F401114

General Info

Members Datasets Scaffolds Average Seq Length
311 109 308 218

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100256165|Ga0068855_1002561652
Length 226
Sequence MPQPISPPVEAVAGITLVLVDDHAIVRQGVRAFLHTQPDIDIVGEAASGDEAVAICAEAAPDVVLMDLVMPGSVLDGVEATREVKRVSPRSQVIILTSYHDDEHILPAIRAGALSYLLKDVNADALVQAVRKAARGEATLHPGVASRLVQSLQTTPTPDRLLDLSEREKEVLQLIAHGHPNAAIAAKLFISEKTVKSHVTNILSKLHLSDRTQAAVYAWRTGAVKE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
64 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
65 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
74 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
76 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
77 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
78 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
79 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
92 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
106 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
107 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
109 8022792930 Bacillus sp. Xin Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.32
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 0
Rhizosphere 97.11
Stem 0
Stem Tuber 0
Unclassified 1.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1230852 2162886007 Bacteria 2570
2 SwRhRL2b_contig_1509737 2162886007 Bacteria 2878
3 SwRhRL2b_contig_1516888 2162886007 Bacteria 7743
4 JGI25151J46595_10088579 3300003187 Bacteria 870
5 Ga0065704_10000936 3300005289 Bacteria 23211
6 Ga0065704_10075175 3300005289 Bacteria 5753
7 Ga0065704_10093549 3300005289 Bacteria 2591
8 Ga0065707_10000482 3300005295 Bacteria 48953
9 Ga0065707_10086415 3300005295 Bacteria 5468
10 Ga0065707_10087698 3300005295 Bacteria 4923
11 Ga0065707_10091488 3300005295 Unclassified 3936
12 Ga0065707_10134723 3300005295 Unclassified 1861
13 Ga0068869_100653128 3300005334 Bacteria 893
14 Ga0070689_100031739 3300005340 Bacteria 4015
15 Ga0070669_100433030 3300005353 Unclassified 1081
16 Ga0070675_100427383 3300005354 Bacteria 1185
17 Ga0070674_100351821 3300005356 Bacteria 1190
18 Ga0070705_100103894 3300005440 Bacteria 1800
19 Ga0070700_100032054 3300005441 Bacteria 3156
20 Ga0070694_100066043 3300005444 Unclassified 2481
21 Ga0070694_100102563 3300005444 Bacteria 2026
22 Ga0070694_100104369 3300005444 Bacteria 2010
23 Ga0070708_100336864 3300005445 Bacteria 1422
24 Ga0070706_100001667 3300005467 Bacteria 23112
25 Ga0070706_100017905 3300005467 Bacteria 6536
26 Ga0070706_100057723 3300005467 Bacteria 3582
27 Ga0070706_100099078 3300005467 Unclassified 2708
28 Ga0070706_100159502 3300005467 Bacteria 2106
29 Ga0070707_100019615 3300005468 Bacteria 6373
30 Ga0070707_100150018 3300005468 Bacteria 2270
31 Ga0070707_100468599 3300005468 Bacteria 1221
32 Ga0070698_100077786 3300005471 Bacteria 3316
33 Ga0070698_100138840 3300005471 Bacteria 2383
34 Ga0070698_100160531 3300005471 Bacteria 2192
35 Ga0070698_100276953 3300005471 Unclassified 1609
36 Ga0070698_100305219 3300005471 Bacteria 1522
37 Ga0070698_100321131 3300005471 Bacteria 1479
38 Ga0070698_100327613 3300005471 Bacteria 1462
39 Ga0070699_100002003 3300005518 Bacteria 18394
40 Ga0070699_100008781 3300005518 Bacteria 8758
41 Ga0070699_100017019 3300005518 Bacteria 6243
42 Ga0070699_100067830 3300005518 Bacteria 3098
43 Ga0070699_100104804 3300005518 Bacteria 2480
44 Ga0070699_100241852 3300005518 Bacteria 1611
45 Ga0070684_100220570 3300005535 Bacteria 1730
46 Ga0070697_100262789 3300005536 Bacteria 1478
47 Ga0070686_100424368 3300005544 Bacteria 1017
48 Ga0070695_100193210 3300005545 Unclassified 1450
49 Ga0070695_100308216 3300005545 Bacteria 1173
50 Ga0070695_100531887 3300005545 Unclassified 914
51 Ga0070704_100603779 3300005549 Bacteria 965
52 Ga0068855_100256165 3300005563 Bacteria 1951
53 Ga0068857_100360747 3300005577 Bacteria 1347
54 Ga0068857_100445377 3300005577 Unclassified 1210
55 Ga0068857_100620871 3300005577 Bacteria 1023
56 Ga0070702_100196305 3300005615 Unclassified 1332
57 Ga0068859_100055718 3300005617 Bacteria 3977
