F401152

General Info

Members Datasets Scaffolds Average Seq Length
311 213 622 350

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100006745|Ga0075434_10000674514
Length 368
Sequence VSLPFPADWLAELPPEWRLGVVSTLWILVVLIAXXXSVAMLTLLERKVIGYMQLRRGPNRIEIFGLPFFRGLAQPFADVIKLLLKEIIVPDRSSRLLFLLAPLIVLVPAMATWAVMPLSPEFVLADIDAGLLYVLALTSMGVYGVILAGWASNSKYAFLGAMRSAAQMVAYEIAMGFALVGVLMAAGSLNLGAIVRAQEGAAFSWNXXXLFPLFFVYFISGIAETNRAPFDVAEGESEIVAGFHVEYSGAAFATLFALPEYANMILISALCSVLFFGGWLSPLDGYLAADSALRQVPVLGFLVGNGFHWLFLKIAFFLFVFLWVRATFPRYRYDQIMRLGWKVLIPITLIWIAVEGLLAWLRIGPWSA

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
130 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
146 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
147 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
148 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
149 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 4.5
Rhizosphere 89.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100006745 3300006871 Bacteria 10551
2 Ga0065715_10107494 3300005293 Bacteria 2769
3 Ga0065715_10154749 3300005293 Bacteria 1672
4 Ga0070690_100008681 3300005330 Bacteria 5862
5 Ga0070690_100066910 3300005330 Bacteria 2327
6 Ga0070666_10005768 3300005335 Bacteria 7606
7 Ga0070666_10008546 3300005335 Bacteria 6361
8 Ga0070666_10060583 3300005335 Bacteria 2562
9 Ga0070680_100008101 3300005336 Bacteria 8022
10 Ga0070689_100031699 3300005340 Bacteria 4018
11 Ga0070669_100149189 3300005353 Bacteria 1809
12 Ga0070669_100314211 3300005353 Bacteria 1264
13 Ga0070675_100063176 3300005354 Bacteria 3061
14 Ga0070671_100000211 3300005355 Bacteria 38816
15 Ga0070671_100047572 3300005355 Bacteria 3566
16 Ga0070667_100000176 3300005367 Bacteria 79346
17 Ga0070667_100004044 3300005367 Bacteria 12402
18 Ga0070667_100004273 3300005367 Bacteria 12059
19 Ga0070709_10007688 3300005434 Bacteria 5915
20 Ga0070714_100001900 3300005435 Bacteria 15241
21 Ga0070713_100043344 3300005436 Bacteria 3678
22 Ga0070710_10004740 3300005437 Bacteria 6431
23 Ga0070711_100002206 3300005439 Bacteria 11051
24 Ga0070705_100060514 3300005440 Bacteria 2246
25 Ga0070678_100031656 3300005456 Bacteria 3652
26 Ga0070681_10063093 3300005458 Bacteria 3678
27 Ga0070681_10269731 3300005458 Bacteria 1613
28 Ga0070679_100005267 3300005530 Bacteria 11971
29 Ga0070679_100012832 3300005530 Bacteria 8019
30 Ga0070686_100124272 3300005544 Bacteria 1776
31 Ga0070695_100008975 3300005545 Bacteria 5942
32 Ga0070696_100021898 3300005546 Bacteria 4336
33 Ga0070693_100187011 3300005547 Bacteria 1337
34 Ga0070665_100002453 3300005548 Bacteria 20441
35 Ga0070665_100013615 3300005548 Bacteria 8180
36 Ga0070665_100094273 3300005548 Bacteria 2998
37 Ga0070704_100038991 3300005549 Bacteria 3259
38 Ga0068855_100030743 3300005563 Bacteria 6420
39 Ga0068855_100130404 3300005563 Bacteria 2872
40 Ga0068857_100426067 3300005577 Bacteria 1238
41 Ga0068856_100009165 3300005614 Bacteria 9622
42 Ga0068852_100308294 3300005616 Bacteria 1534
43 Ga0068859_100002490 3300005617 Bacteria 18744
44 Ga0068859_100023424 3300005617 Bacteria 6196
