F401155

General Info

Members Datasets Scaffolds Average Seq Length
311 230 622 181

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100287204|Ga0068865_1002872042
Length 202
Sequence MDMTPGMAAVNTVVYGTLSQGGNMGDQLSAQDWLDQGLKTLAKAGFTALKAEPLAKAMGVSRGSFYWHFTDISAFHAAILKHWREIAAEQIIAGVEAAAGTENALAVLLRRVFGERLTLERAVRIWASVDPAARAAVQAIDRRRLGYVESLMMQSGLSTEVARARAQILYWAFLGFALSDQPLPKAQQKAVLDEMLRIAAAR

Samples

Sample ID Description Type Environment
1 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
207 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
213 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
214 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
215 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
218 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
219 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
220 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
221 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
222 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
223 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
224 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
225 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
226 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
227 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
228 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
229 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
230 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.29
Nodule 1.29
Rhizoplane 9
Rhizosphere 74.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068865_100287204 3300006881 Bacteria 1312
2 JGI25406J46586_10000241 3300003203 Bacteria 24433
3 Ga0070658_10711391 3300005327 Bacteria 872
4 Ga0070683_100238241 3300005329 Bacteria 1730
5 Ga0070683_100360672 3300005329 Bacteria 1384
6 Ga0070680_100192358 3300005336 Bacteria 1719
7 Ga0070682_100142227 3300005337 Bacteria 1637
8 Ga0070660_100084704 3300005339 Bacteria 2492
9 Ga0070674_100113207 3300005356 Bacteria 1996
10 Ga0070659_100120592 3300005366 Bacteria 2124
11 Ga0070667_100886878 3300005367 Bacteria 830
12 Ga0070714_100014889 3300005435 Bacteria 6252
13 Ga0070713_100011227 3300005436 Bacteria 6514
14 Ga0070713_100183236 3300005436 Bacteria 1883
15 Ga0070710_10240839 3300005437 Bacteria 1159
16 Ga0070681_10025289 3300005458 Bacteria 5972
17 Ga0070681_10653421 3300005458 Bacteria 966
18 Ga0070698_100207347 3300005471 Bacteria 1895
19 Ga0070679_100041560 3300005530 Bacteria 4576
20 Ga0070679_100446984 3300005530 Bacteria 1237
21 Ga0070684_100003873 3300005535 Bacteria 11324
22 Ga0070684_100661010 3300005535 Bacteria 973
23 Ga0068853_100400850 3300005539 Bacteria 1284
24 Ga0068853_100618054 3300005539 Bacteria 1030
25 Ga0068853_100760083 3300005539 Bacteria 926
26 Ga0070665_100171749 3300005548 Bacteria 2169
27 Ga0070665_100699544 3300005548 Bacteria 1027
28 Ga0068855_100012000 3300005563 Bacteria 10475
29 Ga0068855_100068036 3300005563 Bacteria 4147
30 Ga0068855_100173071 3300005563 Bacteria 2444
31 Ga0068855_100536719 3300005563 Bacteria 1268
32 Ga0068857_100352322 3300005577 Bacteria 1363
