F400930

General Info

Members Datasets Scaffolds Average Seq Length
310 169 620 147

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0335324|Ga0501081_0335324_626_1081
Length 151
Sequence VKRALAAILVAGAAALCGGASAGNPAAAVPGQAHPSLIQQDRDIAVSQPAPHDGGGMTTAYPFFADAPEFGIVFRKRALHPGSAIGCHPHDKDEIYYVISGRGEFTLDGVRHAVGPGTAMLTRVGSTHCLKQVGSDDLVILINYLEPPAQR

Samples

Sample ID Description Type Environment
1 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
110 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
111 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
112 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
113 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
114 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
115 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
116 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
117 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
118 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 0.32
Rhizosphere 98.06
Stem 0
Stem Tuber 0
Unclassified 18.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501081_0335324 3300049743 Bacteria 1113
2 Ga0065712_10089294 3300005290 Bacteria 2477
3 Ga0065712_10100129 3300005290 Bacteria 2071
4 Ga0065712_10180578 3300005290 Unclassified 1190
5 Ga0065707_10132875 3300005295 Bacteria 1891
6 Ga0070658_11346762 3300005327 Bacteria 620
7 Ga0070683_100048354 3300005329 Bacteria 3932
8 Ga0070670_100032185 3300005331 Bacteria 4517
9 Ga0070670_100785755 3300005331 Unclassified 859
10 Ga0070666_10021152 3300005335 Bacteria 4214
11 Ga0068868_100711691 3300005338 Unclassified 899
12 Ga0070689_100122228 3300005340 Bacteria 2080
13 Ga0070661_100025411 3300005344 Bacteria 4255
14 Ga0070692_11039382 3300005345 Unclassified 575
15 Ga0070668_100024993 3300005347 Bacteria 4527
16 Ga0070669_100031816 3300005353 Bacteria 3810
17 Ga0070675_100062269 3300005354 Bacteria 3082
18 Ga0070671_100134301 3300005355 Bacteria 2085
19 Ga0070674_100439236 3300005356 Unclassified 1075
20 Ga0070673_100121415 3300005364 Unclassified 2180
21 Ga0070673_100172028 3300005364 Bacteria 1849
22 Ga0070688_100059666 3300005365 Unclassified 2407
23 Ga0070688_100082230 3300005365 Bacteria 2087
24 Ga0070701_10735048 3300005438 Bacteria 667
25 Ga0070705_100294049 3300005440 Unclassified 1161
26 Ga0070705_101021099 3300005440 Bacteria 672
27 Ga0070700_100020542 3300005441 Bacteria 3827
28 Ga0070700_100127463 3300005441 Bacteria 1713
29 Ga0070700_100201355 3300005441 Bacteria 1399
30 Ga0070694_100033431 3300005444 Bacteria 3384
31 Ga0070678_100577847 3300005456 Bacteria 1001
32 Ga0070678_100742674 3300005456 Unclassified 887
33 Ga0070678_101194599 3300005456 Unclassified 705
34 Ga0070678_101866914 3300005456 Unclassified 567
35 Ga0070662_100059987 3300005457 Bacteria 2773
36 Ga0068867_100413629 3300005459 Bacteria 1140
37 Ga0068867_100668322 3300005459 Bacteria 913
38 Ga0070706_100388491 3300005467 Unclassified 1299
39 Ga0070706_100964972 3300005467 Bacteria 786
40 Ga0070699_100196517 3300005518 Bacteria 1793
41 Ga0070684_100008951 3300005535 Bacteria 7862
42 Ga0070697_100029370 3300005536 Bacteria 4407
43 Ga0070672_100023376 3300005543 Bacteria 4555
44 Ga0070672_100839264 3300005543 Bacteria 810
45 Ga0070686_100029331 3300005544 Bacteria 3346
46 Ga0070686_100533228 3300005544 Bacteria 916
47 Ga0070695_100087944 3300005545 Bacteria 2068