58 Ga0068859_101489785 3300005617 Bacteria 747
59 Ga0068864_100388984 3300005618 Bacteria 1323
60 Ga0068862_100004117 3300005844 Bacteria 12319
61 Ga0081539_10002072 3300005985 Bacteria 30021
62 Ga0075427_10000275 3300006194 Bacteria 5557
63 Ga0075428_100030724 3300006844 Bacteria 5940
64 Ga0075428_100036649 3300006844 Bacteria 5402
65 Ga0075428_100073497 3300006844 Bacteria 3735
66 Ga0075428_100879929 3300006844 Bacteria 950
67 Ga0075428_100938299 3300006844 Unclassified 917
68 Ga0075430_100241473 3300006846 Bacteria 1497
69 Ga0075430_100277075 3300006846 Bacteria 1388
70 Ga0075431_100065135 3300006847 Unclassified 3763
71 Ga0075431_100185699 3300006847 Bacteria 2132
72 Ga0075431_100333140 3300006847 Bacteria 1528
73 Ga0075431_100532595 3300006847 Bacteria 1163
74 Ga0075433_10207781 3300006852 Bacteria 1740
75 Ga0075433_10217661 3300006852 Bacteria 1697
76 Ga0075433_10244003 3300006852 Bacteria 1595
77 Ga0075434_100069254 3300006871 Bacteria 3518
78 Ga0075429_100012179 3300006880 Bacteria 7456
79 Ga0075429_100036104 3300006880 Bacteria 4298
80 Ga0075429_100081471 3300006880 Bacteria 2822
81 Ga0075429_100175811 3300006880 Bacteria 1875
82 Ga0075429_100238254 3300006880 Unclassified 1594
83 Ga0075429_100293453 3300006880 Bacteria 1424
84 Ga0097620_100055715 3300006931 Bacteria 3977
85 Ga0097620_100469638 3300006931 Bacteria 1354
86 Ga0097620_101489833 3300006931 Bacteria 747
87 Ga0105244_10009466 3300009036 Bacteria 5988
88 Ga0105250_10002808 3300009092 Bacteria 8536
89 Ga0111539_10075696 3300009094 Bacteria 3964
90 Ga0111539_10136026 3300009094 Bacteria 2878
91 Ga0114129_10004655 3300009147 Bacteria 19370
92 Ga0114129_10005482 3300009147 Bacteria 17933
93 Ga0114129_10018553 3300009147 Bacteria 9905
94 Ga0114129_10055117 3300009147 Bacteria 5572
95 Ga0114129_10056522 3300009147 Bacteria 5496
96 Ga0114129_10079000 3300009147 Unclassified 4575
97 Ga0114129_10085789 3300009147 Unclassified 4368
98 Ga0114129_10092316 3300009147 Bacteria 4194
99 Ga0114129_10093205 3300009147 Bacteria 4173
100 Ga0114129_10655412 3300009147 Bacteria 1354
101 Ga0114129_10657914 3300009147 Bacteria 1351
102 Ga0114129_10808589 3300009147 Bacteria 1195
103 Ga0114129_11022785 3300009147 Bacteria 1039
104 Ga0105243_10011721 3300009148 Bacteria 6630
105 Ga0105243_10203554 3300009148 Bacteria 1738
106 Ga0105243_10222969 3300009148 Bacteria 1668
107 Ga0105243_10602704 3300009148 Bacteria 1058
108 Ga0105243_10672550 3300009148 Bacteria 1006
109 Ga0105242_11442932 3300009176 Unclassified 717
110 Ga0105249_10024039 3300009553 Bacteria 5472
111 Ga0105249_10069951 3300009553 Bacteria 3240
112 Ga0105249_10398387 3300009553 Bacteria 1406
113 Ga0105246_10077813 3300011119 Unclassified 2354
114 Ga0105246_10097030 3300011119 Unclassified 2138
115 Ga0157378_10087951 3300013297 Bacteria 2819
116 Ga0157380_10371429 3300014326 Bacteria 1346
117 Ga0157379_10558504 3300014968 Bacteria 1066
118 Ga0209130_1006711 3300025284 Bacteria 3686
119 Ga0209025_1004301 3300025294 Bacteria 12482
120 Ga0207684_10001676 3300025910 Bacteria 23518
121 Ga0207684_10004822 3300025910 Bacteria 12620
122 Ga0207684_10094826 3300025910 Bacteria 2546
123 Ga0207646_10038026 3300025922 Bacteria 4337
124 Ga0207646_10090066 3300025922 Bacteria 2746
125 Ga0207659_10566401 3300025926 Bacteria 967
126 Ga0207670_10164827 3300025936 Bacteria 1657
127 Ga0207670_10319074 3300025936 Bacteria 1222
128 Ga0207679_10847236 3300025945 Bacteria 835
129 Ga0207712_10202300 3300025961 Bacteria 1576
130 Ga0207712_10213148 3300025961 Bacteria 1539
131 Ga0207712_10254344 3300025961 Bacteria 1421
132 Ga0207712_10515460 3300025961 Bacteria 1024
133 Ga0207648_10643816 3300026089 Unclassified 979
134 Ga0207674_10082543 3300026116 Unclassified 3215
135 Ga0207674_10561542 3300026116 Bacteria 1103
136 Ga0209966_1013642 3300027695 Unclassified 1507
137 Ga0268265_10011694 3300028380 Bacteria 5936
138 Ga0268265_10036888 3300028380 Bacteria 3584
139 Ga0268265_10238162 3300028380 Bacteria 1604
140 Ga0268264_11316028 3300028381 Unclassified 733
141 Ga0265340_10084812 3300031247 Bacteria 1487