33 Ga0068854_100213553 3300005578 Bacteria 1523
34 Ga0068856_100034770 3300005614 Bacteria 4937
35 Ga0070702_100132317 3300005615 Bacteria 1577
36 Ga0068852_101113365 3300005616 Bacteria 810
37 Ga0068863_100591181 3300005841 Bacteria 1098
38 Ga0068858_100315460 3300005842 Bacteria 1493
39 Ga0081540_1125292 3300005983 Bacteria 1058
40 Ga0081539_10000064 3300005985 Bacteria 247020
41 Ga0070717_10000379 3300006028 Bacteria 28424
42 Ga0070717_10055197 3300006028 Bacteria 3277
43 Ga0070717_10241264 3300006028 Bacteria 1594
44 Ga0075365_10173366 3300006038 Bacteria 1506
45 Ga0075368_10363188 3300006042 Bacteria 632
46 Ga0075363_100174873 3300006048 Bacteria 1220
47 Ga0075363_100234742 3300006048 Bacteria 1053
48 Ga0075364_10113200 3300006051 Bacteria 1812
49 Ga0075364_10305862 3300006051 Bacteria 1082
50 Ga0070715_10451334 3300006163 Bacteria 726
51 Ga0070712_100306209 3300006175 Bacteria 1287
52 Ga0070712_100372455 3300006175 Bacteria 1174
53 Ga0075362_10081240 3300006177 Bacteria 1494
54 Ga0075367_10095224 3300006178 Bacteria 1816
55 Ga0075369_10316950 3300006186 Bacteria 729
56 Ga0099794_10028463 3300007265 Bacteria 2599
57 Ga0099794_10154127 3300007265 Bacteria 1167
58 Ga0099795_10187680 3300007788 Bacteria 866
59 Ga0105240_10125559 3300009093 Bacteria 3084
60 Ga0105240_10203637 3300009093 Bacteria 2318
61 Ga0114129_10305906 3300009147 Bacteria 2117
62 Ga0105248_10055781 3300009177 Bacteria 4433
63 Ga0105237_10044076 3300009545 Bacteria 4492
64 Ga0105237_10077922 3300009545 Bacteria 3304
65 Ga0105237_10387507 3300009545 Bacteria 1402
66 Ga0105238_10044634 3300009551 Bacteria 4480
67 Ga0105238_10913782 3300009551 Bacteria 896
68 Ga0099796_10248760 3300010159 Bacteria 737
69 Ga0105239_10024102 3300010375 Bacteria 6702
70 Ga0105239_10033520 3300010375 Bacteria 5639
71 Ga0105246_10408964 3300011119 Bacteria 1129
72 Ga0105246_10424703 3300011119 Bacteria 1110
73 Ga0105246_10674866 3300011119 Bacteria 902
74 Ga0157370_10021676 3300013104 Bacteria 6401
75 Ga0157370_10296214 3300013104 Bacteria 1494
76 Ga0157370_10406477 3300013104 Bacteria 1253
77 Ga0157369_10003844 3300013105 Bacteria 17843
78 Ga0157369_10191388 3300013105 Bacteria 2150
79 Ga0157369_10761692 3300013105 Bacteria 996
80 Ga0157374_10016889 3300013296 Bacteria 6423
81 Ga0157372_10789194 3300013307 Bacteria 1104
82 Ga0157372_10884244 3300013307 Bacteria 1037
83 Ga0157375_10703638 3300013308 Bacteria 1164
84 Ga0157375_10707182 3300013308 Bacteria 1161
85 Ga0157379_10807011 3300014968 Bacteria 886
86 Ga0157376_10289179 3300014969 Bacteria 1547
87 Ga0163161_10346575 3300017792 Bacteria 1179
88 Ga0163161_10529816 3300017792 Bacteria 963
89 Ga0213876_10349176 3300021384 Bacteria 787
90 Ga0207692_10221167 3300025898 Bacteria 1122
91 Ga0207642_10218542 3300025899 Bacteria 1064
92 Ga0207684_10135442 3300025910 Bacteria 2115
93 Ga0207707_10017137 3300025912 Bacteria 6312
94 Ga0207707_10034744 3300025912 Bacteria 4410
95 Ga0207695_10025261 3300025913 Bacteria 6656
96 Ga0207671_10182080 3300025914 Bacteria 1635
97 Ga0207671_10281500 3300025914 Bacteria 1312