45 Ga0068866_10135148 3300005718 Bacteria 1408
46 Ga0068863_100007707 3300005841 Bacteria 10527
47 Ga0068863_100030034 3300005841 Bacteria 5191
48 Ga0068858_100001768 3300005842 Bacteria 22037
49 Ga0068858_100003825 3300005842 Bacteria 14883
50 Ga0068860_100005590 3300005843 Bacteria 12707
51 Ga0068860_100027936 3300005843 Bacteria 5433
52 Ga0068860_100074219 3300005843 Bacteria 3234
53 Ga0068862_100231448 3300005844 Bacteria 1677
54 Ga0081455_10003509 3300005937 Bacteria 18014
55 Ga0070715_10001451 3300006163 Bacteria 6873
56 Ga0070712_100015088 3300006175 Bacteria 4967
57 Ga0097621_100072802 3300006237 Bacteria 2843
58 Ga0068871_100020345 3300006358 Bacteria 5083
59 Ga0068865_100003222 3300006881 Bacteria 9778
60 Ga0075436_100234088 3300006914 Bacteria 1305
61 Ga0097620_100002490 3300006931 Bacteria 18744
62 Ga0097620_100023425 3300006931 Bacteria 6196
63 Ga0099794_10063431 3300007265 Bacteria 1798
64 Ga0099795_10005006 3300007788 Bacteria 3479
65 Ga0105250_10035501 3300009092 Bacteria 2000
66 Ga0105240_10007091 3300009093 Bacteria 16338
67 Ga0105240_10015264 3300009093 Bacteria 10452
68 Ga0105240_10091144 3300009093 Bacteria 3725
69 Ga0111539_10006091 3300009094 Bacteria 15568
70 Ga0105245_10006928 3300009098 Bacteria 9934
71 Ga0105247_10000088 3300009101 Bacteria 98964
72 Ga0105247_10020336 3300009101 Bacteria 3991
73 Ga0105241_10046411 3300009174 Bacteria 3299
74 Ga0105242_10001357 3300009176 Bacteria 19306
75 Ga0105248_10015092 3300009177 Bacteria 8507
76 Ga0105248_10022103 3300009177 Bacteria 7049
77 Ga0105237_10116469 3300009545 Bacteria 2665
78 Ga0105237_10246142 3300009545 Bacteria 1790
79 Ga0105237_10254224 3300009545 Bacteria 1759
80 Ga0105238_10059187 3300009551 Bacteria 3838
81 Ga0105238_10156211 3300009551 Bacteria 2256
82 Ga0105249_10051803 3300009553 Bacteria 3746
83 Ga0105030_102247 3300009987 Bacteria 1690
84 Ga0099796_10010161 3300010159 Bacteria 2578
85 Ga0105239_10047866 3300010375 Bacteria 4687
86 Ga0157370_10008536 3300013104 Bacteria 11043
87 Ga0157370_10356338 3300013104 Bacteria 1348
88 Ga0157369_10045917 3300013105 Bacteria 4749
89 Ga0157374_10010878 3300013296 Bacteria 7852
90 Ga0157378_10010033 3300013297 Bacteria 8255
91 Ga0163162_10065060 3300013306 Bacteria 3692
92 Ga0157375_10005181 3300013308 Bacteria 11309
93 Ga0157514_115792 3300013874 Bacteria 1911
94 Ga0163163_10217618 3300014325 Bacteria 1959
95 Ga0157380_10083313 3300014326 Bacteria 2620
96 Ga0157379_10001073 3300014968 Bacteria 22288
97 Ga0157379_10019431 3300014968 Bacteria 6000
98 Ga0213874_10015060 3300021377 Bacteria 2033
99 Ga0207692_10014912 3300025898 Bacteria 3407
100 Ga0207710_10000200 3300025900 Bacteria 56100
101 Ga0207710_10030330 3300025900 Bacteria 2358
102 Ga0207685_10048605 3300025905 Bacteria 1626
103 Ga0207699_10031900 3300025906 Bacteria 2963
104 Ga0207699_10083942 3300025906 Bacteria 1983
105 Ga0207654_10168535 3300025911 Bacteria 1420
106 Ga0207707_10000045 3300025912 Bacteria 122598
107 Ga0207707_10004216 3300025912 Bacteria 12724
108 Ga0207707_10023452 3300025912 Bacteria 5397
109 Ga0207695_10005045 3300025913 Bacteria 17727