48 Ga0070695_100656659 3300005545 Unclassified 828
49 Ga0070696_100004628 3300005546 Bacteria 9187
50 Ga0070696_100221888 3300005546 Bacteria 1419
51 Ga0070665_100233790 3300005548 Bacteria 1838
52 Ga0070665_100791884 3300005548 Bacteria 961
53 Ga0070664_100002625 3300005564 Bacteria 14499
54 Ga0068852_101023705 3300005616 Unclassified 845
55 Ga0068859_100990110 3300005617 Unclassified 923
56 Ga0068859_100990256 3300005617 Bacteria 923
57 Ga0068864_100356007 3300005618 Unclassified 1382
58 Ga0068861_100020190 3300005719 Bacteria 4767
59 Ga0068861_100084379 3300005719 Bacteria 2494
60 Ga0068861_100847845 3300005719 Bacteria 861
61 Ga0068861_101302298 3300005719 Bacteria 706
62 Ga0068863_100719082 3300005841 Bacteria 993
63 Ga0068858_100272706 3300005842 Bacteria 1610
64 Ga0068862_100030144 3300005844 Bacteria 4571
65 Ga0068862_100135914 3300005844 Bacteria 2178
66 Ga0068862_100326609 3300005844 Bacteria 1417
67 Ga0068862_101769494 3300005844 Unclassified 627
68 Ga0081540_1095623 3300005983 Bacteria 1294
69 Ga0075367_10054989 3300006178 Bacteria 2361
70 Ga0075366_10011976 3300006195 Bacteria 4911
71 Ga0097621_100211742 3300006237 Bacteria 1686
72 Ga0068871_100928351 3300006358 Bacteria 808
73 Ga0075428_100000376 3300006844 Bacteria 44215
74 Ga0075428_100062347 3300006844 Bacteria 4082
75 Ga0075428_100255521 3300006844 Bacteria 1888
76 Ga0075428_100534412 3300006844 Bacteria 1254
77 Ga0075430_100017845 3300006846 Bacteria 6041
78 Ga0075430_101177484 3300006846 Bacteria 631
79 Ga0075431_100078673 3300006847 Bacteria 3404
80 Ga0075431_100282877 3300006847 Bacteria 1679
81 Ga0075431_100291190 3300006847 Unclassified 1652
82 Ga0075431_100495476 3300006847 Unclassified 1213
83 Ga0075433_10343168 3300006852 Bacteria 1320
84 Ga0075433_10693378 3300006852 Bacteria 892
85 Ga0075433_11770987 3300006852 Unclassified 531
86 Ga0075434_100012163 3300006871 Bacteria 8150
87 Ga0075434_100163757 3300006871 Bacteria 2244
88 Ga0075429_100030768 3300006880 Bacteria 4664
89 Ga0075429_100088750 3300006880 Bacteria 2695
90 Ga0075429_100565939 3300006880 Bacteria 996
91 Ga0075436_100013365 3300006914 Bacteria 5624
92 Ga0097620_100990001 3300006931 Unclassified 923
93 Ga0097620_100990437 3300006931 Bacteria 923
94 Ga0111539_10000019 3300009094 Bacteria 266927
95 Ga0111539_10000382 3300009094 Bacteria 54624
96 Ga0111539_10058171 3300009094 Bacteria 4587
97 Ga0111539_10215836 3300009094 Bacteria 2235
98 Ga0111539_10217774 3300009094 Bacteria 2224
99 Ga0114129_10001468 3300009147 Bacteria 31889
100 Ga0114129_10004447 3300009147 Bacteria 19780
101 Ga0114129_10412794 3300009147 Bacteria 1777
102 Ga0105243_10016220 3300009148 Bacteria 5636
103 Ga0105242_11872875 3300009176 Bacteria 640
104 Ga0105248_10758375 3300009177 Bacteria 1095
105 Ga0163163_11750045 3300014325 Unclassified 682
106 Ga0157380_10027726 3300014326 Bacteria 4310
107 Ga0157380_10129858 3300014326 Unclassified 2148
108 Ga0157380_10143740 3300014326 Unclassified 2053
109 Ga0157380_10672821 3300014326 Bacteria 1036
110 Ga0157380_10892592 3300014326 Bacteria 914
111 Ga0157380_12083346 3300014326 Bacteria 630
112 Ga0207697_10020760 3300025315 Bacteria 2688
113 Ga0207682_10223609 3300025893 Bacteria 871
114 Ga0207680_11255537 3300025903 Unclassified 527
115 Ga0207647_10170076 3300025904 Bacteria 1269
116 Ga0207645_10404109 3300025907 Bacteria 919