98 Ga0207671_10820691 3300025914 Bacteria 737
99 Ga0207652_10189913 3300025921 Bacteria 1848
100 Ga0207646_10025654 3300025922 Bacteria 5390
101 Ga0207694_10143530 3300025924 Bacteria 1921
102 Ga0207664_10286802 3300025929 Bacteria 1446
103 Ga0207686_10254055 3300025934 Bacteria 1286
104 Ga0207709_10392149 3300025935 Bacteria 1059
105 Ga0207669_10258410 3300025937 Bacteria 1301
106 Ga0207704_10148508 3300025938 Bacteria 1651
107 Ga0207691_10466149 3300025940 Bacteria 1074
108 Ga0207689_10327251 3300025942 Bacteria 1272
109 Ga0207661_10009246 3300025944 Bacteria 7060
110 Ga0207661_10166393 3300025944 Bacteria 1916
111 Ga0207661_10259415 3300025944 Bacteria 1548
112 Ga0207661_11245917 3300025944 Bacteria 684
113 Ga0207667_10009829 3300025949 Bacteria 11241
114 Ga0207667_10140474 3300025949 Bacteria 2487
115 Ga0207667_10258040 3300025949 Bacteria 1782
116 Ga0207667_10454306 3300025949 Bacteria 1301
117 Ga0207667_10513888 3300025949 Bacteria 1214
118 Ga0207658_10360275 3300025986 Bacteria 1269
119 Ga0207703_10499354 3300026035 Bacteria 1142
120 Ga0207639_10058606 3300026041 Bacteria 2963
121 Ga0207639_10141735 3300026041 Bacteria 2003
122 Ga0207639_10550564 3300026041 Bacteria 1059
123 Ga0207702_10281704 3300026078 Bacteria 1572
124 Ga0207641_10792429 3300026088 Bacteria 937
125 Ga0207674_10050875 3300026116 Bacteria 4230
126 Ga0207698_10179992 3300026142 Bacteria 1872
127 Ga0207698_10875817 3300026142 Bacteria 904
128 Ga0209179_1022922 3300027512 Bacteria 1229
129 Ga0209588_1002567 3300027671 Bacteria 4932
130 Ga0209588_1008910 3300027671 Bacteria 2986
131 Ga0209813_10293570 3300027866 Bacteria 629
132 Ga0265334_10038192 3300028573 Bacteria 1890
133 Ga0307517_10000942 3300028786 Bacteria 49547
134 Ga0265332_10022336 3300031238 Bacteria 2792
135 Ga0265328_10166685 3300031239 Bacteria 831
136 Ga0265340_10151160 3300031247 Bacteria 1058
137 Ga0265339_10023050 3300031249 Bacteria 3602
138 Ga0307513_10057565 3300031456 Bacteria 4139
139 Ga0307513_10074689 3300031456 Bacteria 3524
140 Ga0307508_10286682 3300031616 Bacteria 1240
141 Ga0265314_10220788 3300031711 Bacteria 1106
142 Ga0265342_10073722 3300031712 Bacteria 1985
143 Ga0307413_10093609 3300031824 Bacteria 1965
144 Ga0307410_10266214 3300031852 Bacteria 1339
145 Ga0307406_10694260 3300031901 Bacteria 849
146 Ga0307412_10727562 3300031911 Bacteria 854
147 Ga0307409_101093847 3300031995 Bacteria 818
148 Ga0307416_100220974 3300032002 Bacteria 1817
149 Ga0307411_11155221 3300032005 Bacteria 700
150 Ga0307415_100576469 3300032126 Bacteria 997
151 Ga0373929_0059339 3300035085 Bacteria 892
152 Ga0373934_0016035 3300035086 Bacteria 2846
153 Ga0373934_0202310 3300035086 Bacteria 818
154 Ga0373944_0131852 3300035089 Bacteria 869
155 Ga0373923_0000670 3300035111 Bacteria 8700
156 Ga0373953_0000650 3300035117 Bacteria 9650
157 Ga0373954_0001234 3300035118 Bacteria 10292
158 Ga0373956_0000627 3300035119 Bacteria 14473
159 Ga0373957_0004833 3300035120 Bacteria 4129
160 Ga0373960_0036594 3300035121 Bacteria 1399
161 Ga0373943_0024574 3300035170 Bacteria 2810
162 Ga0373943_0108280 3300035170 Bacteria 1462