142 Ga0316575_10029968 3300031665 Unclassified 2126
143 Ga0316575_10039024 3300031665 Bacteria 1874
144 Ga0316579_10008247 3300031691 Unclassified 4338
145 Ga0316579_10031235 3300031691 Unclassified 2437
146 Ga0316579_10042851 3300031691 Bacteria 2104
147 Ga0316579_10130307 3300031691 Bacteria 1211
148 Ga0316579_10274451 3300031691 Bacteria 815
149 Ga0316576_10089071 3300031727 Unclassified 2298
150 Ga0316576_10105672 3300031727 Bacteria 2108
151 Ga0316576_10221178 3300031727 Bacteria 1424
152 Ga0316576_10448083 3300031727 Unclassified 953
153 Ga0316578_10022634 3300031728 Unclassified 3507
154 Ga0316578_10059363 3300031728 Bacteria 2250
155 Ga0316578_10091164 3300031728 Bacteria 1820
156 Ga0307405_10171629 3300031731 Bacteria 1548
157 Ga0316577_10035133 3300031733 Unclassified 2801
158 Ga0307410_10184270 3300031852 Bacteria 1583
159 Ga0307416_100366157 3300032002 Bacteria 1466
160 Ga0307416_100604468 3300032002 Bacteria 1177
161 Ga0307415_100290058 3300032126 Bacteria 1350
162 Ga0316585_10041866 3300032137 Bacteria 1460
163 Ga0316585_10047275 3300032137 Unclassified 1378
164 Ga0316593_10148906 3300032168 Bacteria 851
165 Ga0316574_0004126 3300035398 Bacteria 7563
166 Ga0316574_0025779 3300035398 Bacteria 3531
167 Ga0316574_0068195 3300035398 Bacteria 2243
168 Ga0316574_0076906 3300035398 Bacteria 2115
169 Ga0316574_0210763 3300035398 Bacteria 1247
170 Ga0316582_0019085 3300036647 Bacteria 4006
171 Ga0316582_0033082 3300036647 Unclassified 3172
172 Ga0316582_0035089 3300036647 Bacteria 3094
173 Ga0316582_0088094 3300036647 Bacteria 2039
174 Ga0316582_0495726 3300036647 Bacteria 842
175 Ga0316584_0012678 3300036712 Bacteria 5947
176 Ga0316584_0018625 3300036712 Bacteria 5011
177 Ga0316584_0039470 3300036712 Unclassified 3514
178 Ga0316584_0050976 3300036712 Bacteria 3095
179 Ga0316584_0311198 3300036712 Bacteria 1138
180 Ga0316584_0416104 3300036712 Unclassified 955
181 Ga0316584_0547884 3300036712 Unclassified 808
182 Ga0316581_0017287 3300037588 Unclassified 2080
183 Ga0316581_0025356 3300037588 Unclassified 1764
184 Ga0400489_05445 3300039093 Unclassified 3069
185 Ga0400489_19696 3300039093 Unclassified 4287
186 Ga0400489_21700 3300039093 Bacteria 31915
187 Ga0400489_29392 3300039093 Bacteria 1152
188 Ga0436365_1078285 3300039437 Bacteria 1273
189 Ga0439462_0056217 3300042015 Bacteria 1062
190 Ga0451577_0002476 3300042876 Bacteria 21957
191 Ga0451577_0016245 3300042876 Bacteria 6897
192 Ga0451577_0022539 3300042876 Bacteria 5751
193 Ga0451577_0026998 3300042876 Bacteria 5198
194 Ga0451577_0048612 3300042876 Bacteria 3789
195 Ga0451577_0068955 3300042876 Unclassified 3154
196 Ga0451577_0110807 3300042876 Unclassified 2456
197 Ga0451577_0480261 3300042876 Bacteria 1128
198 Ga0451577_0559700 3300042876 Bacteria 1038
199 Ga0451577_0902856 3300042876 Bacteria 795
200 Ga0451577_1063653 3300042876 Bacteria 725
201 Ga0453683_0000296 3300044673 Bacteria 63665
202 Ga0453683_0007247 3300044673 Bacteria 7553
203 Ga0453683_0017697 3300044673 Bacteria 4586
204 Ga0453683_0066404 3300044673 Bacteria 2255
205 Ga0453683_0207679 3300044673 Bacteria 1244
206 Ga0453683_0279473 3300044673 Unclassified 1066
207 Ga0453684_0000007 3300044712 Bacteria 1301482
208 Ga0453684_0000053 3300044712 Bacteria 545350
209 Ga0453684_0001942 3300044712 Bacteria 53308
210 Ga0453684_0001997 3300044712 Bacteria 52233
211 Ga0453684_0002878 3300044712 Bacteria 40371
212 Ga0453684_0003105 3300044712 Bacteria 38268
213 Ga0453684_0003503 3300044712 Bacteria 35235
214 Ga0453684_0004022 3300044712 Bacteria 32003
215 Ga0453684_0004582 3300044712 Bacteria 28827
216 Ga0453684_0004802 3300044712 Bacteria 27819
217 Ga0453684_0005397 3300044712 Bacteria 25381
218 Ga0453684_0009279 3300044712 Bacteria 17269
219 Ga0453684_0010279 3300044712 Bacteria 16027
220 Ga0453684_0011317 3300044712 Bacteria 14997
221 Ga0453684_0012390 3300044712 Bacteria 14074
222 Ga0453684_0013528 3300044712 Bacteria 13239
223 Ga0453684_0024767 3300044712 Bacteria 8748
224 Ga0453684_0048111 3300044712 Bacteria 5645
225 Ga0453684_0075388 3300044712 Bacteria 4240
226 Ga0453684_0088516 3300044712 Bacteria 3834
