F400937

General Info

Members Datasets Scaffolds Average Seq Length
310 216 620 221

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_567700_c1|nmdc:mga0qj67_567700_c1_33_809
Length 258
Sequence VAVAGARLAARAARPFLGRPAGDDRHQRIVFAEAHEMTGPLPIGADAPDFEADTTEGRIRFHEWLGNSWGVLFSHPKDFTPVCTTELGYMARIKPDFEKRGVKIIGLSIDPLESHTGWSKDIAETQGTAPNYPMIADHDLKVAKTYGMLPAEAGDSCSGRTAADNATVRNVYVIGPDKKIKLVLSYPMSTGRNFDEVLRIIDSLQLTAKHKVATPVNWKQGEDVIILTSVSNEDAQKQYPEGWKTIKPYLRVVPQPRA

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
206 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
207 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
215 2643221599 Rhizobium sp. Root708 Isolate Unclassified
216 2643221634 Rhizobium sp. Root1203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 1.94
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 6.45
Rhizosphere 89.68
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_567700_c1 3300050509 Bacteria 909
2 JGI25406J46586_10000103 3300003203 Bacteria 37801
3 Ga0058863_11796752 3300004799 Bacteria 2387
4 Ga0058862_10048149 3300004803 Bacteria 961
5 Ga0058862_12823488 3300004803 Bacteria 759
6 Ga0065712_10078585 3300005290 Bacteria 3328
7 Ga0065712_10301272 3300005290 Bacteria 860
8 Ga0065715_10255087 3300005293 Bacteria 1130
9 Ga0070676_10004328 3300005328 Bacteria 7460
10 Ga0070690_100003728 3300005330 Bacteria 8392
11 Ga0070670_100378095 3300005331 Bacteria 1247
12 Ga0068869_100016287 3300005334 Bacteria 5008
13 Ga0068869_100355094 3300005334 Bacteria 1196
14 Ga0070680_100142322 3300005336 Bacteria 2011
15 Ga0070669_100013528 3300005353 Bacteria 5800
16 Ga0070675_100008817 3300005354 Bacteria 7837
17 Ga0070675_100192451 3300005354 Bacteria 1768
18 Ga0070671_100006222 3300005355 Bacteria 9510
19 Ga0070671_100523023 3300005355 Bacteria 1022
20 Ga0070673_100031024 3300005364 Bacteria 4007
21 Ga0070688_100436499 3300005365 Bacteria 976
22 Ga0070659_100048757 3300005366 Bacteria 3328
23 Ga0070701_10256413 3300005438 Bacteria 1058
24 Ga0070700_100006632 3300005441 Bacteria 6197
25 Ga0070694_100356204 3300005444 Bacteria 1135
26 Ga0070708_100000241 3300005445 Bacteria 40642
27 Ga0070708_101012923 3300005445 Bacteria 779
28 Ga0070663_100001372 3300005455 Bacteria 13335
29 Ga0068867_100007263 3300005459 Bacteria 7834
30 Ga0068867_100380254 3300005459 Bacteria 1186
31 Ga0070706_100041912 3300005467 Bacteria 4228
32 Ga0070699_100110450 3300005518 Bacteria 2414
33 Ga0070679_100006635 3300005530 Bacteria 10790
34 Ga0070697_100096468 3300005536 Bacteria 2453
35 Ga0068853_100022574 3300005539 Bacteria 5257
36 Ga0070672_100004487 3300005543 Bacteria 9141
37 Ga0070672_100042183 3300005543 Bacteria 3512
38 Ga0070696_100319213 3300005546 Bacteria 1195
39 Ga0068855_100004592 3300005563 Bacteria 16861
40 Ga0070664_100045292 3300005564 Bacteria 3716
41 Ga0070702_100180767 3300005615 Bacteria 1380
42 Ga0068859_100338453 3300005617 Bacteria 1599
43 Ga0068864_101100938 3300005618 Bacteria 791
44 Ga0068861_100185076 3300005719 Bacteria 1736