163 Ga0373946_0404867 3300035171 Bacteria 689
164 Ga0373955_0005992 3300035172 Bacteria 5513
165 Ga0373924_0006901 3300035410 Bacteria 4085
166 Ga0373931_0001051 3300035691 Bacteria 11687
167 Ga0373935_0129540 3300035692 Bacteria 1694
168 Ga0373927_0024530 3300035695 Bacteria 3943
169 Ga0373927_0049150 3300035695 Bacteria 2728
170 Ga0373927_0063268 3300035695 Bacteria 2393
171 Ga0373933_0000487 3300035724 Bacteria 24768
172 Ga0373947_0022175 3300035725 Bacteria 3680
173 Ga0373947_0263293 3300035725 Bacteria 1143
174 Ga0373937_0013907 3300036401 Bacteria 7095
175 Ga0373925_0029293 3300037068 Bacteria 4039
176 Ga0373925_0050219 3300037068 Bacteria 3111
177 Ga0373925_0145744 3300037068 Bacteria 1856
178 Ga0373925_0758889 3300037068 Bacteria 800
179 Ga0395900_0017110 3300037418 Bacteria 7402
180 Ga0395898_0013931 3300037466 Bacteria 8263
181 Ga0395898_0159263 3300037466 Bacteria 2159
182 Ga0436364_1328077 3300037853 Bacteria 2488
183 Ga0395901_0045549 3300038443 Bacteria 4553
184 Ga0395901_0770841 3300038443 Bacteria 953
185 Ga0436365_0064588 3300039437 Bacteria 1605
186 Ga0436365_0074035 3300039437 Bacteria 2195
187 Ga0436365_1235034 3300039437 Bacteria 820
188 Ga0436360_0763726 3300039438 Bacteria 1141
189 Ga0436361_0653875 3300039447 Bacteria 718
190 Ga0436362_1077866 3300039453 Bacteria 1050
191 Ga0439465_0188987 3300041413 Bacteria 747
192 Ga0466963_0034728 3300044694 Bacteria 3282
193 Ga0466967_0482491 3300045976 Bacteria 1215
194 Ga0495592_0000610 3300046454 Bacteria 25275
195 Ga0495603_0005317 3300046455 Bacteria 7679
196 Ga0495603_0043428 3300046455 Bacteria 2684
197 Ga0495629_0000124 3300046459 Bacteria 68796
198 Ga0495629_0341735 3300046459 Bacteria 1022
199 Ga0495638_0206697 3300046460 Bacteria 1105
200 Ga0495651_0002831 3300046462 Bacteria 13439
201 Ga0495653_0000465 3300046463 Bacteria 31535
202 Ga0495580_0832782 3300046472 Bacteria 596
203 Ga0495662_0094479 3300046476 Bacteria 1460
204 Ga0495664_0091304 3300046477 Bacteria 1831
205 Ga0495664_0646669 3300046477 Bacteria 627
206 Ga0495594_0109858 3300046499 Bacteria 1555
207 Ga0495596_0070407 3300046500 Bacteria 1359
208 Ga0495606_0001721 3300046507 Bacteria 28133
209 Ga0495606_0241619 3300046507 Bacteria 1007
210 Ga0495608_0021426 3300046511 Bacteria 4435
211 Ga0495618_0045470 3300046514 Bacteria 2769
212 Ga0495628_0005485 3300046516 Bacteria 11108
213 Ga0495652_0070013 3300046529 Bacteria 2934
214 Ga0495640_0044960 3300046533 Bacteria 3066
215 Ga0495587_0004810 3300046536 Bacteria 8865
216 Ga0495598_0251881 3300046537 Bacteria 654
217 Ga0495645_0007013 3300046543 Bacteria 7837
218 Ga0495667_0000551 3300046559 Bacteria 23946
219 Ga0495667_0455794 3300046559 Bacteria 803
220 Ga0495656_0013251 3300046615 Bacteria 3063
221 Ga0495634_0019074 3300046642 Bacteria 4875
222 Ga0495635_0000786 3300046663 Bacteria 20681
223 Ga0495659_0389345 3300046664 Bacteria 600
224 Ga0495661_0264860 3300046665 Bacteria 872
225 Ga0495657_0039048 3300046675 Bacteria 3263
226 Ga0495599_0000556 3300046678 Bacteria 21265
227 Ga0495646_0002174 3300046680 Bacteria 11940
228 Ga0495613_0071685 3300046689 Bacteria 2525