110 Ga0207695_10005898 3300025913 Bacteria 16065
111 Ga0207695_10033031 3300025913 Bacteria 5653
112 Ga0207695_10123032 3300025913 Bacteria 2560
113 Ga0207695_10340818 3300025913 Bacteria 1387
114 Ga0207671_10112295 3300025914 Bacteria 2075
115 Ga0207693_10000161 3300025915 Bacteria 61727
116 Ga0207693_10036596 3300025915 Bacteria 3869
117 Ga0207663_10031573 3300025916 Bacteria 3136
118 Ga0207663_10064778 3300025916 Bacteria 2333
119 Ga0207660_10019522 3300025917 Bacteria 4532
120 Ga0207652_10003813 3300025921 Bacteria 12356
121 Ga0207652_10041713 3300025921 Bacteria 3903
122 Ga0207694_10054617 3300025924 Bacteria 3099
123 Ga0207694_10106496 3300025924 Bacteria 2227
124 Ga0207650_10031942 3300025925 Bacteria 3807
125 Ga0207700_10046052 3300025928 Bacteria 3223
126 Ga0207664_10186303 3300025929 Bacteria 1784
127 Ga0207644_10002758 3300025931 Bacteria 11315
128 Ga0207644_10024092 3300025931 Bacteria 4175
129 Ga0207706_10031105 3300025933 Bacteria 4757
130 Ga0207686_10025464 3300025934 Bacteria 3441
131 Ga0207670_10008577 3300025936 Bacteria 5778
132 Ga0207665_10127443 3300025939 Bacteria 1803
133 Ga0207691_10057010 3300025940 Bacteria 3557
134 Ga0207711_10182678 3300025941 Bacteria 1908
135 Ga0207667_10000887 3300025949 Bacteria 38097
136 Ga0207667_10157124 3300025949 Bacteria 2340
137 Ga0207712_10022318 3300025961 Bacteria 4166
138 Ga0207712_10225818 3300025961 Bacteria 1500
139 Ga0207668_10002142 3300025972 Bacteria 11514
140 Ga0207658_10000236 3300025986 Bacteria 58435
141 Ga0207658_10013360 3300025986 Bacteria 5607
142 Ga0207658_10074418 3300025986 Bacteria 2580
143 Ga0207677_10022492 3300026023 Bacteria 3876
144 Ga0207703_10000656 3300026035 Bacteria 34663
145 Ga0207703_10001996 3300026035 Bacteria 17999
146 Ga0207703_10098552 3300026035 Bacteria 2472
147 Ga0207708_10170403 3300026075 Bacteria 1724
148 Ga0207702_10038369 3300026078 Bacteria 4011
149 Ga0207641_10040790 3300026088 Bacteria 3888
150 Ga0207641_10106983 3300026088 Bacteria 2473
151 Ga0207641_10473159 3300026088 Bacteria 1213
152 Ga0207676_10081930 3300026095 Bacteria 2623
153 Ga0207675_100041394 3300026118 Bacteria 4303
154 Ga0207683_10077535 3300026121 Bacteria 2943
155 Ga0207428_10015261 3300027907 Bacteria 6649
156 Ga0207428_10025945 3300027907 Bacteria 4896
157 Ga0268266_10002139 3300028379 Bacteria 21753
158 Ga0268266_10227033 3300028379 Bacteria 1718
159 Ga0268265_10000595 3300028380 Bacteria 36375
160 Ga0268264_10037581 3300028381 Bacteria 3992
161 Ga0268264_10095058 3300028381 Bacteria 2578
162 Ga0265334_10000887 3300028573 Bacteria 14948
163 Ga0265318_10004262 3300028577 Bacteria 6976
164 Ga0265338_10020666 3300028800 Bacteria 6910
165 Ga0265338_10042444 3300028800 Bacteria 4235
166 Ga0265338_10056426 3300028800 Bacteria 3483
167 Ga0307511_10004421 3300030521 Bacteria 14347
168 Ga0265760_10030143 3300031090 Bacteria 1596
169 Ga0265332_10024908 3300031238 Bacteria 2630
170 Ga0265328_10025308 3300031239 Bacteria 2236
171 Ga0265320_10016206 3300031240 Bacteria 4185
172 Ga0265325_10005887 3300031241 Bacteria 7513
173 Ga0265329_10002606 3300031242 Bacteria 8128