227 Ga0453684_0090483 3300044712 Bacteria 3781
228 Ga0453684_0109363 3300044712 Unclassified 3362
229 Ga0453684_0228646 3300044712 Unclassified 2149
230 Ga0453684_0241704 3300044712 Bacteria 2078
231 Ga0453684_0271895 3300044712 Bacteria 1936
232 Ga0453684_0287247 3300044712 Bacteria 1874
233 Ga0453684_0396365 3300044712 Bacteria 1547
234 Ga0453684_0400571 3300044712 Bacteria 1537
235 Ga0453684_0488584 3300044712 Bacteria 1365
236 Ga0453684_0491881 3300044712 Bacteria 1359
237 Ga0453684_0724565 3300044712 Unclassified 1079
238 Ga0453684_0979358 3300044712 Unclassified 901
239 Ga0453684_1270697 3300044712 Bacteria 769
240 Ga0451576_0007969 3300045051 Bacteria 12528
241 Ga0451576_0020057 3300045051 Bacteria 7287
242 Ga0451576_0036917 3300045051 Bacteria 5177
243 Ga0451576_0037604 3300045051 Bacteria 5127
244 Ga0451576_0043500 3300045051 Bacteria 4738
245 Ga0451576_0093516 3300045051 Bacteria 3126
246 Ga0451576_0151832 3300045051 Bacteria 2416
247 Ga0451576_0310409 3300045051 Bacteria 1650
248 Ga0466967_0783734 3300045976 Bacteria 946
249 Ga0501039_0534778 3300049575 Bacteria 920
250 Ga0501041_0143090 3300049577 Bacteria 1492
251 Ga0501046_0271195 3300049580 Bacteria 1245
252 Ga0501046_0322148 3300049580 Bacteria 1126
253 Ga0501048_0210512 3300049582 Bacteria 1379
254 Ga0501048_0213080 3300049582 Bacteria 1370
255 Ga0501071_0047242 3300049587 Bacteria 3093
256 Ga0501072_0156389 3300049588 Bacteria 1818
257 Ga0501075_0011147 3300049591 Bacteria 6353
258 Ga0501075_0229812 3300049591 Bacteria 1415
259 Ga0501075_0469940 3300049591 Bacteria 959
260 Ga0501076_0022033 3300049592 Bacteria 4894
261 Ga0501076_0164887 3300049592 Bacteria 1806
262 Ga0501076_0212493 3300049592 Bacteria 1581
263 Ga0501076_0312063 3300049592 Bacteria 1290
264 Ga0501076_0876993 3300049592 Bacteria 740
265 Ga0501077_0294999 3300049593 Bacteria 1033
266 Ga0501079_0063255 3300049741 Bacteria 2855
267 Ga0501079_0110397 3300049741 Bacteria 2137
268 Ga0501079_0195195 3300049741 Unclassified 1580
269 Ga0501080_0159990 3300049742 Bacteria 2080
270 Ga0501081_0163009 3300049743 Bacteria 1607
271 Ga0501081_0376430 3300049743 Bacteria 1049
272 Ga0501081_0447319 3300049743 Bacteria 960
273 Ga0501045_0099984 3300049824 Bacteria 2147
274 Ga0501045_0248182 3300049824 Bacteria 1325
275 nmdc:mga05p37_135676_c1 3300050507 Unclassified 3018
276 nmdc:mga05p37_200074_c1 3300050507 Unclassified 2420
277 nmdc:mga05p37_201938_c1 3300050507 Bacteria 2407
278 nmdc:mga05p37_211599_c1 3300050507 Bacteria 2343
279 nmdc:mga05p37_37333_c1 3300050507 Bacteria 5956
280 nmdc:mga05p37_416319_c1 3300050507 Bacteria 1565
281 nmdc:mga05p37_56807_c1 3300050507 Bacteria 4819
282 nmdc:mga05p37_771918_c1 3300050507 Bacteria 1056
283 nmdc:mga05p37_93_c2 3300050507 Bacteria 38704
284 nmdc:mga05p37_9561_c1 3300050507 Bacteria 11482
285 nmdc:mga05p37_98908_c1 3300050507 Bacteria 3594
286 nmdc:mga09592_13474_c1 3300050508 Bacteria 6675
287 nmdc:mga09592_142342_c1 3300050508 Bacteria 2067
288 nmdc:mga09592_157103_c1 3300050508 Unclassified 1963
289 nmdc:mga09592_166153_c1 3300050508 Unclassified 1907
290 nmdc:mga09592_308423_c1 3300050508 Bacteria 1372
291 nmdc:mga09592_39713_c1 3300050508 Bacteria 3953
292 nmdc:mga09592_487621_c1 3300050508 Bacteria 1062
293 nmdc:mga09592_63592_c1 3300050508 Bacteria 3124
294 nmdc:mga09592_734_c1 3300050508 Bacteria 25253
295 nmdc:mga0qj67_112966_c1 3300050509 Bacteria 2193
296 nmdc:mga0qj67_240043_c1 3300050509 Bacteria 1470
297 nmdc:mga06r32_518320_c1 3300050510 Bacteria 1168
298 nmdc:mga06r32_98033_c1 3300050510 Bacteria 2873
299 nmdc:mga0n895_746726_c1 3300050512 Bacteria 972
300 nmdc:mga0a205_168334_c1 3300050515 Bacteria 2087
301 nmdc:mga0a205_195085_c1 3300050515 Bacteria 1916
302 nmdc:mga0a205_572168_c1 3300050515 Unclassified 984
303 Ga0501084_0043074 3300054114 Bacteria 3776
304 Ga0501084_0515337 3300054114 Bacteria 1011
305 Ga0501084_0890070 3300054114 Bacteria 749
306 Ga0501082_0212031 3300060353 Bacteria 1685
307 Ga0501082_0212907 3300060353 Bacteria 1681
308 Ga0530510_0076239 3300061734 Bacteria 2436