117 Ga0207705_10631943 3300025909 Bacteria 833
118 Ga0207662_10605848 3300025918 Bacteria 762
119 Ga0207649_10004473 3300025920 Bacteria 7586
120 Ga0207646_11930923 3300025922 Bacteria 502
121 Ga0207681_10004053 3300025923 Bacteria 9090
122 Ga0207681_10371247 3300025923 Bacteria 1150
123 Ga0207681_11392643 3300025923 Unclassified 589
124 Ga0207650_10478498 3300025925 Bacteria 1039
125 Ga0207659_10093954 3300025926 Bacteria 2246
126 Ga0207659_10464098 3300025926 Bacteria 1068
127 Ga0207687_10648357 3300025927 Bacteria 893
128 Ga0207706_10045496 3300025933 Bacteria 3888
129 Ga0207670_10085116 3300025936 Bacteria 2221
130 Ga0207669_10106622 3300025937 Bacteria 1867
131 Ga0207669_10672346 3300025937 Bacteria 849
132 Ga0207669_11438534 3300025937 Bacteria 587
133 Ga0207704_11750797 3300025938 Unclassified 534
134 Ga0207691_10038719 3300025940 Bacteria 4412
135 Ga0207691_10782078 3300025940 Unclassified 803
136 Ga0207711_10145693 3300025941 Bacteria 2134
137 Ga0207661_10036533 3300025944 Bacteria 3835
138 Ga0207661_11611112 3300025944 Bacteria 594
139 Ga0207679_10024498 3300025945 Bacteria 4138
140 Ga0207712_10378771 3300025961 Bacteria 1184
141 Ga0207668_11179011 3300025972 Bacteria 688
142 Ga0207640_10006353 3300025981 Bacteria 6481
143 Ga0207678_10677858 3300026067 Bacteria 906
144 Ga0207708_10002297 3300026075 Bacteria 14057
145 Ga0207708_10128013 3300026075 Bacteria 1983
146 Ga0207708_10391938 3300026075 Bacteria 1147
147 Ga0207641_10568884 3300026088 Unclassified 1107
148 Ga0207676_10143188 3300026095 Bacteria 2049
149 Ga0207676_10696798 3300026095 Bacteria 984
150 Ga0207675_100019259 3300026118 Bacteria 6368
151 Ga0207675_100097014 3300026118 Bacteria 2776
152 Ga0207675_100116651 3300026118 Bacteria 2523
153 Ga0207683_10736877 3300026121 Bacteria 914
154 Ga0207683_10767522 3300026121 Unclassified 895
155 Ga0207698_11082649 3300026142 Bacteria 814
156 Ga0207428_10000248 3300027907 Bacteria 73259
157 Ga0207428_10037167 3300027907 Bacteria 3964
158 Ga0207428_10600254 3300027907 Bacteria 793
159 Ga0268266_10225435 3300028379 Bacteria 1724
160 Ga0268265_10011661 3300028380 Bacteria 5944
161 Ga0268265_10102817 3300028380 Unclassified 2312
162 Ga0268265_10324239 3300028380 Bacteria 1396
163 Ga0268264_10697089 3300028381 Unclassified 1008
164 Ga0307408_100146655 3300031548 Bacteria 1858
165 Ga0307408_100255248 3300031548 Bacteria 1448
166 Ga0307408_100469226 3300031548 Unclassified 1095
167 Ga0307405_10141609 3300031731 Bacteria 1678
168 Ga0307412_10277003 3300031911 Bacteria 1315
169 Ga0307416_100148505 3300032002 Bacteria 2145
170 Ga0307416_100321788 3300032002 Bacteria 1549
171 Ga0307411_10222615 3300032005 Bacteria 1465
172 Ga0307415_100251491 3300032126 Bacteria 1436
173 Ga0307415_101277594 3300032126 Bacteria 694
174 Ga0395900_0012567 3300037418 Bacteria 8663
175 Ga0395898_0100434 3300037466 Bacteria 2778
176 Ga0395905_0018524 3300037471 Bacteria 6608
177 Ga0436364_1518084 3300037853 Bacteria 560
178 Ga0436365_0485201 3300039437 Bacteria 13668
179 Ga0439453_0096770 3300041408 Unclassified 654
180 Ga0439461_0010494 3300041410 Bacteria 1702
181 Ga0439431_0144135 3300041997 Bacteria 674
182 Ga0439441_020127 3300042001 Unclassified 1220
183 Ga0450908_051328 3300042184 Unclassified 718
184 Ga0439434_0148774 3300042435 Unclassified 774
185 Ga0439435_0166115 3300042436 Bacteria 715