45 Ga0068861_100280805 3300005719 Bacteria 1434
46 Ga0068861_100283768 3300005719 Bacteria 1427
47 Ga0068858_100061671 3300005842 Bacteria 3467
48 Ga0068858_100073999 3300005842 Bacteria 3163
49 Ga0068858_100202009 3300005842 Bacteria 1880
50 Ga0068860_100556536 3300005843 Bacteria 1149
51 Ga0068862_100656250 3300005844 Bacteria 1012
52 Ga0081539_10000175 3300005985 Bacteria 150479
53 Ga0081539_10001454 3300005985 Bacteria 40374
54 Ga0075364_10065250 3300006051 Bacteria 2390
55 Ga0075428_100005399 3300006844 Bacteria 14208
56 Ga0075428_100822483 3300006844 Bacteria 987
57 Ga0075430_100001493 3300006846 Bacteria 19071
58 Ga0075431_100388845 3300006847 Bacteria 1398
59 Ga0075431_100898071 3300006847 Bacteria 856
60 Ga0075434_101125871 3300006871 Bacteria 798
61 Ga0075429_100013832 3300006880 Bacteria 6998
62 Ga0075429_100142933 3300006880 Bacteria 2094
63 Ga0075429_100325688 3300006880 Bacteria 1345
64 Ga0075429_100416372 3300006880 Bacteria 1177
65 Ga0068865_100006529 3300006881 Bacteria 7125
66 Ga0097620_100338450 3300006931 Bacteria 1599
67 Ga0099794_10018063 3300007265 Bacteria 3156
68 Ga0111539_10022997 3300009094 Bacteria 7654
69 Ga0111539_10034928 3300009094 Bacteria 6090
70 Ga0111539_10283548 3300009094 Bacteria 1928
71 Ga0111539_11040083 3300009094 Bacteria 952
72 Ga0114129_10001284 3300009147 Bacteria 33454
73 Ga0114129_10003060 3300009147 Bacteria 23450
74 Ga0114129_10054942 3300009147 Bacteria 5582
75 Ga0114129_11620300 3300009147 Bacteria 792
76 Ga0105243_10017198 3300009148 Bacteria 5469
77 Ga0105248_10029991 3300009177 Bacteria 6071
78 Ga0105238_10002638 3300009551 Bacteria 17878
79 Ga0105249_10634799 3300009553 Bacteria 1125
80 Ga0105246_10153825 3300011119 Bacteria 1744
81 Ga0157370_10008027 3300013104 Bacteria 11434
82 Ga0157372_10014923 3300013307 Bacteria 8317
83 Ga0163163_10011323 3300014325 Bacteria 8086
84 Ga0157380_10003103 3300014326 Bacteria 11334
85 Ga0157380_10034001 3300014326 Bacteria 3930
86 Ga0157379_10009189 3300014968 Bacteria 8609
87 Ga0157376_10147140 3300014969 Bacteria 2120
88 Ga0157376_10411392 3300014969 Bacteria 1310
89 Ga0206350_10655267 3300020080 Bacteria 928
90 Ga0206353_11455220 3300020082 Bacteria 897
91 Ga0207682_10278498 3300025893 Bacteria 782
92 Ga0207642_10008173 3300025899 Bacteria 3576
93 Ga0207688_10098397 3300025901 Bacteria 1687
94 Ga0207685_10009201 3300025905 Bacteria 2858
95 Ga0207645_10007249 3300025907 Bacteria 7852
96 Ga0207705_10000176 3300025909 Bacteria 67914
97 Ga0207707_10000758 3300025912 Bacteria 31798
98 Ga0207660_10000859 3300025917 Bacteria 20037
99 Ga0207657_10000129 3300025919 Bacteria 75856
100 Ga0207652_10000596 3300025921 Bacteria 36173
101 Ga0207652_10000860 3300025921 Bacteria 28771
102 Ga0207652_10162218 3300025921 Bacteria 2004
103 Ga0207694_10013405 3300025924 Bacteria 6173
104 Ga0207650_10232343 3300025925 Bacteria 1488
105 Ga0207659_10193964 3300025926 Bacteria 1618
106 Ga0207700_10268809 3300025928 Bacteria 1463
107 Ga0207644_10001793 3300025931 Bacteria 13916
108 Ga0207644_10411691 3300025931 Bacteria 1106