174 Ga0265331_10007497 3300031250 Bacteria 6308
175 Ga0265331_10054055 3300031250 Bacteria 1913
176 Ga0265316_10037551 3300031344 Bacteria 3908
177 Ga0265316_10108262 3300031344 Bacteria 2107
178 Ga0307509_10000003 3300031507 Bacteria 577578
179 Ga0307408_100034517 3300031548 Bacteria 3543
180 Ga0265313_10029110 3300031595 Bacteria 2861
181 Ga0316575_10014025 3300031665 Bacteria 3003
182 Ga0316575_10019094 3300031665 Bacteria 2617
183 Ga0265314_10031754 3300031711 Bacteria 3893
184 Ga0307516_10001401 3300031730 Bacteria 33337
185 Ga0307415_100005213 3300032126 Bacteria 6870
186 Ga0316583_10003935 3300032133 Bacteria 5277
187 Ga0316596_1032915 3300033541 Bacteria 1350
188 Ga0373936_0001983 3300035113 Bacteria 7577
189 Ga0373955_0035414 3300035172 Bacteria 2644
190 Ga0316574_0027407 3300035398 Bacteria 3432
191 Ga0373937_0198032 3300036401 Bacteria 1888
192 Ga0316582_0040749 3300036647 Bacteria 2900
193 Ga0316584_0043554 3300036712 Bacteria 3347
194 Ga0316584_0089164 3300036712 Bacteria 2309
195 Ga0373925_0031784 3300037068 Bacteria 3882
196 Ga0395900_0401726 3300037418 Bacteria 1334
197 Ga0395898_0006256 3300037466 Bacteria 12739
198 Ga0395901_0201006 3300038443 Bacteria 2089
199 Ga0436365_0891607 3300039437 Bacteria 3330
200 Ga0436365_1863591 3300039437 Bacteria 9458
201 Ga0436360_0306650 3300039438 Bacteria 7093
202 Ga0436360_0733390 3300039438 Bacteria 3863
203 Ga0436363_0086023 3300039450 Bacteria 1494
204 Ga0436363_0142927 3300039450 Bacteria 5763
205 Ga0436362_0988947 3300039453 Bacteria 2867
206 Ga0436362_1018257 3300039453 Bacteria 2577
207 Ga0436362_1059879 3300039453 Bacteria 1497
208 Ga0439443_004179 3300042003 Bacteria 1864
209 Ga0450920_011722 3300042122 Bacteria 1637
210 Ga0450923_002651 3300042125 Bacteria 2596
211 Ga0450896_004472 3300042133 Bacteria 1894
212 Ga0450908_003579 3300042184 Bacteria 3025
213 Ga0439435_0000245 3300042436 Bacteria 7822
214 Ga0439435_0015433 3300042436 Bacteria 1901
215 Ga0439444_0008306 3300042437 Bacteria 1616
216 Ga0466969_0001467 3300044656 Bacteria 12666
217 Ga0466966_0004272 3300044684 Bacteria 9420
218 Ga0466961_0001905 3300044693 Bacteria 13004
219 Ga0466964_0001076 3300044706 Bacteria 9138
220 Ga0453684_0537980 3300044712 Bacteria 1288
221 Ga0466971_0000737 3300044719 Bacteria 13113
222 Ga0466957_0006802 3300044842 Bacteria 6458
223 Ga0466959_0007191 3300045049 Bacteria 7797
224 Ga0451576_0184478 3300045051 Bacteria 2178
225 Ga0466958_0049868 3300045836 Bacteria 2534
226 Ga0495580_0024516 3300046472 Bacteria 4414
227 Ga0495669_0067027 3300046684 Bacteria 1631
228 Ga0495671_0021424 3300046692 Bacteria 3396
229 Ga0495687_027925 3300047443 Bacteria 2633
230 Ga0496101_0003337 3300048904 Bacteria 9995
231 Ga0496102_0040108 3300048905 Bacteria 4234
232 Ga0496102_0087574 3300048905 Bacteria 2877
233 Ga0496104_0012734 3300048907 Bacteria 7576
234 Ga0496106_0012245 3300048909 Bacteria 6332
235 Ga0496107_0090816 3300048910 Bacteria 2231
236 Ga0496108_0008084 3300048911 Bacteria 8534
237 Ga0496108_0030467 3300048911 Bacteria 4472
238 Ga0496110_0004985 3300048913 Bacteria 10367
239 Ga0496111_0001533 3300048914 Bacteria 13263