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0547884 Ga0316584_0547884_25_588 187
2 3300005334 Ga0068869_100653128 Ga0068869_1006531282 188
3 3300005354 Ga0070675_100427383 Ga0070675_1004273832 188
4 3300005544 Ga0070686_100424368 Ga0070686_1004243682 188
5 3300014968 Ga0157379_10558504 Ga0157379_105585042 188
6 3300031665 Ga0316575_10039024 Ga0316575_100390242 188
7 3300005356 Ga0070674_100351821 Ga0070674_1003518212 189
8 3300005535 Ga0070684_100220570 Ga0070684_1002205702 189
9 3300009148 Ga0105243_10672550 Ga0105243_106725502 189
10 3300025926 Ga0207659_10566401 Ga0207659_105664011 189
11 3300025936 Ga0207670_10319074 Ga0207670_103190742 189
12 3300025945 Ga0207679_10847236 Ga0207679_108472361 189
13 3300031727 Ga0316576_10448083 Ga0316576_104480832 191
14 3300032137 Ga0316585_10047275 Ga0316585_100472752 191
15 3300036712 Ga0316584_0018625 Ga0316584_0018625_2796_3464 191
16 3300031691 Ga0316579_10130307 Ga0316579_101303072 195
17 3300049577 Ga0501041_0143090 Ga0501041_0143090_21_629 202
18 3300050508 nmdc:mga09592_308423_c1 nmdc:mga09592_308423_c1_751_1362 203
19 3300044712 Ga0453684_0001942 Ga0453684_0001942_26159_26821 204
20 3300049592 Ga0501076_0876993 Ga0501076_0876993_96_719 204
21 3300005471 Ga0070698_100276953 Ga0070698_1002769531 208
22 3300005545 Ga0070695_100193210 Ga0070695_1001932102 208
23 3300005615 Ga0070702_100196305 Ga0070702_1001963051 208
24 3300006852 Ga0075433_10244003 Ga0075433_102440031 208
25 3300006871 Ga0075434_100069254 Ga0075434_1000692541 208
26 3300049575 Ga0501039_0534778 Ga0501039_0534778_200_892 208
27 3300049592 Ga0501076_0212493 Ga0501076_0212493_837_1529 208
28 3300049743 Ga0501081_0163009 Ga0501081_0163009_651_1343 208
29 3300049824 Ga0501045_0099984 Ga0501045_0099984_1439_2131 208
30 3300050512 nmdc:mga0n895_746726_c1 nmdc:mga0n895_746726_c1_71_760 208
31 3300050515 nmdc:mga0a205_195085_c1 nmdc:mga0a205_195085_c1_438_1127 208
32 3300060353 Ga0501082_0212031 Ga0501082_0212031_16_708 208
33 3300005444 Ga0070694_100102563 Ga0070694_1001025631 209
34 3300005468 Ga0070707_100468599 Ga0070707_1004685992 209
35 3300006852 Ga0075433_10217661 Ga0075433_102176611 209
36 3300009147 Ga0114129_10093205 Ga0114129_100932052 209
37 3300025922 Ga0207646_10090066 Ga0207646_100900662 209
38 3300031852 Ga0307410_10184270 Ga0307410_101842702 209
39 3300049580 Ga0501046_0271195 Ga0501046_0271195_339_1028 209
40 3300050515 nmdc:mga0a205_168334_c1 nmdc:mga0a205_168334_c1_1025_1711 209
41 3300054114 Ga0501084_0515337 Ga0501084_0515337_265_954 209
42 3300005518 Ga0070699_100241852 Ga0070699_1002418521 210
43 3300036712 Ga0316584_0012678 Ga0316584_0012678_451_1083 210
44 3300042876 Ga0451577_0559700 Ga0451577_0559700_130_771 210
45 3300045976 Ga0466967_0783734 Ga0466967_0783734_195_830 210
46 3300042876 Ga0451577_0002476 Ga0451577_0002476_12722_13357 211
47 3300044712 Ga0453684_0002878 Ga0453684_0002878_8818_9453 211
48 3300026089 Ga0207648_10643816 Ga0207648_106438162 212
49 3300045051 Ga0451576_0310409 Ga0451576_0310409_361_1047 212
50 iso_pu_bacteria 2524023250 2524613129 212
51 2162886007 SwRhRL2b_contig_1516888 SwRhRL2b_0310.00000620 213
52 3300005289 Ga0065704_10000936 Ga0065704_1000093617 213
53 3300005295 Ga0065707_10000482 Ga0065707_100004823 213
54 3300042876 Ga0451577_0110807 Ga0451577_0110807_421_1164 213
55 3300045051 Ga0451576_0043500 Ga0451576_0043500_1437_2180 213
56 3300005563 Ga0068855_100256165 Ga0068855_1002561652 214
57 3300009148 Ga0105243_10011721 Ga0105243_100117213 214
58 3300006880 Ga0075429_100081471 Ga0075429_1000814712 215
59 3300009147 Ga0114129_10005482 Ga0114129_1000548214 215
60 3300009147 Ga0114129_10055117 Ga0114129_100551172 215
61 3300009147 Ga0114129_10657914 Ga0114129_106579142 215
62 3300013297 Ga0157378_10087951 Ga0157378_100879513 215
63 3300049591 Ga0501075_0229812 Ga0501075_0229812_72_728 215
64 3300049741 Ga0501079_0195195 Ga0501079_0195195_319_975 215
65 3300049743 Ga0501081_0376430 Ga0501081_0376430_313_969 215
66 3300050507 nmdc:mga05p37_201938_c1 nmdc:mga05p37_201938_c1_1633_2289 215
67 3300050507 nmdc:mga05p37_211599_c1 nmdc:mga05p37_211599_c1_1525_2181 215
68 3300050507 nmdc:mga05p37_93_c2 nmdc:mga05p37_93_c2_11433_12089 215
69 3300050508 nmdc:mga09592_734_c1 nmdc:mga09592_734_c1_4307_4963 215
70 3300050509 nmdc:mga0qj67_112966_c1 nmdc:mga0qj67_112966_c1_730_1386 215
71 3300054114 Ga0501084_0890070 Ga0501084_0890070_20_676 215
72 3300005445 Ga0070708_100336864 Ga0070708_1003368641 216
73 3300005467 Ga0070706_100017905 Ga0070706_1000179051 216
74 3300005468 Ga0070707_100019615 Ga0070707_1000196152 216
75 3300005471 Ga0070698_100160531 Ga0070698_1001605312 216
76 3300006847 Ga0075431_100333140 Ga0075431_1003331402 216
77 3300009147 Ga0114129_10092316 Ga0114129_100923166 216
78 3300009147 Ga0114129_10655412 Ga0114129_106554122 216
79 3300025910 Ga0207684_10004822 Ga0207684_100048224 216
80 3300025922 Ga0207646_10038026 Ga0207646_100380262 216
81 3300031247 Ga0265340_10084812 Ga0265340_100848121 216
82 3300031691 Ga0316579_10042851 Ga0316579_100428512 216
83 3300031727 Ga0316576_10105672 Ga0316576_101056723 216
84 3300045051 Ga0451576_0007969 Ga0451576_0007969_4993_5643 216
85 3300049588 Ga0501072_0156389 Ga0501072_0156389_691_1341 216