109 Ga0207690_10068404 3300025932 Bacteria 2440
110 Ga0207706_10238069 3300025933 Bacteria 1591
111 Ga0207686_10394875 3300025934 Bacteria 1052
112 Ga0207709_10223036 3300025935 Bacteria 1361
113 Ga0207670_10048009 3300025936 Bacteria 2846
114 Ga0207691_10021930 3300025940 Bacteria 6027
115 Ga0207691_10066634 3300025940 Bacteria 3257
116 Ga0207711_10056994 3300025941 Bacteria 3358
117 Ga0207689_10006771 3300025942 Bacteria 10087
118 Ga0207689_10280498 3300025942 Bacteria 1380
119 Ga0207689_10375613 3300025942 Bacteria 1183
120 Ga0207679_10026996 3300025945 Bacteria 3966
121 Ga0207679_10415819 3300025945 Bacteria 1186
122 Ga0207651_10001376 3300025960 Bacteria 11011
123 Ga0207651_10368557 3300025960 Bacteria 1214
124 Ga0207703_10027693 3300026035 Bacteria 4463
125 Ga0207703_10085634 3300026035 Bacteria 2638
126 Ga0207703_10170880 3300026035 Bacteria 1912
127 Ga0207639_10065529 3300026041 Bacteria 2820
128 Ga0207678_10001445 3300026067 Bacteria 21828
129 Ga0207708_10001418 3300026075 Bacteria 17960
130 Ga0207708_10023304 3300026075 Bacteria 4677
131 Ga0207708_10255110 3300026075 Bacteria 1414
132 Ga0207708_10460195 3300026075 Bacteria 1061
133 Ga0207702_10061592 3300026078 Bacteria 3201
134 Ga0207641_10106155 3300026088 Bacteria 2482
135 Ga0207648_10006501 3300026089 Bacteria 11609
136 Ga0207674_10326861 3300026116 Bacteria 1483
137 Ga0207675_100130630 3300026118 Bacteria 2382
138 Ga0207675_100592511 3300026118 Bacteria 1111
139 Ga0207683_10097919 3300026121 Bacteria 2616
140 Ga0209998_10010871 3300027717 Bacteria 1884
141 Ga0207428_10003237 3300027907 Bacteria 15879
142 Ga0207428_10025094 3300027907 Bacteria 4992
143 Ga0207428_10040409 3300027907 Bacteria 3784
144 Ga0268265_10252033 3300028380 Bacteria 1564
145 Ga0268264_10113956 3300028381 Bacteria 2373
146 Ga0265319_1041296 3300028563 Bacteria 1557
147 Ga0265322_10023727 3300028654 Bacteria 1754
148 Ga0265338_10023788 3300028800 Bacteria 6283
149 Ga0265338_10036203 3300028800 Bacteria 4729
150 Ga0265338_10072985 3300028800 Bacteria 2927
151 Ga0265338_10518974 3300028800 Bacteria 837
152 Ga0265330_10086160 3300031235 Bacteria 1351
153 Ga0265316_10121445 3300031344 Bacteria 1973
154 Ga0307408_100709503 3300031548 Bacteria 905
155 Ga0265314_10011078 3300031711 Bacteria 7474
156 Ga0265342_10077386 3300031712 Bacteria 1927
157 Ga0307405_10495374 3300031731 Bacteria 978
158 Ga0307413_10035801 3300031824 Bacteria 2852
159 Ga0307413_10132387 3300031824 Bacteria 1709
160 Ga0307410_10209836 3300031852 Bacteria 1491
161 Ga0307406_10031125 3300031901 Bacteria 3247
162 Ga0307406_10376921 3300031901 Bacteria 1117
163 Ga0307407_10045432 3300031903 Bacteria 2482
164 Ga0307407_10113215 3300031903 Bacteria 1707
165 Ga0307407_10218193 3300031903 Bacteria 1288
166 Ga0307409_100005825 3300031995 Bacteria 7150
167 Ga0307416_100043144 3300032002 Bacteria 3529
168 Ga0307416_100125429 3300032002 Bacteria 2299
169 Ga0307416_100200456 3300032002 Bacteria 1893
170 Ga0307415_100053889 3300032126 Bacteria 2743