240 Ga0496112_0133590 3300048915 Bacteria 2452
241 Ga0496112_0187428 3300048915 Bacteria 2032
242 Ga0496114_0002253 3300048917 Bacteria 14687
243 Ga0496115_0018048 3300048918 Bacteria 5407
244 Ga0496118_0036775 3300048921 Bacteria 3952
245 Ga0496118_0055373 3300048921 Bacteria 2994
246 Ga0496121_0000461 3300048924 Bacteria 79954
247 Ga0496125_0004912 3300048928 Bacteria 15136
248 Ga0496126_0060488 3300048929 Bacteria 3406
249 Ga0496126_0216528 3300048929 Bacteria 1611
250 Ga0501031_0089417 3300049568 Bacteria 2008
251 Ga0501036_0027447 3300049572 Bacteria 4810
252 Ga0501036_0310640 3300049572 Bacteria 1318
253 Ga0501037_0109443 3300049573 Bacteria 1991
254 Ga0501038_0048168 3300049574 Bacteria 3689
255 Ga0501038_0142796 3300049574 Bacteria 1957
256 Ga0501039_0002347 3300049575 Bacteria 14083
257 Ga0501039_0021827 3300049575 Bacteria 4912
258 Ga0501039_0061599 3300049575 Bacteria 2906
259 Ga0501040_0015468 3300049576 Bacteria 5042
260 Ga0501040_0026521 3300049576 Bacteria 3898
261 Ga0501041_0006421 3300049577 Bacteria 6882
262 Ga0501041_0020338 3300049577 Bacteria 3968
263 Ga0501041_0022911 3300049577 Bacteria 3742
264 Ga0501041_0023150 3300049577 Bacteria 3725
265 Ga0501042_0025147 3300049578 Bacteria 4181
266 Ga0501046_0041052 3300049580 Bacteria 3693
267 Ga0501047_0154979 3300049581 Bacteria 2165
268 Ga0501048_0016004 3300049582 Bacteria 5531
269 Ga0501048_0056231 3300049582 Bacteria 2792
270 Ga0501068_0043614 3300049584 Bacteria 2699
271 Ga0501071_0004887 3300049587 Bacteria 8545
272 Ga0501071_0006895 3300049587 Bacteria 7408
273 Ga0501071_0175842 3300049587 Bacteria 1603
274 Ga0501072_0020116 3300049588 Bacteria 5169
275 Ga0501072_0024717 3300049588 Bacteria 4676
276 Ga0501072_0056250 3300049588 Bacteria 3100
277 Ga0501075_0011703 3300049591 Bacteria 6217
278 Ga0501075_0027238 3300049591 Bacteria 4211
279 Ga0501075_0086743 3300049591 Bacteria 2371
280 Ga0501076_0009161 3300049592 Bacteria 7294
281 Ga0501076_0025159 3300049592 Bacteria 4605
282 Ga0501077_0056979 3300049593 Bacteria 2481
283 Ga0501079_0016989 3300049741 Bacteria 5557
284 Ga0501079_0102849 3300049741 Bacteria 2215
285 Ga0501080_0003157 3300049742 Bacteria 14519
286 Ga0501080_0052228 3300049742 Bacteria 3804
287 Ga0501080_0308178 3300049742 Bacteria 1435
288 Ga0501081_0013108 3300049743 Bacteria 5451
289 Ga0501081_0016625 3300049743 Bacteria 4865
290 Ga0501081_0028494 3300049743 Bacteria 3769
291 Ga0501081_0121171 3300049743 Bacteria 1863
292 Ga0501083_0113803 3300049744 Bacteria 1777
293 Ga0501083_0202291 3300049744 Bacteria 1295
294 Ga0501045_0000225 3300049824 Bacteria 32621
295 nmdc:mga05p37_276778_c1 3300050507 Bacteria 2003
296 nmdc:mga08y16_142719_c1 3300050511 Bacteria 2490
297 nmdc:mga08y16_46278_c1 3300050511 Bacteria 4555
298 nmdc:mga0n895_67879_c1 3300050512 Bacteria 3532
299 Ga0500646_0006445 3300053090 Bacteria 2986
300 Ga0500617_058203 3300053124 Bacteria 1714
301 Ga0500616_0000569 3300053153 Bacteria 45203
302 Ga0500637_0017200 3300053178 Bacteria 3867
303 Ga0500637_0074780 3300053178 Bacteria 1952
304 Ga0501084_0022989 3300054114 Bacteria 5204
