F401140

General Info

Members Datasets Scaffolds Average Seq Length
311 202 622 235

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10003002|Ga0075362_100030023
Length 283
Sequence MCGACGAKPWCRRQLDAPPRSALRVLTAPRGGRGRLGAARRRPAFALDSSLYLIVALGAIVAGFVQGLSGFAFGLVAMSFWAWTVDPKLAAVLATFGALTGQVIAAVTVRRGFDRALLLPFVLGGLMGVPLGVWLLPRLDVPLFKACLGGLLVIWCPAMLMARNLPRVSAGGRAADGAVAIPTLWCTLRGLEKDVQRSVIQNFNLSMLLVTFSVYLGTGLVGVPMLPLLGIVALAVLVPVLLGARLYIGISEAGFRKIVLGLLTLSGVALLMSSVPVLLARAG

Samples

Sample ID Description Type Environment
1 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
54 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
58 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
82 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
86 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
105 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
106 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
111 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
112 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
117 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
118 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
119 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
120 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
121 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
124 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
176 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
177 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
178 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
179 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
180 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
184 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
185 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
188 2511231024 Pseudomonas sp. GM84 Isolate Nodule
189 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
190 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
191 2765235841 Pseudomonas putida AA7 Isolate Unclassified
192 2842733646 Variovorax sp. R-72446 Isolate Unclassified
193 2842747753 Variovorax sp. R-72060 Isolate Unclassified
194 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
195 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
196 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
197 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
198 2941479691
199 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
200 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
201 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
202 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.86
Metatranscriptomes 0
Isolates 5.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.76
Nodule 1.93
Rhizoplane 1.93
Rhizosphere 38.26
Stem 0
Stem Tuber 0
Unclassified 4.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075362_10003002 3300006177 Bacteria 5805
2 JGI25155J39150_1000090 3300002704 Bacteria 51836
3 JGI25155J39150_1000353 3300002704 Bacteria 14458
4 JGI25156J39149_1000148 3300002705 Bacteria 51890
5 JGI25156J39149_1002767 3300002705 Bacteria 6091
6 JGI25154J39366_1000155 3300002738 Bacteria 52889
7 JGI25154J39366_1000297 3300002738 Bacteria 29585
8 JGI25157J39369_1000183 3300002741 Bacteria 52889