171 Ga0373956_0297109 3300035119 Bacteria 769
172 Ga0373955_0027049 3300035172 Bacteria 2961
173 Ga0373933_0000097 3300035724 Bacteria 54539
174 Ga0373937_0009837 3300036401 Bacteria 8338
175 Ga0373937_0106910 3300036401 Bacteria 2601
176 Ga0373937_0296227 3300036401 Bacteria 1529
177 Ga0395901_0493741 3300038443 Bacteria 1247
178 Ga0436365_1599743 3300039437 Bacteria 1477
179 Ga0439444_0027122 3300042437 Bacteria 1053
180 Ga0439460_0041009 3300042461 Bacteria 1359
181 Ga0439440_0022042 3300042993 Bacteria 1441
182 Ga0466966_0193043 3300044684 Bacteria 1233
183 Ga0466963_0056056 3300044694 Bacteria 2622
184 Ga0453684_0278184 3300044712 Bacteria 1910
185 Ga0453684_1088483 3300044712 Unclassified 845
186 Ga0466957_0142766 3300044842 Bacteria 1543
187 Ga0466959_0073364 3300045049 Bacteria 2476
188 Ga0466958_0015424 3300045836 Bacteria 4379
189 Ga0466967_0008574 3300045976 Bacteria 7511
190 Ga0495638_0047339 3300046460 Bacteria 2696
191 Ga0495638_0086507 3300046460 Bacteria 1894
192 Ga0495651_0223384 3300046462 Bacteria 1302
193 Ga0495651_0336279 3300046462 Bacteria 1002
194 Ga0495653_0064338 3300046463 Bacteria 2764
195 Ga0495608_0380733 3300046511 Bacteria 865
196 Ga0495610_0002294 3300046512 Bacteria 16162
197 Ga0495620_0049145 3300046515 Bacteria 1806
198 Ga0495628_0142694 3300046516 Bacteria 1827
199 Ga0495632_0011438 3300046519 Bacteria 5178
200 Ga0495643_0003938 3300046522 Bacteria 10638
201 Ga0495621_0018277 3300046539 Bacteria 2275
202 Ga0495645_0020873 3300046543 Bacteria 4733
203 Ga0495645_0290286 3300046543 Bacteria 1072
204 Ga0495646_0227288 3300046680 Bacteria 1007
205 Ga0495647_0038974 3300046681 Bacteria 1799
206 Ga0495658_0028983 3300046683 Bacteria 2992
207 Ga0495658_0065927 3300046683 Bacteria 2090
208 Ga0495600_0122505 3300046809 Bacteria 1691
209 Ga0495674_0180704 3300047319 Bacteria 1757
210 Ga0495674_0706222 3300047319 Bacteria 791
211 Ga0495673_0012449 3300047469 Bacteria 4510
212 Ga0495684_0052807 3300047471 Bacteria 3101
213 Ga0495686_0004663 3300047472 Bacteria 11135
214 Ga0496100_0003196 3300048903 Bacteria 8507
215 Ga0496101_0045179 3300048904 Bacteria 3154
216 Ga0496102_0031139 3300048905 Bacteria 4783
217 Ga0496104_0101654 3300048907 Bacteria 2752
218 Ga0496104_0107974 3300048907 Bacteria 2667
219 Ga0496105_0168591 3300048908 Bacteria 1795
220 Ga0496108_0009554 3300048911 Bacteria 7863
221 Ga0496108_0016611 3300048911 Bacteria 6010
222 Ga0496109_0025279 3300048912 Bacteria 5290
223 Ga0496109_0116048 3300048912 Bacteria 2491
224 Ga0496110_0035394 3300048913 Bacteria 4331
225 Ga0496110_0609156 3300048913 Bacteria 990
226 Ga0496111_0081473 3300048914 Bacteria 2363
227 Ga0496111_0722970 3300048914 Bacteria 723
228 Ga0496112_0518137 3300048915 Bacteria 1127
229 Ga0496112_0673380 3300048915 Bacteria 963
230 Ga0496113_0035866 3300048916 Bacteria 3630
231 Ga0496113_0101611 3300048916 Bacteria 2229
232 Ga0496114_0027346 3300048917 Bacteria 4672
233 Ga0496115_0042623 3300048918 Bacteria 3616
234 Ga0496116_0021206 3300048919 Bacteria 4906