229 Ga0495600_0036164 3300046809 Bacteria 3208
230 Ga0495581_0187038 3300047315 Bacteria 1211
231 Ga0495604_0004036 3300047317 Bacteria 11668
232 Ga0495674_0003198 3300047319 Bacteria 15908
233 Ga0495672_0029184 3300047320 Bacteria 3477
234 Ga0495680_0001556 3300047322 Bacteria 24553
235 Ga0495675_0036474 3300047444 Bacteria 3135
236 Ga0495684_0000169 3300047471 Bacteria 49164
237 Ga0495593_0002450 3300047673 Bacteria 11166
238 Ga0495602_0007192 3300048088 Bacteria 11665
239 Ga0496102_0499315 3300048905 Bacteria 1139
240 Ga0496102_0540954 3300048905 Bacteria 1087
241 Ga0496103_0727179 3300048906 Bacteria 628
242 Ga0496104_0130231 3300048907 Bacteria 2417
243 Ga0496104_0239528 3300048907 Bacteria 1726
244 Ga0496104_0887139 3300048907 Bacteria 797
245 Ga0496105_0007450 3300048908 Bacteria 8472
246 Ga0496106_0032680 3300048909 Bacteria 3880
247 Ga0496106_0532543 3300048909 Bacteria 943
248 Ga0496107_0187031 3300048910 Bacteria 1538
249 Ga0496108_0452219 3300048911 Bacteria 1122
250 Ga0496109_0126530 3300048912 Bacteria 2383
251 Ga0496109_0329980 3300048912 Bacteria 1440
252 Ga0496109_0426249 3300048912 Bacteria 1253
253 Ga0496110_0060804 3300048913 Bacteria 3333
254 Ga0496110_0648571 3300048913 Bacteria 955
255 Ga0496111_0067901 3300048914 Bacteria 2591
256 Ga0496111_0149689 3300048914 Bacteria 1731
257 Ga0496111_0446388 3300048914 Bacteria 954
258 Ga0496112_0029550 3300048915 Bacteria 5300
259 Ga0496112_0550312 3300048915 Bacteria 1088
260 Ga0496113_0067416 3300048916 Bacteria 2713
261 Ga0496114_0084218 3300048917 Bacteria 2692
262 Ga0496114_0103930 3300048917 Bacteria 2428
263 Ga0496115_0024110 3300048918 Bacteria 4726
264 Ga0496115_0186789 3300048918 Bacteria 1712
265 Ga0496115_0283096 3300048918 Bacteria 1361
266 Ga0496115_0502624 3300048918 Bacteria 974
267 Ga0496121_0025457 3300048924 Bacteria 5612
268 Ga0496121_0569741 3300048924 Bacteria 705
269 Ga0496126_0014102 3300048929 Bacteria 8093
270 Ga0496126_0034492 3300048929 Bacteria 4752
271 Ga0501034_0003012 3300049571 Bacteria 19480
272 Ga0501046_0087490 3300049580 Bacteria 2401
273 Ga0501047_0039627 3300049581 Bacteria 4556
274 Ga0501048_0416385 3300049582 Bacteria 961
275 Ga0501070_0043183 3300049586 Bacteria 3752
276 Ga0501073_0218003 3300049589 Bacteria 1318
277 Ga0501074_0108521 3300049590 Bacteria 1986
278 Ga0501044_0036012 3300049823 Bacteria 5179
279 nmdc:mga03n38_379411_c1 3300050490 Bacteria 774
280 nmdc:mga00v17_84625_c1 3300050491 Bacteria 1985
281 nmdc:mga06z11_82054_c1 3300050494 Bacteria 1732
282 nmdc:mga04h51_328872_c1 3300050495 Bacteria 628
283 nmdc:mga08y16_330037_c1 3300050511 Bacteria 1569
284 Ga0495601_0034574 3300053077 Bacteria 3154
285 Ga0500610_0176538 3300053079 Bacteria 1050
286 Ga0500635_0010711 3300053080 Bacteria 2584
287 Ga0500635_0045019 3300053080 Bacteria 1491
288 Ga0495595_0002875 3300053084 Bacteria 6791
289 Ga0495619_0000556 3300053085 Bacteria 24680
290 Ga0500647_0147816 3300053091 Bacteria 1098
291 Ga0500566_0000150 3300053094 Bacteria 35703
292 Ga0500640_003756 3300053095 Bacteria 5384
293 Ga0500554_049634 3300053102 Bacteria 1317