9 JGI25150J39212_1009293 3300002774 Bacteria 1881
10 JGI25159J45721_1000691 3300002987 Bacteria 14796
11 JGI25159J45721_1003197 3300002987 Bacteria 5873
12 JGI25151J46595_10001945 3300003187 Bacteria 13087
13 JGI25151J46595_10003877 3300003187 Bacteria 8082
14 JGI25151J46595_10005361 3300003187 Bacteria 6631
15 JGI25151J46595_10051147 3300003187 Bacteria 1401
16 JGI25160J50197_1000059 3300003354 Bacteria 116962
17 JGI25161J50226_1000109 3300003374 Bacteria 64835
18 Ga0055526_1002106 3300003771 Bacteria 13658
19 Ga0055526_1012858 3300003771 Bacteria 3602
20 Ga0055526_1054662 3300003771 Bacteria 885
21 Ga0055537_1000737 3300003773 Bacteria 16770
22 Ga0055537_1002580 3300003773 Bacteria 5946
23 Ga0055524_1000052 3300003775 Bacteria 144959
24 Ga0055524_1000279 3300003775 Bacteria 50624
25 Ga0055524_1001552 3300003775 Bacteria 12941
26 Ga0055536_1001302 3300003781 Bacteria 15354
27 Ga0055536_1001865 3300003781 Bacteria 12295
28 Ga0055536_1003309 3300003781 Bacteria 8720
29 Ga0055534_1001717 3300003784 Bacteria 8307
30 Ga0055534_1010455 3300003784 Bacteria 1943
31 Ga0055534_1016586 3300003784 Bacteria 1320
32 Ga0055534_1022072 3300003784 Bacteria 1056
33 Ga0055528_1019143 3300003790 Bacteria 2288
34 Ga0055530_10001255 3300003791 Bacteria 19265
35 Ga0055530_10004197 3300003791 Bacteria 7585
36 Ga0055530_10021988 3300003791 Bacteria 1866
37 Ga0055540_1000019 3300003792 Bacteria 210593
38 Ga0055540_1000553 3300003792 Bacteria 27912
39 Ga0055531_10000726 3300003794 Bacteria 27911
40 Ga0055531_10019310 3300003794 Bacteria 2764
41 Ga0055543_1000138 3300004625 Bacteria 60628
42 Ga0065165_1005883 3300005262 Bacteria 6667
43 Ga0065165_1026603 3300005262 Bacteria 1901
44 Ga0070669_100068262 3300005353 Bacteria 2624
45 Ga0070669_100124069 3300005353 Bacteria 1974
46 Ga0070713_100035607 3300005436 Bacteria 4009
47 Ga0070665_100387800 3300005548 Bacteria 1404
48 Ga0068855_100416638 3300005563 Unclassified 1470
49 Ga0068854_100624489 3300005578 Bacteria 922
50 Ga0068856_100475125 3300005614 Bacteria 1271
51 Ga0068852_100017301 3300005616 Bacteria 5652
52 Ga0068859_100179489 3300005617 Bacteria 2200
53 Ga0068860_100013012 3300005843 Bacteria 8171
54 Ga0070717_10048880 3300006028 Bacteria 3471
55 Ga0070717_10424676 3300006028 Bacteria 1196
56 Ga0075363_100058318 3300006048 Bacteria 2073
57 Ga0075364_10043363 3300006051 Bacteria 2924
58 Ga0075432_10051173 3300006058 Bacteria 1458
59 Ga0075362_10225773 3300006177 Bacteria 916
60 Ga0075369_10225273 3300006186 Bacteria 868
61 Ga0075366_10003640 3300006195 Bacteria 8167
62 Ga0075370_10191445 3300006353 Bacteria 1205
63 Ga0075370_10233539 3300006353 Bacteria 1088
64 Ga0075428_100366516 3300006844 Unclassified 1545
65 Ga0097620_100179491 3300006931 Bacteria 2200
66 Ga0079104_1000206 3300006946 Bacteria 82424
67 Ga0105251_10003777 3300009011 Bacteria 10826
68 Ga0105240_10003746 3300009093 Bacteria 23491
69 Ga0111539_10312031 3300009094 Unclassified 1830
70 Ga0105243_10003767 3300009148 Bacteria 12156
71 Ga0105238_10331958 3300009551 Bacteria 1508
72 Ga0157326_1006021 3300012513 Bacteria 1291
73 Ga0157371_10000022 3300013102 Bacteria 295029
74 Ga0182008_10000536 3300014497 Bacteria 28332
75 Ga0182008_10051325 3300014497 Bacteria 2046