235 Ga0496124_0077114 3300048927 Bacteria 2749
236 Ga0496124_0299679 3300048927 Bacteria 1162
237 Ga0496125_0004674 3300048928 Bacteria 15611
238 Ga0496126_0305931 3300048929 Bacteria 1310
239 Ga0495678_030002 3300049459 Bacteria 2280
240 Ga0501031_0016808 3300049568 Bacteria 4751
241 Ga0501031_0266948 3300049568 Bacteria 1112
242 Ga0501031_0275776 3300049568 Bacteria 1091
243 Ga0501032_0089514 3300049569 Bacteria 2043
244 Ga0501032_0486550 3300049569 Bacteria 789
245 Ga0501033_0072672 3300049570 Bacteria 2525
246 Ga0501036_0105773 3300049572 Bacteria 2380
247 Ga0501037_0032449 3300049573 Bacteria 3856
248 Ga0501037_0258703 3300049573 Bacteria 1216
249 Ga0501038_0079778 3300049574 Bacteria 2759
250 Ga0501038_0217780 3300049574 Bacteria 1525
251 Ga0501039_0128861 3300049575 Bacteria 1985
252 Ga0501040_0237590 3300049576 Bacteria 1298
253 Ga0501041_0072417 3300049577 Bacteria 2117
254 Ga0501042_0015368 3300049578 Bacteria 5240
255 Ga0501043_0603323 3300049579 Bacteria 811
256 Ga0501048_0229145 3300049582 Bacteria 1318
257 Ga0501048_0238945 3300049582 Bacteria 1289
258 Ga0501048_0406601 3300049582 Bacteria 973
259 Ga0501070_0000280 3300049586 Bacteria 47649
260 Ga0501070_0002141 3300049586 Bacteria 17348
261 Ga0501071_0019482 3300049587 Bacteria 4708
262 Ga0501071_0142793 3300049587 Bacteria 1783
263 Ga0501071_0358473 3300049587 Bacteria 1110
264 Ga0501071_0560197 3300049587 Bacteria 878
265 Ga0501072_0114889 3300049588 Bacteria 2143
266 Ga0501073_0141578 3300049589 Bacteria 1666
267 Ga0501074_0054655 3300049590 Bacteria 2879
268 Ga0501075_0221082 3300049591 Bacteria 1445
269 Ga0501076_0018138 3300049592 Bacteria 5359
270 Ga0501076_0171911 3300049592 Bacteria 1766
271 Ga0501076_0218661 3300049592 Bacteria 1557
272 Ga0501077_0164324 3300049593 Bacteria 1410
273 Ga0501079_0021727 3300049741 Bacteria 4912
274 Ga0501079_0288923 3300049741 Bacteria 1282
275 Ga0501080_0229077 3300049742 Bacteria 1699
276 Ga0501081_0014164 3300049743 Bacteria 5256
277 Ga0501035_0001834 3300049822 Bacteria 21387
278 Ga0501035_0151503 3300049822 Bacteria 2012
279 Ga0501035_0590139 3300049822 Bacteria 906
280 Ga0501044_0009695 3300049823 Bacteria 10475
281 Ga0501044_0029549 3300049823 Bacteria 5778
282 Ga0501044_0431818 3300049823 Bacteria 1226
283 nmdc:mga05p37_5376_c1 3300050507 Bacteria 15058
284 nmdc:mga05p37_55486_c1 3300050507 Bacteria 4875
285 nmdc:mga09592_15089_c1 3300050508 Bacteria 6310
286 nmdc:mga09592_805940_c1 3300050508 Bacteria 794
287 nmdc:mga09592_99740_c1 3300050508 Bacteria 2486
288 nmdc:mga0qj67_10969_c1 3300050509 Bacteria 6783
289 nmdc:mga08y16_25204_c1 3300050511 Bacteria 6271
290 nmdc:mga08y16_25659_c1 3300050511 Bacteria 6218
291 nmdc:mga08y16_290818_c1 3300050511 Bacteria 1685
292 nmdc:mga08y16_329862_c1 3300050511 Bacteria 1570
293 nmdc:mga08y16_4639_c1 3300050511 Bacteria 14317
294 nmdc:mga08y16_662137_c1 3300050511 Bacteria 1047
295 nmdc:mga0n895_788290_c1 3300050512 Bacteria 941
296 nmdc:mga0a205_154133_c1 3300050515 Bacteria 2196
297 Ga0495595_0198251 3300053084 Bacteria 999
