0075369_10091313 Ga0075369_100913132 348
134 3300013102 Ga0157371_10000004 Ga0157371_10000004321 348
135 3300050491 nmdc:mga00v17_302_c1 nmdc:mga00v17_302_c1_22640_23785 348
136 3300050516 nmdc:mga0sz30_208_c1 nmdc:mga0sz30_208_c1_1314_2459 348
137 3300053137 Ga0500561_0000195 Ga0500561_0000195_8592_9737 348
138 3300005548 Ga0070665_100002719 Ga0070665_10000271910 350
139 3300005985 Ga0081539_10003448 Ga0081539_100034485 350
140 3300013104 Ga0157370_10001389 Ga0157370_1000138919 350
141 3300025923 Ga0207681_10080714 Ga0207681_100807141 350
142 3300028379 Ga0268266_10106070 Ga0268266_101060702 350
143 3300048919 Ga0496116_0017180 Ga0496116_0017180_3164_4309 350
144 3300048920 Ga0496117_0000002 Ga0496117_0000002_2139462_2140607 350
145 3300048921 Ga0496118_0004084 Ga0496118_0004084_14630_15775 350
146 3300048922 Ga0496119_0052424 Ga0496119_0052424_165_1310 350
147 3300048923 Ga0496120_0000034 Ga0496120_0000034_72769_73914 350
148 3300048925 Ga0496122_0000001 Ga0496122_0000001_1510258_1511403 350
149 3300048926 Ga0496123_0000001 Ga0496123_0000001_1513989_1515134 350
150 3300048927 Ga0496124_0002103 Ga0496124_0002103_20843_21988 350
151 3300050494 nmdc:mga06z11_30123_c1 nmdc:mga06z11_30123_c1_899_2176 350
152 3300005356 Ga0070674_100098944 Ga0070674_1000989442 351
153 3300005438 Ga0070701_10098952 Ga0070701_100989522 351
154 3300005441 Ga0070700_100066421 Ga0070700_1000664212 351
155 3300005548 Ga0070665_100173804 Ga0070665_1001738042 351
156 3300005564 Ga0070664_100236189 Ga0070664_1002361892 351
157 3300005614 Ga0068856_100173788 Ga0068856_1001737882 351
158 3300005616 Ga0068852_100272010 Ga0068852_1002720102 351
159 3300005937 Ga0081455_10133762 Ga0081455_101337621 351
160 3300005981 Ga0081538_10056142 Ga0081538_100561422 351
161 3300006844 Ga0075428_100172552 Ga0075428_1001725522 351
162 3300006880 Ga0075429_100115552 Ga0075429_1001155523 351
163 3300009094 Ga0111539_10069128 Ga0111539_100691282 351
164 3300009094 Ga0111539_10201831 Ga0111539_102018312 351
165 3300009098 Ga0105245_10161160 Ga0105245_101611602 351
166 3300009147 Ga0114129_10846151 Ga0114129_108461511 351
167 3300009148 Ga0105243_10163615 Ga0105243_101636152 351
168 3300014326 Ga0157380_10032920 Ga0157380_100329203 351
169 3300025918 Ga0207662_10126472 Ga0207662_101264722 351
170 3300025932 Ga0207690_10081610 Ga0207690_100816101 351
171 3300025938 Ga0207704_10066603 Ga0207704_100666032 351
172 3300025944 Ga0207661_10158127 Ga0207661_101581272 351
173 3300026075 Ga0207708_10024960 Ga0207708_100249605 351
174 3300026075 Ga0207708_10047652 Ga0207708_100476522 351
175 3300026089 Ga0207648_10169774 Ga0207648_101697742 351
176 3300026095 Ga0207676_10414399 Ga0207676_104143991 351
177 3300026116 Ga0207674_10165102 Ga0207674_101651022 351
178 3300026118 Ga0207675_100108782 Ga0207675_1001087823 351
179 3300027907 Ga0207428_10025829 Ga0207428_100258294 351
180 3300028380 Ga0268265_10201595 Ga0268265_102015952 351
181 3300031901 Ga0307406_10115176 Ga0307406_101151762 351
182 3300032126 Ga0307415_100043538 Ga0307415_1000435382 351
183 3300032126 Ga0307415_100328749 Ga0307415_1003287491 351
184 3300037466 Ga0395898_0092629 Ga0395898_0092629_298_1365 351
185 3300038443 Ga0395901_0063391 Ga0395901_0063391_1797_2864 351
186 3300041451 Ga0451791_0220846 Ga0451791_0220846_614_1681 351
187 3300042016 Ga0439463_033262 Ga0439463_033262_13_1080 351
188 3300044901 Ga0466960_0121332 Ga0466960_0121332_282_1352 351
189 3300045976 Ga0466967_0065211 Ga0466967_0065211_1894_2961 351
190 3300046500 Ga0495596_0044553 Ga0495596_0044553_163_1230 351
191 3300046515 Ga0495620_0053825 Ga0495620_0053825_309_1376 351
192 3300048912 Ga0496109_0421888 Ga0496109_0421888_165_1235 351
193 3300048913 Ga0496110_0063171 Ga0496110_0063171_1186_2253 351
194 3300048915 Ga0496112_0017248 Ga0496112_0017248_1247_2314 351
195 3300048917 Ga0496114_0144072 Ga0496114_0144072_435_1502 351
196 3300049568 Ga0501031_0043253 Ga0501031_0043253_150_1217 351