294 Ga0500572_003755 3300053111 Bacteria 3446
295 Ga0500608_071708 3300053122 Bacteria 1647
296 Ga0500559_0087296 3300053136 Bacteria 1424
297 Ga0500603_000115 3300053150 Bacteria 18809
298 Ga0500630_050986 3300053159 Bacteria 2001
299 Ga0500639_163641 3300053163 Bacteria 1008
300 Ga0500637_0014994 3300053178 Bacteria 4096
301 Ga0500637_0213026 3300053178 Bacteria 1095
302 Ga0500596_000250 3300053735 Bacteria 9375
303 Ga0500601_004515 3300053737 Bacteria 1517
304 Ga0500661_043701 3300055283 Bacteria 795
305 2513675104 2513237098 Bacteria 9902361
306 2524469492 2524023210 Bacteria 9029266
307 2885390813 2885383462 Bacteria 9473874
308 2903771833 2903768456 Bacteria 9749579
309 2922392591 2922386360 Bacteria 7017218
310 8006990947 8006984368 Bacteria 9651211
311 8056686559 8056681323 Bacteria 8472857
312 Ga0068865_100287204
313 JGI25406J46586_10000241
314 Ga0070658_10711391
315 Ga0070683_100238241
316 Ga0070683_100360672
317 Ga0070680_100192358
318 Ga0070682_100142227
319 Ga0070660_100084704
320 Ga0070674_100113207
321 Ga0070659_100120592
322 Ga0070667_100886878
323 Ga0070714_100014889
324 Ga0070713_100011227
325 Ga0070713_100183236
326 Ga0070710_10240839
327 Ga0070681_10025289
328 Ga0070681_10653421
329 Ga0070698_100207347
330 Ga0070679_100041560
331 Ga0070679_100446984
332 Ga0070684_100003873
333 Ga0070684_100661010
334 Ga0068853_100400850
335 Ga0068853_100618054
336 Ga0068853_100760083
337 Ga0070665_100171749
338 Ga0070665_100699544
339 Ga0068855_100012000
340 Ga0068855_100068036
341 Ga0068855_100173071
342 Ga0068855_100536719
343 Ga0068857_100352322
344 Ga0068854_100213553
345 Ga0068856_100034770
346 Ga0070702_100132317
347 Ga0068852_101113365
348 Ga0068863_100591181
349 Ga0068858_100315460
350 Ga0081540_1125292
351 Ga0081539_10000064
352 Ga0070717_10000379
353 Ga0070717_10055197
354 Ga0070717_10241264
355 Ga0075365_10173366
356 Ga0075368_10363188
357 Ga0075363_100174873
358 Ga0075363_100234742
359 Ga0075364_10113200
360 Ga0075364_10305862
361 Ga0070715_10451334
362 Ga0070712_100306209
363 Ga0070712_100372455
364 Ga0075362_10081240
365 Ga0075367_10095224
366 Ga0075369_10316950
367 Ga0099794_10028463
368 Ga0099794_10154127
369 Ga0099795_10187680
370 Ga0105240_10125559
371 Ga0105240_10203637
372 Ga0114129_10305906
373 Ga0105248_10055781
374 Ga0105237_10044076
375 Ga0105237_10077922
376 Ga0105237_10387507
377 Ga0105238_10044634
378 Ga0105238_10913782
379 Ga0099796_10248760
380 Ga0105239_10024102
381 Ga0105239_10033520
382 Ga0105246_10408964
383 Ga0105246_10424703
384 Ga0105246_10674866
385 Ga0157370_10021676
386 Ga0157370_10296214
387 Ga0157370_10406477
388 Ga0157369_10003844
389 Ga0157369_10191388
390 Ga0157369_10761692
391 Ga0157374_10016889
392 Ga0157372_10789194
393 Ga0157372_10884244
394 Ga0157375_10703638
395 Ga0157375_10707182
396 Ga0157379_10807011
397 Ga0157376_10289179
398 Ga0163161_10346575
399 Ga0163161_10529816
400 Ga0213876_10349176
401 Ga0207692_10221167
402 Ga0207642_10218542
403 Ga0207684_10135442
404 Ga0207707_10017137
405 Ga0207707_10034744
406 Ga0207695_10025261
407 Ga0207671_10182080
408 Ga0207671_10281500
409 Ga0207671_10820691