298 Ga0495619_0206660 3300053085 Bacteria 1359
299 Ga0500572_130713 3300053111 Bacteria 815
300 Ga0500592_003990 3300053116 Bacteria 2356
301 Ga0500611_071953 3300053727 Bacteria 844
302 Ga0501084_0159228 3300054114 Bacteria 1905
303 Ga0590071_008113 3300059421 Bacteria 2479
304 Ga0590075_043246 3300059424 Bacteria 1152
305 Ga0590077_034559 3300059426 Bacteria 1111
306 Ga0587069_007190 3300059642 Bacteria 1366
307 Ga0466962_0174301 3300061719 Bacteria 1048
308 Ga0530510_0142627 3300061734 Bacteria 1766
309 2644005959 2643221599 Bacteria 6292121
310 2644193176 2643221634 Bacteria 6705461
311 nmdc:mga0qj67_567700_c1
312 JGI25406J46586_10000103
313 Ga0058863_11796752
314 Ga0058862_10048149
315 Ga0058862_12823488
316 Ga0065712_10078585
317 Ga0065712_10301272
318 Ga0065715_10255087
319 Ga0070676_10004328
320 Ga0070690_100003728
321 Ga0070670_100378095
322 Ga0068869_100016287
323 Ga0068869_100355094
324 Ga0070680_100142322
325 Ga0070669_100013528
326 Ga0070675_100008817
327 Ga0070675_100192451
328 Ga0070671_100006222
329 Ga0070671_100523023
330 Ga0070673_100031024
331 Ga0070688_100436499
332 Ga0070659_100048757
333 Ga0070701_10256413
334 Ga0070700_100006632
335 Ga0070694_100356204
336 Ga0070708_100000241
337 Ga0070708_101012923
338 Ga0070663_100001372
339 Ga0068867_100007263
340 Ga0068867_100380254
341 Ga0070706_100041912
342 Ga0070699_100110450
343 Ga0070679_100006635
344 Ga0070697_100096468
345 Ga0068853_100022574
346 Ga0070672_100004487
347 Ga0070672_100042183
348 Ga0070696_100319213
349 Ga0068855_100004592
350 Ga0070664_100045292
351 Ga0070702_100180767
352 Ga0068859_100338453
353 Ga0068864_101100938
354 Ga0068861_100185076
355 Ga0068861_100280805
356 Ga0068861_100283768
357 Ga0068858_100061671
358 Ga0068858_100073999
359 Ga0068858_100202009
360 Ga0068860_100556536
361 Ga0068862_100656250
362 Ga0081539_10000175
363 Ga0081539_10001454
364 Ga0075364_10065250
365 Ga0075428_100005399
366 Ga0075428_100822483
367 Ga0075430_100001493
368 Ga0075431_100388845
369 Ga0075431_100898071
370 Ga0075434_101125871
371 Ga0075429_100013832
372 Ga0075429_100142933
373 Ga0075429_100325688
374 Ga0075429_100416372
375 Ga0068865_100006529
376 Ga0097620_100338450
377 Ga0099794_10018063
378 Ga0111539_10022997
379 Ga0111539_10034928
380 Ga0111539_10283548
381 Ga0111539_11040083
382 Ga0114129_10001284
383 Ga0114129_10003060
384 Ga0114129_10054942
385 Ga0114129_11620300
386 Ga0105243_10017198
387 Ga0105248_10029991
388 Ga0105238_10002638
389 Ga0105249_10634799
390 Ga0105246_10153825
391 Ga0157370_10008027
392 Ga0157372_10014923
393 Ga0163163_10011323
394 Ga0157380_10003103
395 Ga0157380_10034001
396 Ga0157379_10009189
397 Ga0157376_10147140
398 Ga0157376_10411392
399 Ga0206350_10655267
400 Ga0206353_11455220
401 Ga0207682_10278498
402 Ga0207642_10008173
403 Ga0207688_10098397
404 Ga0207685_10009201
405 Ga0207645_10007249
406 Ga0207705_10000176
407 Ga0207707_10000758
408 Ga0207660_10000859
409 Ga0207657_10000129
410 Ga0207652_10000596
411 Ga0207652_10000860
412 Ga0207652_10162218