76 Ga0182007_10000004 3300015262 Bacteria 485875
77 Ga0182005_1000254 3300015265 Bacteria 34035
78 Ga0183362_10001 3300015683 Bacteria 2046624
79 Ga0213872_10018359 3300021361 Bacteria 3227
80 Ga0209435_100014 3300025206 Bacteria 322129
81 Ga0209435_100274 3300025206 Bacteria 12587
82 Ga0209436_102041 3300025208 Bacteria 6353
83 Ga0209646_1000001 3300025246 Bacteria 3092932
84 Ga0209646_1000173 3300025246 Bacteria 84706
85 Ga0209026_1000137 3300025250 Bacteria 116282
86 Ga0209026_1003174 3300025250 Bacteria 5570
87 Ga0209759_1000013 3300025256 Bacteria 399300
88 Ga0209759_1000224 3300025256 Bacteria 84649
89 Ga0209565_1000028 3300025263 Bacteria 348536
90 Ga0209565_1000449 3300025263 Bacteria 32070
91 Ga0209565_1000821 3300025263 Bacteria 17655
92 Ga0209565_1029389 3300025263 Bacteria 1079
93 Ga0209673_1000035 3300025273 Bacteria 328411
94 Ga0209130_1000052 3300025284 Bacteria 216971
95 Ga0209130_1000759 3300025284 Bacteria 27970
96 Ga0209675_1000111 3300025291 Bacteria 114805
97 Ga0209675_1001023 3300025291 Bacteria 17504
98 Ga0209675_1003000 3300025291 Bacteria 8305
99 Ga0209675_1004096 3300025291 Bacteria 6634
100 Ga0209676_1000634 3300025292 Bacteria 50573
101 Ga0209676_1005397 3300025292 Bacteria 6699
102 Ga0209025_1000764 3300025294 Bacteria 53509
103 Ga0209025_1001864 3300025294 Bacteria 24710
104 Ga0209025_1003486 3300025294 Bacteria 14832
105 Ga0209025_1004606 3300025294 Bacteria 11807
106 Ga0209025_1008344 3300025294 Bacteria 7467
107 Ga0209564_1000531 3300025295 Bacteria 62085
108 Ga0209564_1000714 3300025295 Bacteria 48032
109 Ga0209564_1005740 3300025295 Bacteria 6932
110 Ga0209564_1009115 3300025295 Bacteria 4776
111 Ga0209758_1014532 3300025297 Bacteria 4177
112 Ga0209050_1000023 3300025298 Bacteria 537172
113 Ga0209050_1001761 3300025298 Bacteria 21453
114 Ga0209050_1006122 3300025298 Bacteria 7257
115 Ga0209050_1009042 3300025298 Bacteria 5183
116 Ga0209050_1030046 3300025298 Bacteria 1722
117 Ga0209256_1000003 3300025299 Bacteria 1661127
118 Ga0209256_1000036 3300025299 Bacteria 386664
119 Ga0209256_1000432 3300025299 Bacteria 65073
120 Ga0209256_1003811 3300025299 Bacteria 10105
121 Ga0207426_1000306 3300025302 Bacteria 96112
122 Ga0207426_1003626 3300025302 Bacteria 8175
123 Ga0209051_1000017 3300025303 Bacteria 537172
124 Ga0209051_1000071 3300025303 Bacteria 210843
125 Ga0209051_1012624 3300025303 Bacteria 4075
126 Ga0209051_1052796 3300025303 Bacteria 1340
127 Ga0209257_1000041 3300025304 Bacteria 537172
128 Ga0209257_1000367 3300025304 Bacteria 91077
129 Ga0209257_1008645 3300025304 Bacteria 5709
130 Ga0207713_1040115 3300025735 Bacteria 1968
131 Ga0207695_10004508 3300025913 Bacteria 18954
132 Ga0207695_10041683 3300025913 Bacteria 4912
133 Ga0207657_10016247 3300025919 Bacteria 7183
134 Ga0207681_10003538 3300025923 Bacteria 9727
135 Ga0207694_10155700 3300025924 Bacteria 1843
136 Ga0207644_10721821 3300025931 Bacteria 832
137 Ga0207709_10002287 3300025935 Bacteria 12156
138 Ga0207667_10044317 3300025949 Bacteria 4715
139 Ga0207667_10702221 3300025949 Bacteria 1014
140 Ga0207683_10042513 3300026121 Bacteria 3970
141 Ga0207698_10011670 3300026142 Bacteria 5709
142 Ga0209281_1000259 3300027111 Bacteria 101905