86 3300049741 Ga0501079_0110397 Ga0501079_0110397_840_1493 216
87 3300050507 nmdc:mga05p37_416319_c1 nmdc:mga05p37_416319_c1_875_1525 216
88 3300050508 nmdc:mga09592_63592_c1 nmdc:mga09592_63592_c1_1275_1925 216
89 3300005295 Ga0065707_10091488 Ga0065707_100914883 217
90 3300005441 Ga0070700_100032054 Ga0070700_1000320542 217
91 3300005467 Ga0070706_100099078 Ga0070706_1000990783 217
92 3300005468 Ga0070707_100150018 Ga0070707_1001500183 217
93 3300005471 Ga0070698_100077786 Ga0070698_1000777862 217
94 3300005471 Ga0070698_100138840 Ga0070698_1001388403 217
95 3300005471 Ga0070698_100321131 Ga0070698_1003211312 217
96 3300005518 Ga0070699_100002003 Ga0070699_10000200313 217
97 3300005518 Ga0070699_100067830 Ga0070699_1000678303 217
98 3300005518 Ga0070699_100104804 Ga0070699_1001048042 217
99 3300005536 Ga0070697_100262789 Ga0070697_1002627892 217
100 3300005545 Ga0070695_100531887 Ga0070695_1005318872 217
101 3300005577 Ga0068857_100445377 Ga0068857_1004453772 217
102 3300005617 Ga0068859_100055718 Ga0068859_1000557183 217
103 3300006844 Ga0075428_100036649 Ga0075428_1000366496 217
104 3300006844 Ga0075428_100879929 Ga0075428_1008799291 217
105 3300006844 Ga0075428_100938299 Ga0075428_1009382991 217
106 3300006846 Ga0075430_100241473 Ga0075430_1002414732 217
107 3300006847 Ga0075431_100065135 Ga0075431_1000651353 217
108 3300006847 Ga0075431_100185699 Ga0075431_1001856992 217
109 3300006852 Ga0075433_10207781 Ga0075433_102077813 217
110 3300006880 Ga0075429_100036104 Ga0075429_1000361044 217
111 3300006880 Ga0075429_100175811 Ga0075429_1001758112 217
112 3300006880 Ga0075429_100238254 Ga0075429_1002382543 217
113 3300006931 Ga0097620_100055715 Ga0097620_1000557153 217
114 3300009094 Ga0111539_10075696 Ga0111539_100756962 217
115 3300009147 Ga0114129_10004655 Ga0114129_100046554 217
116 3300009147 Ga0114129_10056522 Ga0114129_100565221 217
117 3300009147 Ga0114129_10085789 Ga0114129_100857894 217
118 3300009148 Ga0105243_10222969 Ga0105243_102229692 217
119 3300009176 Ga0105242_11442932 Ga0105242_114429321 217
120 3300009553 Ga0105249_10398387 Ga0105249_103983871 217
121 3300014326 Ga0157380_10371429 Ga0157380_103714291 217
122 3300025961 Ga0207712_10254344 Ga0207712_102543442 217
123 3300026116 Ga0207674_10082543 Ga0207674_100825434 217
124 3300027695 Ga0209966_1013642 Ga0209966_10136422 217
125 3300028380 Ga0268265_10036888 Ga0268265_100368884 217
126 3300028381 Ga0268264_11316028 Ga0268264_113160281 217
127 3300031691 Ga0316579_10274451 Ga0316579_102744511 217
128 3300031727 Ga0316576_10221178 Ga0316576_102211781 217
129 3300031728 Ga0316578_10059363 Ga0316578_100593633 217
130 3300032002 Ga0307416_100604468 Ga0307416_1006044681 217
131 3300032137 Ga0316585_10041866 Ga0316585_100418661 217
132 3300036647 Ga0316582_0035089 Ga0316582_0035089_1760_2413 217
133 3300036647 Ga0316582_0495726 Ga0316582_0495726_148_816 217
134 3300039093 Ga0400489_05445 Ga0400489_05445_2328_2987 217
135 3300039093 Ga0400489_21700 Ga0400489_21700_13922_14578 217
136 3300042015 Ga0439462_0056217 Ga0439462_0056217_390_1043 217
137 3300044673 Ga0453683_0017697 Ga0453683_0017697_2779_3432 217
138 3300044673 Ga0453683_0066404 Ga0453683_0066404_1573_2226 217
139 3300044712 Ga0453684_0003503 Ga0453684_0003503_32544_33206 217
140 3300044712 Ga0453684_0009279 Ga0453684_0009279_778_1431 217
141 3300044712 Ga0453684_0400571 Ga0453684_0400571_424_1077 217
142 3300044712 Ga0453684_0979358 Ga0453684_0979358_126_779 217
143 3300045051 Ga0451576_0151832 Ga0451576_0151832_1669_2322 217
144 3300049580 Ga0501046_0322148 Ga0501046_0322148_416_1069 217
145 3300049582 Ga0501048_0210512 Ga0501048_0210512_433_1086 217
146 3300049587 Ga0501071_0047242 Ga0501071_0047242_2030_2683 217
147 3300049591 Ga0501075_0011147 Ga0501075_0011147_1479_2132 217
148 3300049591 Ga0501075_0469940 Ga0501075_0469940_204_857 217
149 3300049592 Ga0501076_0022033 Ga0501076_0022033_3398_4051 217
150 3300049592 Ga0501076_0164887 Ga0501076_0164887_210_863 217
151 3300049741 Ga0501079_0063255 Ga0501079_0063255_859_1512 217
152 3300049742 Ga0501080_0159990 Ga0501080_0159990_665_1318 217
153 3300050507 nmdc:mga05p37_200074_c1 nmdc:mga05p37_200074_c1_1400_2053 217
154 3300050507 nmdc:mga05p37_37333_c1 nmdc:mga05p37_37333_c1_3173_3826 217
155 3300050507 nmdc:mga05p37_56807_c1 nmdc:mga05p37_56807_c1_3153_3806 217
156 3300050507 nmdc:mga05p37_98908_c1 nmdc:mga05p37_98908_c1_992_1645 217
157 3300050508 nmdc:mga09592_142342_c1 nmdc:mga09592_142342_c1_508_1164 217
158 3300050508 nmdc:mga09592_157103_c1 nmdc:mga09592_157103_c1_170_826 217
159 3300050508 nmdc:mga09592_166153_c1 nmdc:mga09592_166153_c1_939_1595 217
160 3300050515 nmdc:mga0a205_572168_c1 nmdc:mga0a205_572168_c1_78_731 217
161 3300054114 Ga0501084_0043074 Ga0501084_0043074_2239_2892 217
162 3300060353 Ga0501082_0212907 Ga0501082_0212907_572_1225 217
163 3300061734 Ga0530510_0076239 Ga0530510_0076239_652_1305 217
164 iso_pu_bacteria 8022792930 8022797203 217
165 3300005289 Ga0065704_10075175 Ga0065704_100751752 218
166 3300005467 Ga0070706_100057723 Ga0070706_1000577232 218
167 3300006847 Ga0075431_100532595 Ga0075431_1005325952 218
168 3300025910 Ga0207684_10094826 Ga0207684_100948262 218
169 3300036647 Ga0316582_0019085 Ga0316582_0019085_579_1238 218