413 Ga0207694_10013405
414 Ga0207650_10232343
415 Ga0207659_10193964
416 Ga0207700_10268809
417 Ga0207644_10001793
418 Ga0207644_10411691
419 Ga0207690_10068404
420 Ga0207706_10238069
421 Ga0207686_10394875
422 Ga0207709_10223036
423 Ga0207670_10048009
424 Ga0207691_10021930
425 Ga0207691_10066634
426 Ga0207711_10056994
427 Ga0207689_10006771
428 Ga0207689_10280498
429 Ga0207689_10375613
430 Ga0207679_10026996
431 Ga0207679_10415819
432 Ga0207651_10001376
433 Ga0207651_10368557
434 Ga0207703_10027693
435 Ga0207703_10085634
436 Ga0207703_10170880
437 Ga0207639_10065529
438 Ga0207678_10001445
439 Ga0207708_10001418
440 Ga0207708_10023304
441 Ga0207708_10255110
442 Ga0207708_10460195
443 Ga0207702_10061592
444 Ga0207641_10106155
445 Ga0207648_10006501
446 Ga0207674_10326861
447 Ga0207675_100130630
448 Ga0207675_100592511
449 Ga0207683_10097919
450 Ga0209998_10010871
451 Ga0207428_10003237
452 Ga0207428_10025094
453 Ga0207428_10040409
454 Ga0268265_10252033
455 Ga0268264_10113956
456 Ga0265319_1041296
457 Ga0265322_10023727
458 Ga0265338_10023788
459 Ga0265338_10036203
460 Ga0265338_10072985
461 Ga0265338_10518974
462 Ga0265330_10086160
463 Ga0265316_10121445
464 Ga0307408_100709503
465 Ga0265314_10011078
466 Ga0265342_10077386
467 Ga0307405_10495374
468 Ga0307413_10035801
469 Ga0307413_10132387
470 Ga0307410_10209836
471 Ga0307406_10031125
472 Ga0307406_10376921
473 Ga0307407_10045432
474 Ga0307407_10113215
475 Ga0307407_10218193
476 Ga0307409_100005825
477 Ga0307416_100043144
478 Ga0307416_100125429
479 Ga0307416_100200456
480 Ga0307415_100053889
481 Ga0373956_0297109
482 Ga0373955_0027049
483 Ga0373933_0000097
484 Ga0373937_0009837
485 Ga0373937_0106910
486 Ga0373937_0296227
487 Ga0395901_0493741
488 Ga0436365_1599743
489 Ga0439444_0027122
490 Ga0439460_0041009
491 Ga0439440_0022042
492 Ga0466966_0193043
493 Ga0466963_0056056
494 Ga0453684_0278184
495 Ga0453684_1088483
496 Ga0466957_0142766
497 Ga0466959_0073364
498 Ga0466958_0015424
499 Ga0466967_0008574
500 Ga0495638_0047339
501 Ga0495638_0086507
502 Ga0495651_0223384
503 Ga0495651_0336279
504 Ga0495653_0064338
505 Ga0495608_0380733
506 Ga0495610_0002294
507 Ga0495620_0049145
508 Ga0495628_0142694
509 Ga0495632_0011438
510 Ga0495643_0003938
511 Ga0495621_0018277
512 Ga0495645_0020873
513 Ga0495645_0290286
514 Ga0495646_0227288
515 Ga0495647_0038974
516 Ga0495658_0028983
517 Ga0495658_0065927
518 Ga0495600_0122505
519 Ga0495674_0180704
520 Ga0495674_0706222
521 Ga0495673_0012449
522 Ga0495684_0052807
523 Ga0495686_0004663
524 Ga0496100_0003196
525 Ga0496101_0045179
526 Ga0496102_0031139
527 Ga0496104_0101654
528 Ga0496104_0107974
529 Ga0496105_0168591
530 Ga0496108_0009554
531 Ga0496108_0016611
532 Ga0496109_0025279
533 Ga0496109_0116048
534 Ga0496110_0035394
535 Ga0496110_0609156
536 Ga0496111_0081473
537 Ga0496111_0722970
538 Ga0496112_0518137
539 Ga0496112_0673380
540 Ga0496113_0035866
541 Ga0496113_0101611
542 Ga0496114_0027346
543 Ga0496115_0042623
544 Ga0496116_0021206
545 Ga0496124_0077114
546 Ga0496124_0299679