305 Ga0501084_0035091 3300054114 Bacteria 4192
306 Ga0501082_0007102 3300060353 Bacteria 9661
307 Ga0501082_0008631 3300060353 Bacteria 8786
308 Ga0501082_0165073 3300060353 Bacteria 1924
309 Ga0466962_0001942 3300061719 Bacteria 9745
310 Ga0530510_0013730 3300061734 Bacteria 5700
311 Ga0530510_0025314 3300061734 Bacteria 4242
312 Ga0075434_100006745
313 Ga0065715_10107494
314 Ga0065715_10154749
315 Ga0070690_100008681
316 Ga0070690_100066910
317 Ga0070666_10005768
318 Ga0070666_10008546
319 Ga0070666_10060583
320 Ga0070680_100008101
321 Ga0070689_100031699
322 Ga0070669_100149189
323 Ga0070669_100314211
324 Ga0070675_100063176
325 Ga0070671_100000211
326 Ga0070671_100047572
327 Ga0070667_100000176
328 Ga0070667_100004044
329 Ga0070667_100004273
330 Ga0070709_10007688
331 Ga0070714_100001900
332 Ga0070713_100043344
333 Ga0070710_10004740
334 Ga0070711_100002206
335 Ga0070705_100060514
336 Ga0070678_100031656
337 Ga0070681_10063093
338 Ga0070681_10269731
339 Ga0070679_100005267
340 Ga0070679_100012832
341 Ga0070686_100124272
342 Ga0070695_100008975
343 Ga0070696_100021898
344 Ga0070693_100187011
345 Ga0070665_100002453
346 Ga0070665_100013615
347 Ga0070665_100094273
348 Ga0070704_100038991
349 Ga0068855_100030743
350 Ga0068855_100130404
351 Ga0068857_100426067
352 Ga0068856_100009165
353 Ga0068852_100308294
354 Ga0068859_100002490
355 Ga0068859_100023424
356 Ga0068866_10135148
357 Ga0068863_100007707
358 Ga0068863_100030034
359 Ga0068858_100001768
360 Ga0068858_100003825
361 Ga0068860_100005590
362 Ga0068860_100027936
363 Ga0068860_100074219
364 Ga0068862_100231448
365 Ga0081455_10003509
366 Ga0070715_10001451
367 Ga0070712_100015088
368 Ga0097621_100072802
369 Ga0068871_100020345
370 Ga0068865_100003222
371 Ga0075436_100234088
372 Ga0097620_100002490
373 Ga0097620_100023425
374 Ga0099794_10063431
375 Ga0099795_10005006
376 Ga0105250_10035501
377 Ga0105240_10007091
378 Ga0105240_10015264
379 Ga0105240_10091144
380 Ga0111539_10006091
381 Ga0105245_10006928
382 Ga0105247_10000088
383 Ga0105247_10020336
384 Ga0105241_10046411
385 Ga0105242_10001357
386 Ga0105248_10015092
387 Ga0105248_10022103
388 Ga0105237_10116469
389 Ga0105237_10246142
390 Ga0105237_10254224
391 Ga0105238_10059187
392 Ga0105238_10156211
393 Ga0105249_10051803
394 Ga0105030_102247
395 Ga0099796_10010161
396 Ga0105239_10047866
397 Ga0157370_10008536
398 Ga0157370_10356338
399 Ga0157369_10045917
400 Ga0157374_10010878
401 Ga0157378_10010033
402 Ga0163162_10065060
403 Ga0157375_10005181
404 Ga0157514_115792
405 Ga0163163_10217618
406 Ga0157380_10083313
407 Ga0157379_10001073
408 Ga0157379_10019431
409 Ga0213874_10015060
410 Ga0207692_10014912
411 Ga0207710_10000200
412 Ga0207710_10030330
413 Ga0207685_10048605
414 Ga0207699_10031900
415 Ga0207699_10083942
416 Ga0207654_10168535
417 Ga0207707_10000045
418 Ga0207707_10004216
419 Ga0207707_10023452
420 Ga0207695_10005045
421 Ga0207695_10005898
422 Ga0207695_10033031
423 Ga0207695_10123032
424 Ga0207695_10340818
425 Ga0207671_10112295
426 Ga0207693_10000161
427 Ga0207693_10036596
428 Ga0207663_10031573
429 Ga0207663_10064778