143 Ga0209371_1000749 3300027312 Bacteria 27097
144 Ga0209371_1028619 3300027312 Bacteria 1241
145 Ga0268264_10321073 3300028381 Bacteria 1464
146 Ga0307515_10000471 3300028794 Bacteria 96225
147 Ga0268256_1000633 3300030500 Bacteria 27097
148 Ga0268256_1025366 3300030500 Bacteria 1507
149 Ga0307512_10013623 3300030522 Bacteria 7616
150 Ga0265316_10586542 3300031344 Bacteria 791
151 Ga0307513_10000006 3300031456 Bacteria 470848
152 Ga0307513_10000011 3300031456 Bacteria 354929
153 Ga0307513_10159888 3300031456 Bacteria 2147
154 Ga0307513_10179425 3300031456 Bacteria 1983
155 Ga0307509_10001002 3300031507 Bacteria 48561
156 Ga0307514_10001153 3300031649 Bacteria 35997
157 Ga0307516_10104209 3300031730 Bacteria 2649
158 Ga0307405_10065730 3300031731 Bacteria 2310
159 Ga0307406_10060792 3300031901 Bacteria 2437
160 Ga0307412_10000121 3300031911 Bacteria 59488
161 Ga0307510_10062411 3300033180 Bacteria 3808
162 Ga0307510_10076125 3300033180 Bacteria 3303
163 Ga0373934_0073814 3300035086 Bacteria 1366
164 Ga0373953_0143034 3300035117 Bacteria 1023
165 Ga0373935_0100965 3300035692 Bacteria 1902
166 Ga0373935_0126341 3300035692 Unclassified 1714
167 Ga0373927_0217042 3300035695 Unclassified 1257
168 Ga0373933_0017489 3300035724 Bacteria 4022
169 Ga0373937_0001040 3300036401 Bacteria 23446
170 Ga0373925_0101413 3300037068 Bacteria 2213
171 Ga0373925_0190797 3300037068 Unclassified 1626
172 Ga0436361_0282341 3300039447 Bacteria 8324
173 Ga0439436_0002814 3300041404 Bacteria 5271
174 Ga0439461_0012620 3300041410 Bacteria 1584
175 Ga0439466_0001657 3300041411 Bacteria 8699
176 Ga0439465_0000034 3300041413 Bacteria 28027
177 Ga0439465_0044723 3300041413 Bacteria 1439
178 Ga0451793_0728153 3300041452 Bacteria 1209
179 Ga0439431_0007515 3300041997 Bacteria 2432
180 Ga0439442_003289 3300042002 Bacteria 3194
181 Ga0439445_0002637 3300042004 Bacteria 3994
182 Ga0439445_0056816 3300042004 Bacteria 1065
183 Ga0439432_003253 3300042006 Bacteria 6045
184 Ga0439449_0005146 3300042007 Bacteria 5026
185 Ga0439456_000022 3300042013 Bacteria 60329
186 Ga0439462_0036457 3300042015 Bacteria 1309
187 Ga0450900_000745 3300042136 Bacteria 2792
188 Ga0450902_000269 3300042137 Bacteria 6267
189 Ga0450905_000081 3300042142 Bacteria 9143
190 Ga0450906_004138 3300042145 Bacteria 3068
191 Ga0439446_0012688 3300042156 Bacteria 2303
192 Ga0450909_002805 3300042185 Bacteria 2476
193 Ga0439434_0020308 3300042435 Bacteria 1994
194 Ga0450893_0001870 3300042532 Bacteria 3259
195 Ga0450901_000071 3300042533 Bacteria 10373
196 Ga0466965_0042010 3300044683 Bacteria 2254
197 Ga0466966_0020304 3300044684 Bacteria 4371
198 Ga0466971_0104950 3300044719 Bacteria 1301
199 Ga0495592_0000611 3300046454 Bacteria 25268
200 Ga0495590_0004552 3300046457 Bacteria 5588
201 Ga0495653_0059349 3300046463 Bacteria 2904
202 Ga0495650_0096912 3300046471 Bacteria 1113
203 Ga0495664_0003227 3300046477 Bacteria 8854
204 Ga0495608_0007915 3300046511 Bacteria 7469
205 Ga0495618_0279871 3300046514 Unclassified 1041
206 Ga0495628_0199062 3300046516 Unclassified 1510
207 Ga0495652_0377549 3300046529 Unclassified 1009
208 Ga0495640_0053019 3300046533 Unclassified 2782
209 Ga0495587_0012684 3300046536 Bacteria 5300
210 Ga0495645_0001523 3300046543 Bacteria 15639