410 Ga0207652_10189913
411 Ga0207646_10025654
412 Ga0207694_10143530
413 Ga0207664_10286802
414 Ga0207686_10254055
415 Ga0207709_10392149
416 Ga0207669_10258410
417 Ga0207704_10148508
418 Ga0207691_10466149
419 Ga0207689_10327251
420 Ga0207661_10009246
421 Ga0207661_10166393
422 Ga0207661_10259415
423 Ga0207661_11245917
424 Ga0207667_10009829
425 Ga0207667_10140474
426 Ga0207667_10258040
427 Ga0207667_10454306
428 Ga0207667_10513888
429 Ga0207658_10360275
430 Ga0207703_10499354
431 Ga0207639_10058606
432 Ga0207639_10141735
433 Ga0207639_10550564
434 Ga0207702_10281704
435 Ga0207641_10792429
436 Ga0207674_10050875
437 Ga0207698_10179992
438 Ga0207698_10875817
439 Ga0209179_1022922
440 Ga0209588_1002567
441 Ga0209588_1008910
442 Ga0209813_10293570
443 Ga0265334_10038192
444 Ga0307517_10000942
445 Ga0265332_10022336
446 Ga0265328_10166685
447 Ga0265340_10151160
448 Ga0265339_10023050
449 Ga0307513_10057565
450 Ga0307513_10074689
451 Ga0307508_10286682
452 Ga0265314_10220788
453 Ga0265342_10073722
454 Ga0307413_10093609
455 Ga0307410_10266214
456 Ga0307406_10694260
457 Ga0307412_10727562
458 Ga0307409_101093847
459 Ga0307416_100220974
460 Ga0307411_11155221
461 Ga0307415_100576469
462 Ga0373929_0059339
463 Ga0373934_0016035
464 Ga0373934_0202310
465 Ga0373944_0131852
466 Ga0373923_0000670
467 Ga0373953_0000650
468 Ga0373954_0001234
469 Ga0373956_0000627
470 Ga0373957_0004833
471 Ga0373960_0036594
472 Ga0373943_0024574
473 Ga0373943_0108280
474 Ga0373946_0404867
475 Ga0373955_0005992
476 Ga0373924_0006901
477 Ga0373931_0001051
478 Ga0373935_0129540
479 Ga0373927_0024530
480 Ga0373927_0049150
481 Ga0373927_0063268
482 Ga0373933_0000487
483 Ga0373947_0022175
484 Ga0373947_0263293
485 Ga0373937_0013907
486 Ga0373925_0029293
487 Ga0373925_0050219
488 Ga0373925_0145744
489 Ga0373925_0758889
490 Ga0395900_0017110
491 Ga0395898_0013931
492 Ga0395898_0159263
493 Ga0436364_1328077
494 Ga0395901_0045549
495 Ga0395901_0770841
496 Ga0436365_0064588
497 Ga0436365_0074035
498 Ga0436365_1235034
499 Ga0436360_0763726
500 Ga0436361_0653875
501 Ga0436362_1077866
502 Ga0439465_0188987
503 Ga0466963_0034728
504 Ga0466967_0482491
505 Ga0495592_0000610
506 Ga0495603_0005317
507 Ga0495603_0043428
508 Ga0495629_0000124
509 Ga0495629_0341735
510 Ga0495638_0206697
511 Ga0495651_0002831
512 Ga0495653_0000465
513 Ga0495580_0832782
514 Ga0495662_0094479
515 Ga0495664_0091304
516 Ga0495664_0646669
517 Ga0495594_0109858
518 Ga0495596_0070407
519 Ga0495606_0001721
520 Ga0495606_0241619
521 Ga0495608_0021426
522 Ga0495618_0045470
523 Ga0495628_0005485
524 Ga0495652_0070013
525 Ga0495640_0044960
526 Ga0495587_0004810
527 Ga0495598_0251881
528 Ga0495645_0007013
529 Ga0495667_0000551
530 Ga0495667_0455794
531 Ga0495656_0013251
532 Ga0495634_0019074
533 Ga0495635_0000786
534 Ga0495659_0389345
535 Ga0495661_0264860
536 Ga0495657_0039048
537 Ga0495599_0000556
538 Ga0495646_0002174
539 Ga0495613_0071685
540 Ga0495600_0036164
541 Ga0495581_0187038
542 Ga0495604_0004036
543 Ga0495674_0003198
544 Ga0495672_0029184
545 Ga0495680_0001556
546 Ga0495675_0036474
547 Ga0495684_0000169