547 Ga0496125_0004674
548 Ga0496126_0305931
549 Ga0495678_030002
550 Ga0501031_0016808
551 Ga0501031_0266948
552 Ga0501031_0275776
553 Ga0501032_0089514
554 Ga0501032_0486550
555 Ga0501033_0072672
556 Ga0501036_0105773
557 Ga0501037_0032449
558 Ga0501037_0258703
559 Ga0501038_0079778
560 Ga0501038_0217780
561 Ga0501039_0128861
562 Ga0501040_0237590
563 Ga0501041_0072417
564 Ga0501042_0015368
565 Ga0501043_0603323
566 Ga0501048_0229145
567 Ga0501048_0238945
568 Ga0501048_0406601
569 Ga0501070_0000280
570 Ga0501070_0002141
571 Ga0501071_0019482
572 Ga0501071_0142793
573 Ga0501071_0358473
574 Ga0501071_0560197
575 Ga0501072_0114889
576 Ga0501073_0141578
577 Ga0501074_0054655
578 Ga0501075_0221082
579 Ga0501076_0018138
580 Ga0501076_0171911
581 Ga0501076_0218661
582 Ga0501077_0164324
583 Ga0501079_0021727
584 Ga0501079_0288923
585 Ga0501080_0229077
586 Ga0501081_0014164
587 Ga0501035_0001834
588 Ga0501035_0151503
589 Ga0501035_0590139
590 Ga0501044_0009695
591 Ga0501044_0029549
592 Ga0501044_0431818
593 nmdc:mga05p37_5376_c1
594 nmdc:mga05p37_55486_c1
595 nmdc:mga09592_15089_c1
596 nmdc:mga09592_805940_c1
597 nmdc:mga09592_99740_c1
598 nmdc:mga0qj67_10969_c1
599 nmdc:mga08y16_25204_c1
600 nmdc:mga08y16_25659_c1
601 nmdc:mga08y16_290818_c1
602 nmdc:mga08y16_329862_c1
603 nmdc:mga08y16_4639_c1
604 nmdc:mga08y16_662137_c1
605 nmdc:mga0n895_788290_c1
606 nmdc:mga0a205_154133_c1
607 Ga0495595_0198251
608 Ga0495619_0206660
609 Ga0500572_130713
610 Ga0500592_003990
611 Ga0500611_071953
612 Ga0501084_0159228
613 Ga0590071_008113
614 Ga0590075_043246
615 Ga0590077_034559
616 Ga0587069_007190
617 Ga0466962_0174301
618 Ga0530510_0142627
619 2644005959
620 2644193176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

203

242

0.97

PF00578

AhpC-TSA

AhpC/TSA family

43

183

0.96

PF08534

Redoxin

Redoxin

42

201

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9656 9 225
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9609 9 225
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9592 9 225
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9499 9 225
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.9374 9 222
ID Description Score Start End Superfamily
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9474 11 112 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9303 161 224 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9215 11 112 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.917 161 224 3.30.1020.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9118 161 222 3.30.1020.10
ID Description Score Start End GO Terms
AF-A0A7C7WM65-F1-model_v4 Redoxin domain-containing protein 0.9855 8 175 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A534YD48-F1-model_v4 Peroxiredoxin 0.9807 8 190 GO:0005829
GO:0045454
GO:0051920
AF-A0A659YRX5-F1-model_v4 deleted 0.9746 9 108
AF-X7YBQ5-F1-model_v4 deleted 0.9725 8 226
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.9704 9 112 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Map