211 Ga0495667_0031618 3300046559 Unclassified 3551
212 Ga0495635_0118540 3300046663 Unclassified 1806
213 Ga0495646_0068740 3300046680 Bacteria 2090
214 Ga0495600_0118749 3300046809 Bacteria 1720
215 Ga0495660_0049152 3300046810 Bacteria 2304
216 Ga0495581_0199716 3300047315 Bacteria 1170
217 Ga0495674_0050497 3300047319 Bacteria 3670
218 Ga0495680_0018716 3300047322 Bacteria 5870
219 Ga0495675_0019668 3300047444 Bacteria 4290
220 Ga0495684_0133807 3300047471 Unclassified 1861
221 Ga0495684_0383271 3300047471 Unclassified 991
222 Ga0495602_0001071 3300048088 Bacteria 26855
223 Ga0495602_0092337 3300048088 Bacteria 2508
224 Ga0496101_0014978 3300048904 Bacteria 5218
225 Ga0496104_0061809 3300048907 Bacteria 3551
226 Ga0496111_0186012 3300048914 Bacteria 1544
227 Ga0496112_0652394 3300048915 Bacteria 982
228 Ga0496114_0002158 3300048917 Bacteria 14977
229 Ga0496116_0006867 3300048919 Bacteria 10221
230 Ga0496116_0010039 3300048919 Bacteria 7984
231 Ga0496116_0021650 3300048919 Bacteria 4841
232 Ga0496116_0048886 3300048919 Bacteria 2834
233 Ga0496116_0091811 3300048919 Bacteria 1844
234 Ga0496117_0015924 3300048920 Bacteria 6371
235 Ga0496117_0178599 3300048920 Bacteria 1223
236 Ga0496118_0001773 3300048921 Bacteria 31247
237 Ga0496118_0025133 3300048921 Bacteria 5118
238 Ga0496118_0040513 3300048921 Bacteria 3703
239 Ga0496118_0065156 3300048921 Bacteria 2667
240 Ga0496118_0254006 3300048921 Bacteria 997
241 Ga0496119_0000632 3300048922 Bacteria 47533
242 Ga0496119_0031589 3300048922 Bacteria 3547
243 Ga0496120_0000204 3300048923 Bacteria 101626
244 Ga0496121_0010790 3300048924 Bacteria 10239
245 Ga0496121_0014412 3300048924 Bacteria 8392
246 Ga0496121_0210849 3300048924 Bacteria 1376
247 Ga0496122_0000134 3300048925 Bacteria 171080
248 Ga0496122_0000450 3300048925 Bacteria 85686
249 Ga0496122_0008475 3300048925 Bacteria 11078
250 Ga0496122_0169329 3300048925 Bacteria 1319
251 Ga0496123_0000176 3300048926 Bacteria 130010
252 Ga0496123_0000307 3300048926 Bacteria 95174
253 Ga0496123_0010932 3300048926 Bacteria 7941
254 Ga0496123_0128097 3300048926 Bacteria 1413
255 Ga0496124_0004145 3300048927 Bacteria 17118
256 Ga0496124_0004275 3300048927 Bacteria 16792
257 Ga0496124_0006956 3300048927 Bacteria 12152
258 Ga0496124_0061359 3300048927 Bacteria 3151
259 Ga0496124_0075063 3300048927 Bacteria 2794
260 Ga0496124_0098362 3300048927 Bacteria 2374
261 Ga0496124_0153882 3300048927 Bacteria 1801
262 Ga0496124_0330682 3300048927 Bacteria 1087
263 Ga0496125_0000132 3300048928 Bacteria 162176
264 Ga0496125_0001680 3300048928 Bacteria 30949
265 Ga0496125_0004153 3300048928 Bacteria 16888
266 Ga0496125_0004311 3300048928 Bacteria 16516
267 Ga0496125_0007623 3300048928 Bacteria 11483
268 Ga0496125_0019377 3300048928 Bacteria 6419
269 Ga0496125_0031572 3300048928 Bacteria 4719
270 Ga0496126_0000201 3300048929 Bacteria 132938
271 Ga0496126_0040923 3300048929 Bacteria 4293
272 Ga0496126_0112054 3300048929 Bacteria 2376
273 nmdc:mga03683_167583_c1 3300050489 Bacteria 997
274 nmdc:mga03683_69176_c1 3300050489 Bacteria 1506
275 nmdc:mga03n38_126045_c1 3300050490 Bacteria 1264
276 nmdc:mga00v17_159770_c1 3300050491 Bacteria 1450
277 nmdc:mga0k408_28050_c1 3300050493 Bacteria 3200