548 Ga0495593_0002450
549 Ga0495602_0007192
550 Ga0496102_0499315
551 Ga0496102_0540954
552 Ga0496103_0727179
553 Ga0496104_0130231
554 Ga0496104_0239528
555 Ga0496104_0887139
556 Ga0496105_0007450
557 Ga0496106_0032680
558 Ga0496106_0532543
559 Ga0496107_0187031
560 Ga0496108_0452219
561 Ga0496109_0126530
562 Ga0496109_0329980
563 Ga0496109_0426249
564 Ga0496110_0060804
565 Ga0496110_0648571
566 Ga0496111_0067901
567 Ga0496111_0149689
568 Ga0496111_0446388
569 Ga0496112_0029550
570 Ga0496112_0550312
571 Ga0496113_0067416
572 Ga0496114_0084218
573 Ga0496114_0103930
574 Ga0496115_0024110
575 Ga0496115_0186789
576 Ga0496115_0283096
577 Ga0496115_0502624
578 Ga0496121_0025457
579 Ga0496121_0569741
580 Ga0496126_0014102
581 Ga0496126_0034492
582 Ga0501034_0003012
583 Ga0501046_0087490
584 Ga0501047_0039627
585 Ga0501048_0416385
586 Ga0501070_0043183
587 Ga0501073_0218003
588 Ga0501074_0108521
589 Ga0501044_0036012
590 nmdc:mga03n38_379411_c1
591 nmdc:mga00v17_84625_c1
592 nmdc:mga06z11_82054_c1
593 nmdc:mga04h51_328872_c1
594 nmdc:mga08y16_330037_c1
595 Ga0495601_0034574
596 Ga0500610_0176538
597 Ga0500635_0010711
598 Ga0500635_0045019
599 Ga0495595_0002875
600 Ga0495619_0000556
601 Ga0500647_0147816
602 Ga0500566_0000150
603 Ga0500640_003756
604 Ga0500554_049634
605 Ga0500572_003755
606 Ga0500608_071708
607 Ga0500559_0087296
608 Ga0500603_000115
609 Ga0500630_050986
610 Ga0500639_163641
611 Ga0500637_0014994
612 Ga0500637_0213026
613 Ga0500596_000250
614 Ga0500601_004515
615 Ga0500661_043701
616 2513675104
617 2524469492
618 2885390813
619 2903771833
620 2922392591
621 8006990947
622 8056686559

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

34

79

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g7r-assembly1.cif.gz_A crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor 0.7954 10 178
3g7r-assembly1.cif.gz_B crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor 0.7921 10 178
2g3b-assembly1.cif.gz_B crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp. 0.7759 10 178
6o6n-assembly1.cif.gz_A structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa 0.7758 10 176
2np5-assembly1.cif.gz_A crystal structure of a transcriptional regulator (rha1_ro04179) from rhodococcus sp. rha1. 0.7692 6 177
ID Description Score Start End Superfamily
1zk8B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9516 5 48 1.10.10.60
2y30A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9469 6 59 1.10.10.60
3fiwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9465 6 48 1.10.10.60
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9425 5 59 1.10.10.60
2y31B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9424 4 59 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2H9VKR7-F1-model_v4 deleted 0.9601 1 178
AF-A0A2H9VKR7-F1-model_v4 deleted 0.9549 1 178
AF-A0A0S6UNV9-F1-model_v4 HTH tetR-type domain-containing protein 0.9498 1 178 GO:0003677
AF-G3D5H5-F1-model_v4 Transcriptional regulatory protein 0.9451 3 177 GO:0000976
GO:0003700
AF-H0TRG6-F1-model_v4 Putative transcriptional regulator protein 0.9444 1 177 GO:0003677

Map