197 3300049568 Ga0501031_0086397 Ga0501031_0086397_251_1318 351
198 3300049572 Ga0501036_0068582 Ga0501036_0068582_1491_2558 351
199 3300049573 Ga0501037_0120368 Ga0501037_0120368_689_1756 351
200 3300049574 Ga0501038_0071120 Ga0501038_0071120_231_1298 351
201 3300049575 Ga0501039_0013277 Ga0501039_0013277_1898_2965 351
202 3300049576 Ga0501040_0052418 Ga0501040_0052418_895_1962 351
203 3300049577 Ga0501041_0056669 Ga0501041_0056669_328_1395 351
204 3300049579 Ga0501043_0163475 Ga0501043_0163475_514_1581 351
205 3300049580 Ga0501046_0109325 Ga0501046_0109325_152_1219 351
206 3300049586 Ga0501070_0255915 Ga0501070_0255915_183_1250 351
207 3300049587 Ga0501071_0042140 Ga0501071_0042140_36_1103 351
208 3300049587 Ga0501071_0077312 Ga0501071_0077312_508_1575 351
209 3300049587 Ga0501071_0135028 Ga0501071_0135028_67_1134 351
210 3300049587 Ga0501071_0284174 Ga0501071_0284174_114_1181 351
211 3300049588 Ga0501072_0062823 Ga0501072_0062823_1590_2657 351
212 3300049588 Ga0501072_0319205 Ga0501072_0319205_133_1200 351
213 3300049590 Ga0501074_0034103 Ga0501074_0034103_1209_2276 351
214 3300049592 Ga0501076_0014567 Ga0501076_0014567_4280_5347 351
215 3300049592 Ga0501076_0055033 Ga0501076_0055033_1186_2253 351
216 3300049592 Ga0501076_0175727 Ga0501076_0175727_151_1218 351
217 3300049741 Ga0501079_0049811 Ga0501079_0049811_1332_2399 351
218 3300049742 Ga0501080_0203452 Ga0501080_0203452_175_1242 351
219 3300049743 Ga0501081_0009316 Ga0501081_0009316_1583_2650 351
220 3300049743 Ga0501081_0167318 Ga0501081_0167318_133_1200 351
221 3300049822 Ga0501035_0062813 Ga0501035_0062813_1332_2399 351
222 3300049824 Ga0501045_0078103 Ga0501045_0078103_220_1287 351
223 3300049824 Ga0501045_0101319 Ga0501045_0101319_317_1384 351
224 3300050511 nmdc:mga08y16_22313_c1 nmdc:mga08y16_22313_c1_5513_6580 351
225 3300053161 Ga0500634_0000016 Ga0500634_0000016_65254_66321 351
226 3300020077 Ga0206351_10775907 Ga0206351_107759075 352
227 3300020610 Ga0154015_1087099 Ga0154015_10870992 352
228 3300048924 Ga0496121_0024195 Ga0496121_0024195_2727_3797 352
229 3300006051 Ga0075364_10003583 Ga0075364_100035835 353
230 3300050491 nmdc:mga00v17_47217_c1 nmdc:mga00v17_47217_c1_1199_2338 353
231 iso_pu_bacteria 2537561587 2537873323 353
232 iso_pu_bacteria 2554235003 2554246418 353
233 iso_pu_bacteria 2558860242 2559293640 353
234 iso_pu_bacteria 2582581304 2585258666 353
235 iso_pu_bacteria 2599185210 2599605787 353
236 iso_pu_bacteria 2600255279 2601609338 353
237 iso_pu_bacteria 2600255308 2601746113 353
238 iso_pu_bacteria 2643221582 2643920802 353
239 iso_pu_bacteria 2643221693 2644519393 353
240 iso_pu_bacteria 2808606387 2808986589 353
241 iso_pu_bacteria 2818991439 2819556660 353
242 iso_pu_bacteria 2838675328 2838677394 353
243 iso_pu_bacteria 2838714209 2838716282 353
244 iso_pu_bacteria 2838719591 2838719918 353
245 iso_pu_bacteria 2838724970 2838727034 353
246 iso_pu_bacteria 2841846520 2841846849 353
247 iso_pu_bacteria 2841859092 2841860622 353
248 iso_pu_bacteria 2842124991 2842127122 353
249 iso_pu_bacteria 2842130223 2842132287 353
250 iso_pu_bacteria 2842152218 2842152544 353
251 iso_pu_bacteria 2842170452 2842172527 353
252 iso_pu_bacteria 2842175837 2842176163 353
253 iso_pu_bacteria 2842187318 2842189389 353
254 iso_pu_bacteria 2842211629 2842213703 353
255 iso_pu_bacteria 2842224351 2842224679 353
256 iso_pu_bacteria 2842515876 2842517407 353
257 iso_pu_bacteria 2899792073 2899794586 353
258 iso_pu_bacteria 2899845264 2899845929 353
259 iso_pu_bacteria 2919114240 2919116486 353
260 iso_pu_bacteria 2926754445 2926754508 353
261 iso_pu_bacteria 2926760298 2926761681 353
262 iso_pu_bacteria 2933006813 2933007190 353
263 iso_pu_bacteria 2933011516 2933015219 353
264 iso_pu_bacteria 2933594066 2933594392 353
265 iso_pu_bacteria 2979089926 2979093056 353
266 iso_pu_bacteria 2979095461 2979099556 353
267 iso_pu_bacteria 2979100975 2979105026 353
268 iso_pu_bacteria 2984509177 2984513160 353
269 iso_pu_bacteria 2984537506 2984539767 353