278 nmdc:mga07m45_28990_c1 3300050496 Bacteria 3058
279 nmdc:mga0sz30_226087_c1 3300050516 Bacteria 832
280 Ga0495601_0235360 3300053077 Bacteria 1196
281 Ga0495595_0002589 3300053084 Bacteria 7096
282 Ga0500650_0157705 3300053098 Bacteria 1047
283 Ga0500593_000553 3300053117 Bacteria 14510
284 Ga0500608_161225 3300053122 Bacteria 972
285 Ga0500618_029857 3300053125 Bacteria 1285
286 Ga0500559_0001223 3300053136 Bacteria 15216
287 Ga0500564_030941 3300053138 Bacteria 2466
288 Ga0500568_0001780 3300053139 Bacteria 13275
289 Ga0500573_0035049 3300053140 Bacteria 2895
290 Ga0500604_0044426 3300053151 Bacteria 1353
291 Ga0500645_000474 3300053730 Bacteria 27453
292 Ga0500645_003967 3300053730 Bacteria 5825
293 Ga0500645_007939 3300053730 Bacteria 3658
294 Ga0500661_016836 3300055283 Bacteria 1306
295 Ga0466962_0192254 3300061719 Bacteria 996
296 2511244865 2511231002 Bacteria 5042903
297 2511374444 2511231024 Bacteria 5835885
298 2513952315 2513237150 Bacteria 6553639
299 2514041790 2513237165 Bacteria 6771773
300 2765583274 2765235841 Bacteria 6137024
301 2842734732 2842733646 Bacteria 5716726
302 2842748499 2842747753 Bacteria 5578255
303 2885195600 2885192300 Bacteria 5882526
304 2904482497 2904479285 Bacteria 5073931
305 2939656097 2939651529 Bacteria 5895393
306 2941475940 2941475908 Bacteria 4145589
307 2941481337
308 2974321640 2974320154 Bacteria 4571377
309 644751120 644736347 Bacteria 6476522
310 8054931794 8054929484 Bacteria 5599761
311 8056122959 8056120720 Bacteria 5758328
312 Ga0075362_10003002
313 JGI25155J39150_1000090
314 JGI25155J39150_1000353
315 JGI25156J39149_1000148
316 JGI25156J39149_1002767
317 JGI25154J39366_1000155
318 JGI25154J39366_1000297
319 JGI25157J39369_1000183
320 JGI25150J39212_1009293
321 JGI25159J45721_1000691
322 JGI25159J45721_1003197
323 JGI25151J46595_10001945
324 JGI25151J46595_10003877
325 JGI25151J46595_10005361
326 JGI25151J46595_10051147
327 JGI25160J50197_1000059
328 JGI25161J50226_1000109
329 Ga0055526_1002106
330 Ga0055526_1012858
331 Ga0055526_1054662
332 Ga0055537_1000737
333 Ga0055537_1002580
334 Ga0055524_1000052
335 Ga0055524_1000279
336 Ga0055524_1001552
337 Ga0055536_1001302
338 Ga0055536_1001865
339 Ga0055536_1003309
340 Ga0055534_1001717
341 Ga0055534_1010455
342 Ga0055534_1016586
343 Ga0055534_1022072
344 Ga0055528_1019143
345 Ga0055530_10001255
346 Ga0055530_10004197
347 Ga0055530_10021988
348 Ga0055540_1000019
349 Ga0055540_1000553
350 Ga0055531_10000726
351 Ga0055531_10019310
352 Ga0055543_1000138
353 Ga0065165_1005883
354 Ga0065165_1026603
355 Ga0070669_100068262
356 Ga0070669_100124069
357 Ga0070713_100035607
358 Ga0070665_100387800
359 Ga0068855_100416638
360 Ga0068854_100624489
361 Ga0068856_100475125
362 Ga0068852_100017301
363 Ga0068859_100179489
364 Ga0068860_100013012
365 Ga0070717_10048880
366 Ga0070717_10424676
367 Ga0075363_100058318
368 Ga0075364_10043363
369 Ga0075432_10051173
370 Ga0075362_10225773
371 Ga0075369_10225273
372 Ga0075366_10003640
373 Ga0075370_10191445
374 Ga0075370_10233539
375 Ga0075428_100366516
376 Ga0097620_100179491
377 Ga0079104_1000206
378 Ga0105251_10003777
379 Ga0105240_10003746
380 Ga0111539_10312031
381 Ga0105243_10003767
382 Ga0105238_10331958
383 Ga0157326_1006021