430 Ga0207660_10019522
431 Ga0207652_10003813
432 Ga0207652_10041713
433 Ga0207694_10054617
434 Ga0207694_10106496
435 Ga0207650_10031942
436 Ga0207700_10046052
437 Ga0207664_10186303
438 Ga0207644_10002758
439 Ga0207644_10024092
440 Ga0207706_10031105
441 Ga0207686_10025464
442 Ga0207670_10008577
443 Ga0207665_10127443
444 Ga0207691_10057010
445 Ga0207711_10182678
446 Ga0207667_10000887
447 Ga0207667_10157124
448 Ga0207712_10022318
449 Ga0207712_10225818
450 Ga0207668_10002142
451 Ga0207658_10000236
452 Ga0207658_10013360
453 Ga0207658_10074418
454 Ga0207677_10022492
455 Ga0207703_10000656
456 Ga0207703_10001996
457 Ga0207703_10098552
458 Ga0207708_10170403
459 Ga0207702_10038369
460 Ga0207641_10040790
461 Ga0207641_10106983
462 Ga0207641_10473159
463 Ga0207676_10081930
464 Ga0207675_100041394
465 Ga0207683_10077535
466 Ga0207428_10015261
467 Ga0207428_10025945
468 Ga0268266_10002139
469 Ga0268266_10227033
470 Ga0268265_10000595
471 Ga0268264_10037581
472 Ga0268264_10095058
473 Ga0265334_10000887
474 Ga0265318_10004262
475 Ga0265338_10020666
476 Ga0265338_10042444
477 Ga0265338_10056426
478 Ga0307511_10004421
479 Ga0265760_10030143
480 Ga0265332_10024908
481 Ga0265328_10025308
482 Ga0265320_10016206
483 Ga0265325_10005887
484 Ga0265329_10002606
485 Ga0265331_10007497
486 Ga0265331_10054055
487 Ga0265316_10037551
488 Ga0265316_10108262
489 Ga0307509_10000003
490 Ga0307408_100034517
491 Ga0265313_10029110
492 Ga0316575_10014025
493 Ga0316575_10019094
494 Ga0265314_10031754
495 Ga0307516_10001401
496 Ga0307415_100005213
497 Ga0316583_10003935
498 Ga0316596_1032915
499 Ga0373936_0001983
500 Ga0373955_0035414
501 Ga0316574_0027407
502 Ga0373937_0198032
503 Ga0316582_0040749
504 Ga0316584_0043554
505 Ga0316584_0089164
506 Ga0373925_0031784
507 Ga0395900_0401726
508 Ga0395898_0006256
509 Ga0395901_0201006
510 Ga0436365_0891607
511 Ga0436365_1863591
512 Ga0436360_0306650
513 Ga0436360_0733390
514 Ga0436363_0086023
515 Ga0436363_0142927
516 Ga0436362_0988947
517 Ga0436362_1018257
518 Ga0436362_1059879
519 Ga0439443_004179
520 Ga0450920_011722
521 Ga0450923_002651
522 Ga0450896_004472
523 Ga0450908_003579
524 Ga0439435_0000245
525 Ga0439435_0015433
526 Ga0439444_0008306
527 Ga0466969_0001467
528 Ga0466966_0004272
529 Ga0466961_0001905
530 Ga0466964_0001076
531 Ga0453684_0537980
532 Ga0466971_0000737
533 Ga0466957_0006802
534 Ga0466959_0007191
535 Ga0451576_0184478
536 Ga0466958_0049868
537 Ga0495580_0024516
538 Ga0495669_0067027
539 Ga0495671_0021424
540 Ga0495687_027925
541 Ga0496101_0003337
542 Ga0496102_0040108
543 Ga0496102_0087574
544 Ga0496104_0012734
545 Ga0496106_0012245
546 Ga0496107_0090816
547 Ga0496108_0008084
548 Ga0496108_0030467
549 Ga0496110_0004985
550 Ga0496111_0001533
551 Ga0496112_0133590
552 Ga0496112_0187428
553 Ga0496114_0002253
554 Ga0496115_0018048
555 Ga0496118_0036775
556 Ga0496118_0055373
557 Ga0496121_0000461
558 Ga0496125_0004912
559 Ga0496126_0060488
560 Ga0496126_0216528
561 Ga0501031_0089417
562 Ga0501036_0027447
563 Ga0501036_0310640
564 Ga0501037_0109443
565 Ga0501038_0048168
566 Ga0501038_0142796