270 iso_pu_bacteria 2984601300 2984601981 353
271 iso_pu_bacteria 650716007 650738881 353
272 iso_pu_bacteria 8003570095 8003572438 353
273 iso_pu_bacteria 3000017691 3000020265 354
274 3300003187 JGI25151J46595_10035663 JGI25151J46595_100356633 355
275 3300003771 Ga0055526_1000017 Ga0055526_100001788 355
276 3300006051 Ga0075364_10201904 Ga0075364_102019041 355
277 3300006051 Ga0075364_10229753 Ga0075364_102297531 355
278 3300006178 Ga0075367_10013445 Ga0075367_100134454 355
279 3300006948 Ga0099826_10000149 Ga0099826_1000014927 355
280 3300006948 Ga0099826_10024551 Ga0099826_100245514 355
281 3300025294 Ga0209025_1000060 Ga0209025_1000060181 355
282 3300025295 Ga0209564_1000031 Ga0209564_1000031119 355
283 3300027312 Ga0209371_1000009 Ga0209371_1000009676 355
284 3300027312 Ga0209371_1001578 Ga0209371_100157812 355
285 3300027666 Ga0209282_1000279 Ga0209282_10002794 355
286 3300027666 Ga0209282_1042359 Ga0209282_10423591 355
287 3300030500 Ga0268256_1000010 Ga0268256_1000010675 355
288 3300030500 Ga0268256_1006040 Ga0268256_10060405 355
289 3300046519 Ga0495632_0000050 Ga0495632_0000050_9806_10951 355
290 3300048907 Ga0496104_0069888 Ga0496104_0069888_590_1735 355
291 3300048920 Ga0496117_0031406 Ga0496117_0031406_431_1576 355
292 3300048921 Ga0496118_0094058 Ga0496118_0094058_777_1922 355
293 3300048922 Ga0496119_0006497 Ga0496119_0006497_8671_9816 355
294 3300048924 Ga0496121_0218520 Ga0496121_0218520_90_1235 355
295 3300048928 Ga0496125_0014988 Ga0496125_0014988_68_1213 355
296 3300050494 nmdc:mga06z11_14908_c1 nmdc:mga06z11_14908_c1_350_1495 355
297 3300053153 Ga0500616_0009610 Ga0500616_0009610_4422_5501 355
298 3300031727 Ga0316576_10000815 Ga0316576_1000081513 356
299 3300031733 Ga0316577_10028148 Ga0316577_100281484 356
300 3300032137 Ga0316585_10013943 Ga0316585_100139433 356
301 3300032139 Ga0316580_10002760 Ga0316580_100027605 356
302 3300033524 Ga0316592_1000539 Ga0316592_10005392 356
303 3300035398 Ga0316574_0021266 Ga0316574_0021266_1360_2472 356
304 iso_pu_bacteria 2524023210 2524468436 356
305 iso_pu_bacteria 8056681323 8056684858 356
306 3300031616 Ga0307508_10001676 Ga0307508_100016765 357
307 3300025302 Ga0207426_1010779 Ga0207426_10107793 359
308 3300037466 Ga0395898_0024330 Ga0395898_0024330_4409_5626 361
309 iso_pu_bacteria 2939602548 2939603234 363
310 3300001989 JGI24739J22299_10000093 JGI24739J22299_1000009310 367
311 3300003856 Ga0058692_1000495 Ga0058692_10004953 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

65

225

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9434 1 217
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.943 3 233
7ahc-assembly1.cif.gz_C opua apo inward-facing 0.9392 3 230
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9388 3 233
8bmr-assembly1.cif.gz_A cryo-em structure of the wild-type solitary ecf module in msp2n2 lipid nanodiscs in the atpase open and nucleotide-free conformation 0.9385 1 220
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9864 4 215 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9784 2 217 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9727 4 233 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9652 2 217 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9647 4 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2E7V6G1-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9882 2 216 GO:0005524
GO:0016887
AF-A0A382Y1F8-F1-model_v4 ABC transporter domain-containing protein 0.9878 1 199 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359
AF-A0A519YL00-F1-model_v4 deleted 0.986 2 233
AF-A0A6D0IIJ6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9852 30 240 GO:0005524
GO:0008643
GO:0016887
GO:0055052
GO:0140359
AF-A0A3M1A2L0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9832 1 209 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060

Feature Viewer

pLDDT pTM Quality
88.13 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map