384 Ga0157371_10000022
385 Ga0182008_10000536
386 Ga0182008_10051325
387 Ga0182007_10000004
388 Ga0182005_1000254
389 Ga0183362_10001
390 Ga0213872_10018359
391 Ga0209435_100014
392 Ga0209435_100274
393 Ga0209436_102041
394 Ga0209646_1000001
395 Ga0209646_1000173
396 Ga0209026_1000137
397 Ga0209026_1003174
398 Ga0209759_1000013
399 Ga0209759_1000224
400 Ga0209565_1000028
401 Ga0209565_1000449
402 Ga0209565_1000821
403 Ga0209565_1029389
404 Ga0209673_1000035
405 Ga0209130_1000052
406 Ga0209130_1000759
407 Ga0209675_1000111
408 Ga0209675_1001023
409 Ga0209675_1003000
410 Ga0209675_1004096
411 Ga0209676_1000634
412 Ga0209676_1005397
413 Ga0209025_1000764
414 Ga0209025_1001864
415 Ga0209025_1003486
416 Ga0209025_1004606
417 Ga0209025_1008344
418 Ga0209564_1000531
419 Ga0209564_1000714
420 Ga0209564_1005740
421 Ga0209564_1009115
422 Ga0209758_1014532
423 Ga0209050_1000023
424 Ga0209050_1001761
425 Ga0209050_1006122
426 Ga0209050_1009042
427 Ga0209050_1030046
428 Ga0209256_1000003
429 Ga0209256_1000036
430 Ga0209256_1000432
431 Ga0209256_1003811
432 Ga0207426_1000306
433 Ga0207426_1003626
434 Ga0209051_1000017
435 Ga0209051_1000071
436 Ga0209051_1012624
437 Ga0209051_1052796
438 Ga0209257_1000041
439 Ga0209257_1000367
440 Ga0209257_1008645
441 Ga0207713_1040115
442 Ga0207695_10004508
443 Ga0207695_10041683
444 Ga0207657_10016247
445 Ga0207681_10003538
446 Ga0207694_10155700
447 Ga0207644_10721821
448 Ga0207709_10002287
449 Ga0207667_10044317
450 Ga0207667_10702221
451 Ga0207683_10042513
452 Ga0207698_10011670
453 Ga0209281_1000259
454 Ga0209371_1000749
455 Ga0209371_1028619
456 Ga0268264_10321073
457 Ga0307515_10000471
458 Ga0268256_1000633
459 Ga0268256_1025366
460 Ga0307512_10013623
461 Ga0265316_10586542
462 Ga0307513_10000006
463 Ga0307513_10000011
464 Ga0307513_10159888
465 Ga0307513_10179425
466 Ga0307509_10001002
467 Ga0307514_10001153
468 Ga0307516_10104209
469 Ga0307405_10065730
470 Ga0307406_10060792
471 Ga0307412_10000121
472 Ga0307510_10062411
473 Ga0307510_10076125
474 Ga0373934_0073814
475 Ga0373953_0143034
476 Ga0373935_0100965
477 Ga0373935_0126341
478 Ga0373927_0217042
479 Ga0373933_0017489
480 Ga0373937_0001040
481 Ga0373925_0101413
482 Ga0373925_0190797
483 Ga0436361_0282341
484 Ga0439436_0002814
485 Ga0439461_0012620
486 Ga0439466_0001657
487 Ga0439465_0000034
488 Ga0439465_0044723
489 Ga0451793_0728153
490 Ga0439431_0007515
491 Ga0439442_003289
492 Ga0439445_0002637
493 Ga0439445_0056816
494 Ga0439432_003253
495 Ga0439449_0005146
496 Ga0439456_000022
497 Ga0439462_0036457
498 Ga0450900_000745
499 Ga0450902_000269
500 Ga0450905_000081
501 Ga0450906_004138
502 Ga0439446_0012688
503 Ga0450909_002805
504 Ga0439434_0020308
505 Ga0450893_0001870
506 Ga0450901_000071
507 Ga0466965_0042010
508 Ga0466966_0020304
509 Ga0466971_0104950
510 Ga0495592_0000611
511 Ga0495590_0004552
512 Ga0495653_0059349
513 Ga0495650_0096912
514 Ga0495664_0003227
515 Ga0495608_0007915
516 Ga0495618_0279871
517 Ga0495628_0199062
518 Ga0495652_0377549
519 Ga0495640_0053019
520 Ga0495587_0012684
521 Ga0495645_0001523
522 Ga0495667_0031618
523 Ga0495635_0118540
524 Ga0495646_0068740
525 Ga0495600_0118749
526 Ga0495660_0049152
527 Ga0495581_0199716
528 Ga0495674_0050497
529 Ga0495680_0018716