567 Ga0501039_0002347
568 Ga0501039_0021827
569 Ga0501039_0061599
570 Ga0501040_0015468
571 Ga0501040_0026521
572 Ga0501041_0006421
573 Ga0501041_0020338
574 Ga0501041_0022911
575 Ga0501041_0023150
576 Ga0501042_0025147
577 Ga0501046_0041052
578 Ga0501047_0154979
579 Ga0501048_0016004
580 Ga0501048_0056231
581 Ga0501068_0043614
582 Ga0501071_0004887
583 Ga0501071_0006895
584 Ga0501071_0175842
585 Ga0501072_0020116
586 Ga0501072_0024717
587 Ga0501072_0056250
588 Ga0501075_0011703
589 Ga0501075_0027238
590 Ga0501075_0086743
591 Ga0501076_0009161
592 Ga0501076_0025159
593 Ga0501077_0056979
594 Ga0501079_0016989
595 Ga0501079_0102849
596 Ga0501080_0003157
597 Ga0501080_0052228
598 Ga0501080_0308178
599 Ga0501081_0013108
600 Ga0501081_0016625
601 Ga0501081_0028494
602 Ga0501081_0121171
603 Ga0501083_0113803
604 Ga0501083_0202291
605 Ga0501045_0000225
606 nmdc:mga05p37_276778_c1
607 nmdc:mga08y16_142719_c1
608 nmdc:mga08y16_46278_c1
609 nmdc:mga0n895_67879_c1
610 Ga0500646_0006445
611 Ga0500617_058203
612 Ga0500616_0000569
613 Ga0500637_0017200
614 Ga0500637_0074780
615 Ga0501084_0022989
616 Ga0501084_0035091
617 Ga0501082_0007102
618 Ga0501082_0008631
619 Ga0501082_0165073
620 Ga0466962_0001942
621 Ga0530510_0013730
622 Ga0530510_0025314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00146

NADHdh

NADH dehydrogenase

25

356

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7l-assembly1.cif.gz_H complex i from e. coli, ddm/lmng-purified, with nadh and fmn, open state 0.8784 13 359
7p7m-assembly1.cif.gz_H complex i from e. coli, ddm/lmng-purified, inhibited by piericidin a, open state 0.8783 13 357
7arb-assembly1.cif.gz_H cryo-em structure of arabidopsis thaliana complex-i (complete composition) 0.878 22 357
7z83-assembly1.cif.gz_H complex i from e. coli, ddm/lmng-purified, under turnover at ph 8, open state 0.8773 13 359
7qsn-assembly1.cif.gz_H bovine complex i in lipid nanodisc, deactive-apo 0.8768 22 357
ID Description Score Start End Superfamily
5ic0A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4665 95 174 1.20.120.230
af_Q9H1K6_144_260_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4033 89 258 1.20.120.230
af_Q9H1K6_144_260_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3963 89 258 1.20.120.230
5ic0A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3305 95 174 1.20.120.230
2x0cA02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.328 92 270 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A5H2P0N8-F1-model_v4 NADH-ubiquinone oxidoreductase chain 1 (EC 7.1.1.2) 0.9641 79 197 GO:0003954
GO:0005743
GO:0008137
GO:0009060
AF-A0A6A6AVZ4-F1-model_v4 NADH-ubiquinone oxidoreductase chain 1 0.954 19 197 GO:0003954
GO:0005743
GO:0009060
AF-A0A7C2K6Y5-F1-model_v4 NADH-quinone oxidoreductase subunit H (EC 1.6.5.11) 0.9472 15 195 GO:0003954
GO:0005886
GO:0009060
AF-A0A3M2TKW8-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.9438 43 197 GO:0003954
GO:0005886
GO:0009060
AF-A0A088FYI5-F1-model_v4 NADH-ubiquinone oxidoreductase chain 1 (EC 7.1.1.2) 0.9429 38 198 GO:0003954
GO:0005743
GO:0008137
GO:0009060

Map