170 3300036712 Ga0316584_0416104 Ga0316584_0416104_269_925 218
171 3300039093 Ga0400489_19696 Ga0400489_19696_3226_3882 218
172 3300044712 Ga0453684_0003105 Ga0453684_0003105_685_1371 218
173 3300044712 Ga0453684_0010279 Ga0453684_0010279_11175_11831 218
174 3300049592 Ga0501076_0312063 Ga0501076_0312063_546_1202 218
175 3300049743 Ga0501081_0447319 Ga0501081_0447319_77_742 218
176 3300050508 nmdc:mga09592_13474_c1 nmdc:mga09592_13474_c1_4771_5427 218
177 3300050510 nmdc:mga06r32_518320_c1 nmdc:mga06r32_518320_c1_231_887 218
178 2162886007 SwRhRL2b_contig_1230852 SwRhRL2b_0681.00003180 219
179 2162886007 SwRhRL2b_contig_1509737 SwRhRL2b_0338.00001900 219
180 3300003187 JGI25151J46595_10088579 JGI25151J46595_100885791 219
181 3300005289 Ga0065704_10093549 Ga0065704_100935492 219
182 3300005295 Ga0065707_10086415 Ga0065707_100864152 219
183 3300005295 Ga0065707_10087698 Ga0065707_100876985 219
184 3300005295 Ga0065707_10134723 Ga0065707_101347232 219
185 3300005340 Ga0070689_100031739 Ga0070689_1000317394 219
186 3300005353 Ga0070669_100433030 Ga0070669_1004330301 219
187 3300005440 Ga0070705_100103894 Ga0070705_1001038942 219
188 3300005444 Ga0070694_100066043 Ga0070694_1000660432 219
189 3300005444 Ga0070694_100104369 Ga0070694_1001043692 219
190 3300005467 Ga0070706_100001667 Ga0070706_10000166716 219
191 3300005467 Ga0070706_100159502 Ga0070706_1001595022 219
192 3300005471 Ga0070698_100305219 Ga0070698_1003052191 219
193 3300005471 Ga0070698_100327613 Ga0070698_1003276132 219
194 3300005518 Ga0070699_100008781 Ga0070699_1000087812 219
195 3300005518 Ga0070699_100017019 Ga0070699_1000170196 219
196 3300005545 Ga0070695_100308216 Ga0070695_1003082161 219
197 3300005549 Ga0070704_100603779 Ga0070704_1006037792 219
198 3300005577 Ga0068857_100360747 Ga0068857_1003607472 219
199 3300005577 Ga0068857_100620871 Ga0068857_1006208712 219
200 3300005617 Ga0068859_101489785 Ga0068859_1014897851 219
201 3300005618 Ga0068864_100388984 Ga0068864_1003889842 219
202 3300005844 Ga0068862_100004117 Ga0068862_1000041174 219
203 3300005985 Ga0081539_10002072 Ga0081539_1000207211 219
204 3300006194 Ga0075427_10000275 Ga0075427_100002753 219
205 3300006844 Ga0075428_100030724 Ga0075428_1000307243 219
206 3300006844 Ga0075428_100073497 Ga0075428_1000734975 219
207 3300006846 Ga0075430_100277075 Ga0075430_1002770751 219
208 3300006880 Ga0075429_100012179 Ga0075429_1000121792 219
209 3300006880 Ga0075429_100293453 Ga0075429_1002934532 219
210 3300006931 Ga0097620_100469638 Ga0097620_1004696383 219
211 3300006931 Ga0097620_101489833 Ga0097620_1014898331 219
212 3300009036 Ga0105244_10009466 Ga0105244_100094665 219
213 3300009092 Ga0105250_10002808 Ga0105250_100028085 219
214 3300009094 Ga0111539_10136026 Ga0111539_101360262 219
215 3300009147 Ga0114129_10018553 Ga0114129_100185532 219
216 3300009147 Ga0114129_10079000 Ga0114129_100790002 219
217 3300009147 Ga0114129_10808589 Ga0114129_108085891 219
218 3300009147 Ga0114129_11022785 Ga0114129_110227851 219
219 3300009148 Ga0105243_10203554 Ga0105243_102035542 219
220 3300009148 Ga0105243_10602704 Ga0105243_106027042 219
221 3300009553 Ga0105249_10024039 Ga0105249_100240394 219
222 3300009553 Ga0105249_10069951 Ga0105249_100699512 219
223 3300011119 Ga0105246_10077813 Ga0105246_100778132 219
224 3300011119 Ga0105246_10097030 Ga0105246_100970302 219
225 3300025284 Ga0209130_1006711 Ga0209130_10067112 219
226 3300025294 Ga0209025_1004301 Ga0209025_10043013 219
227 3300025910 Ga0207684_10001676 Ga0207684_100016766 219
228 3300025936 Ga0207670_10164827 Ga0207670_101648272 219
229 3300025961 Ga0207712_10202300 Ga0207712_102023001 219
230 3300025961 Ga0207712_10213148 Ga0207712_102131482 219
231 3300025961 Ga0207712_10515460 Ga0207712_105154601 219
232 3300026116 Ga0207674_10561542 Ga0207674_105615422 219
233 3300028380 Ga0268265_10011694 Ga0268265_100116942 219
234 3300028380 Ga0268265_10238162 Ga0268265_102381622 219
235 3300031665 Ga0316575_10029968 Ga0316575_100299681 219
236 3300031691 Ga0316579_10008247 Ga0316579_100082472 219
237 3300031691 Ga0316579_10031235 Ga0316579_100312351 219
238 3300031727 Ga0316576_10089071 Ga0316576_100890712 219
239 3300031728 Ga0316578_10022634 Ga0316578_100226342 219
240 3300031728 Ga0316578_10091164 Ga0316578_100911643 219
241 3300031731 Ga0307405_10171629 Ga0307405_101716292 219
242 3300031733 Ga0316577_10035133 Ga0316577_100351332 219
243 3300032002 Ga0307416_100366157 Ga0307416_1003661572 219
244 3300032126 Ga0307415_100290058 Ga0307415_1002900582 219
245 3300032168 Ga0316593_10148906 Ga0316593_101489061 219
246 3300035398 Ga0316574_0004126 Ga0316574_0004126_5568_6230 219
247 3300035398 Ga0316574_0025779 Ga0316574_0025779_2775_3437 219
248 3300035398 Ga0316574_0068195 Ga0316574_0068195_1263_1925 219
249 3300035398 Ga0316574_0076906 Ga0316574_0076906_1104_1766 219
250 3300035398 Ga0316574_0210763 Ga0316574_0210763_372_1034 219
251 3300036647 Ga0316582_0033082 Ga0316582_0033082_1092_1754 219
252 3300036647 Ga0316582_0088094 Ga0316582_0088094_509_1168 219
253 3300036712 Ga0316584_0039470 Ga0316584_0039470_2018_2680 219
254 3300036712 Ga0316584_0050976 Ga0316584_0050976_1945_2607 219
255 3300036712 Ga0316584_0311198 Ga0316584_0311198_63_731 219