530 Ga0495675_0019668
531 Ga0495684_0133807
532 Ga0495684_0383271
533 Ga0495602_0001071
534 Ga0495602_0092337
535 Ga0496101_0014978
536 Ga0496104_0061809
537 Ga0496111_0186012
538 Ga0496112_0652394
539 Ga0496114_0002158
540 Ga0496116_0006867
541 Ga0496116_0010039
542 Ga0496116_0021650
543 Ga0496116_0048886
544 Ga0496116_0091811
545 Ga0496117_0015924
546 Ga0496117_0178599
547 Ga0496118_0001773
548 Ga0496118_0025133
549 Ga0496118_0040513
550 Ga0496118_0065156
551 Ga0496118_0254006
552 Ga0496119_0000632
553 Ga0496119_0031589
554 Ga0496120_0000204
555 Ga0496121_0010790
556 Ga0496121_0014412
557 Ga0496121_0210849
558 Ga0496122_0000134
559 Ga0496122_0000450
560 Ga0496122_0008475
561 Ga0496122_0169329
562 Ga0496123_0000176
563 Ga0496123_0000307
564 Ga0496123_0010932
565 Ga0496123_0128097
566 Ga0496124_0004145
567 Ga0496124_0004275
568 Ga0496124_0006956
569 Ga0496124_0061359
570 Ga0496124_0075063
571 Ga0496124_0098362
572 Ga0496124_0153882
573 Ga0496124_0330682
574 Ga0496125_0000132
575 Ga0496125_0001680
576 Ga0496125_0004153
577 Ga0496125_0004311
578 Ga0496125_0007623
579 Ga0496125_0019377
580 Ga0496125_0031572
581 Ga0496126_0000201
582 Ga0496126_0040923
583 Ga0496126_0112054
584 nmdc:mga03683_167583_c1
585 nmdc:mga03683_69176_c1
586 nmdc:mga03n38_126045_c1
587 nmdc:mga00v17_159770_c1
588 nmdc:mga0k408_28050_c1
589 nmdc:mga07m45_28990_c1
590 nmdc:mga0sz30_226087_c1
591 Ga0495601_0235360
592 Ga0495595_0002589
593 Ga0500650_0157705
594 Ga0500593_000553
595 Ga0500608_161225
596 Ga0500618_029857
597 Ga0500559_0001223
598 Ga0500564_030941
599 Ga0500568_0001780
600 Ga0500573_0035049
601 Ga0500604_0044426
602 Ga0500645_000474
603 Ga0500645_003967
604 Ga0500645_007939
605 Ga0500661_016836
606 Ga0466962_0192254
607 2511244865
608 2511374444
609 2513952315
610 2514041790
611 2765583274
612 2842734732
613 2842748499
614 2885195600
615 2904482497
616 2939656097
617 2941475940
618 2941481337
619 2974321640
620 644751120
621 8054931794
622 8056122959

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

55

270

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.495 8 221
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.4889 8 221
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.4654 8 221
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.4615 8 221
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.3957 3 226
ID Description Score Start End Superfamily
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5167 4 224 1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4712 4 224 1.20.1250.20
af_Q55EC8_162_384_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4709 40 225 1.20.1250.20
af_Q4DAY3_10_243_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4693 2 222 1.20.1250.20
af_P9WLG3_229_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4633 2 225 1.20.1250.20
ID Description Score Start End GO Terms
AF-M5CK91-F1-model_v4 deleted 0.983 5 232
AF-A0A6B9FFC2-F1-model_v4 Probable membrane transporter protein 0.9758 1 232 GO:0005886
AF-A0A6B9FFC2-F1-model_v4 Probable membrane transporter protein 0.9717 1 232 GO:0005886
AF-A0A7W5TYI7-F1-model_v4 deleted 0.9695 1 232
AF-A0A7Z0MSF1-F1-model_v4 Probable membrane transporter protein 0.9693 1 231 GO:0005886

Map