256 3300037588 Ga0316581_0017287 Ga0316581_0017287_1356_2024 219
257 3300037588 Ga0316581_0025356 Ga0316581_0025356_36_698 219
258 3300039093 Ga0400489_29392 Ga0400489_29392_441_1103 219
259 3300039437 Ga0436365_1078285 Ga0436365_1078285_183_842 219
260 3300042876 Ga0451577_0016245 Ga0451577_0016245_4081_4758 219
261 3300042876 Ga0451577_0022539 Ga0451577_0022539_559_1224 219
262 3300042876 Ga0451577_0026998 Ga0451577_0026998_135_809 219
263 3300042876 Ga0451577_0048612 Ga0451577_0048612_2399_3079 219
264 3300042876 Ga0451577_0068955 Ga0451577_0068955_481_1143 219
265 3300042876 Ga0451577_0480261 Ga0451577_0480261_34_702 219
266 3300042876 Ga0451577_0902856 Ga0451577_0902856_101_763 219
267 3300042876 Ga0451577_1063653 Ga0451577_1063653_29_709 219
268 3300044673 Ga0453683_0000296 Ga0453683_0000296_7591_8262 219
269 3300044673 Ga0453683_0007247 Ga0453683_0007247_4682_5353 219
270 3300044673 Ga0453683_0207679 Ga0453683_0207679_334_1023 219
271 3300044673 Ga0453683_0279473 Ga0453683_0279473_149_817 219
272 3300044712 Ga0453684_0000007 Ga0453684_0000007_1047288_1047962 219
273 3300044712 Ga0453684_0000053 Ga0453684_0000053_298730_299392 219
274 3300044712 Ga0453684_0001942 Ga0453684_0001942_50030_50776 219
275 3300044712 Ga0453684_0001997 Ga0453684_0001997_10844_11503 219
276 3300044712 Ga0453684_0004022 Ga0453684_0004022_18074_18736 219
277 3300044712 Ga0453684_0004582 Ga0453684_0004582_17244_17909 219
278 3300044712 Ga0453684_0004802 Ga0453684_0004802_9716_10438 219
279 3300044712 Ga0453684_0005397 Ga0453684_0005397_24130_24801 219
280 3300044712 Ga0453684_0011317 Ga0453684_0011317_13974_14636 219
281 3300044712 Ga0453684_0012390 Ga0453684_0012390_8490_9155 219
282 3300044712 Ga0453684_0013528 Ga0453684_0013528_6263_6925 219
283 3300044712 Ga0453684_0024767 Ga0453684_0024767_1150_1830 219
284 3300044712 Ga0453684_0048111 Ga0453684_0048111_3957_4625 219
285 3300044712 Ga0453684_0075388 Ga0453684_0075388_586_1260 219
286 3300044712 Ga0453684_0088516 Ga0453684_0088516_1157_1831 219
287 3300044712 Ga0453684_0090483 Ga0453684_0090483_765_1433 219
288 3300044712 Ga0453684_0109363 Ga0453684_0109363_636_1307 219
289 3300044712 Ga0453684_0228646 Ga0453684_0228646_1090_1761 219
290 3300044712 Ga0453684_0241704 Ga0453684_0241704_558_1220 219
291 3300044712 Ga0453684_0271895 Ga0453684_0271895_332_1009 219
292 3300044712 Ga0453684_0287247 Ga0453684_0287247_1013_1681 219
293 3300044712 Ga0453684_0396365 Ga0453684_0396365_182_841 219
294 3300044712 Ga0453684_0488584 Ga0453684_0488584_545_1204 219
295 3300044712 Ga0453684_0491881 Ga0453684_0491881_434_1096 219
296 3300044712 Ga0453684_0724565 Ga0453684_0724565_306_971 219
297 3300044712 Ga0453684_1270697 Ga0453684_1270697_49_726 219
298 3300045051 Ga0451576_0020057 Ga0451576_0020057_6160_6849 219
299 3300045051 Ga0451576_0036917 Ga0451576_0036917_1266_1937 219
300 3300045051 Ga0451576_0037604 Ga0451576_0037604_2822_3490 219
301 3300045051 Ga0451576_0093516 Ga0451576_0093516_1304_1984 219
302 3300049582 Ga0501048_0213080 Ga0501048_0213080_267_959 219
303 3300049593 Ga0501077_0294999 Ga0501077_0294999_254_946 219
304 3300049824 Ga0501045_0248182 Ga0501045_0248182_477_1169 219
305 3300050507 nmdc:mga05p37_135676_c1 nmdc:mga05p37_135676_c1_642_1325 219
306 3300050507 nmdc:mga05p37_771918_c1 nmdc:mga05p37_771918_c1_113_772 219
307 3300050507 nmdc:mga05p37_9561_c1 nmdc:mga05p37_9561_c1_8146_8868 219
308 3300050508 nmdc:mga09592_39713_c1 nmdc:mga09592_39713_c1_2769_3491 219
309 3300050508 nmdc:mga09592_487621_c1 nmdc:mga09592_487621_c1_10_699 219
310 3300050509 nmdc:mga0qj67_240043_c1 nmdc:mga0qj67_240043_c1_636_1316 219
311 3300050510 nmdc:mga06r32_98033_c1 nmdc:mga06r32_98033_c1_1073_1762 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

17

131

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

162

218

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

158

206

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9939 153 214
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.991 154 214
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9888 153 214
7ve6-assembly1.cif.gz_B n-terminal domain of vrar 0.9809 4 138
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.98 153 215
ID Description Score Start End Superfamily
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9917 154 210 1.10.10.10
4if4D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9732 4 141 3.40.50.2300
af_O53213_1064_1134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9727 154 212 1.10.10.10
1a04B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9691 154 211 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9664 154 215 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A536PVN6-F1-model_v4 Response regulator transcription factor 0.9939 2 141 GO:0000160
GO:0003677
AF-A0A7C2WJ38-F1-model_v4 DUF853 family protein 0.9806 3 141 GO:0000160
GO:0003677
GO:0016887
AF-A0A2W2DE54-F1-model_v4 DNA-binding response regulator 0.9803 3 141 GO:0000160
GO:0003677
AF-A0A399TBJ3-F1-model_v4 deleted 0.9749 1 143
AF-A0A7Z0LHK6-F1-model_v4 Response regulator transcription factor 0.9713 4 139 GO:0000160
GO:0003677
GO:0010468

Feature Viewer

pLDDT pTM Quality
89.13 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map