186 Ga0439435_0226668 3300042436 Unclassified 623
187 Ga0450918_044972 3300042531 Unclassified 797
188 Ga0450893_0096134 3300042532 Unclassified 599
189 Ga0439440_0032722 3300042993 Unclassified 1236
190 Ga0451576_0665927 3300045051 Bacteria 1094
191 Ga0495644_0372074 3300046523 Bacteria 564
192 Ga0495658_0516077 3300046683 Bacteria 765
193 Ga0495669_0070474 3300046684 Bacteria 1592
194 Ga0496109_0215840 3300048912 Unclassified 1804
195 Ga0501031_0001130 3300049568 Bacteria 16222
196 Ga0501032_0042841 3300049569 Bacteria 3069
197 Ga0501032_0210545 3300049569 Bacteria 1267
198 Ga0501033_0013790 3300049570 Bacteria 6147
199 Ga0501033_0169508 3300049570 Bacteria 1568
200 Ga0501034_0025357 3300049571 Bacteria 6035
201 Ga0501034_0060297 3300049571 Bacteria 3811
202 Ga0501034_0151874 3300049571 Bacteria 2291
203 Ga0501034_0419569 3300049571 Bacteria 1259
204 Ga0501036_0003498 3300049572 Bacteria 12555
205 Ga0501036_0004780 3300049572 Bacteria 10942
206 Ga0501036_0011254 3300049572 Bacteria 7402
207 Ga0501037_0006115 3300049573 Bacteria 8794
208 Ga0501037_0011082 3300049573 Bacteria 6633
209 Ga0501037_0041365 3300049573 Bacteria 3389
210 Ga0501038_0010091 3300049574 Bacteria 8646
211 Ga0501038_0619161 3300049574 Bacteria 817
212 Ga0501039_0006730 3300049575 Bacteria 8747
213 Ga0501039_0021547 3300049575 Bacteria 4943
214 Ga0501041_0671685 3300049577 Unclassified 662
215 Ga0501042_0026332 3300049578 Bacteria 4088
216 Ga0501043_0026290 3300049579 Bacteria 4566
217 Ga0501043_0045435 3300049579 Bacteria 3454
218 Ga0501043_0049697 3300049579 Bacteria 3297
219 Ga0501043_0339241 3300049579 Unclassified 1143
220 Ga0501043_0442321 3300049579 Bacteria 978
221 Ga0501046_0001279 3300049580 Bacteria 24356
222 Ga0501046_0018414 3300049580 Bacteria 5812
223 Ga0501046_0058169 3300049580 Bacteria 3031
224 Ga0501046_0391608 3300049580 Unclassified 1004
225 Ga0501047_0000366 3300049581 Bacteria 51151
226 Ga0501047_0031698 3300049581 Bacteria 5099
227 Ga0501047_0053186 3300049581 Bacteria 3914
228 Ga0501047_0072561 3300049581 Bacteria 3313
229 Ga0501047_0273660 3300049581 Bacteria 1534
230 Ga0501048_0002700 3300049582 Bacteria 13538
231 Ga0501048_0094380 3300049582 Bacteria 2110
232 Ga0501048_0119565 3300049582 Unclassified 1861
233 Ga0501048_0182600 3300049582 Bacteria 1487
234 Ga0501048_0407302 3300049582 Bacteria 972
235 Ga0501067_0000994 3300049583 Bacteria 15226
236 Ga0501067_0254057 3300049583 Unclassified 978
237 Ga0501068_0011779 3300049584 Bacteria 4943
238 Ga0501068_0018799 3300049584 Bacteria 4004
239 Ga0501068_0155963 3300049584 Bacteria 1437
240 Ga0501068_0262733 3300049584 Bacteria 1101
241 Ga0501069_0000337 3300049585 Bacteria 21161
242 Ga0501069_0020799 3300049585 Bacteria 3558
243 Ga0501070_0066553 3300049586 Bacteria 2983
244 Ga0501071_0001471 3300049587 Bacteria 13686
245 Ga0501072_0344747 3300049588 Unclassified 1183
246 Ga0501072_0806645 3300049588 Bacteria 735
247 Ga0501073_0016208 3300049589 Bacteria 5400
248 Ga0501073_0158458 3300049589 Bacteria 1568
249 Ga0501073_0308576 3300049589 Bacteria 1091
250 Ga0501073_0868278 3300049589 Unclassified 621
251 Ga0501074_0008532 3300049590 Bacteria 7424
252 Ga0501075_0013651 3300049591 Bacteria 5802
253 Ga0501076_0087655 3300049592 Bacteria 2502
254 Ga0501076_0130362 3300049592 Bacteria 2039
255 Ga0501076_0166794 3300049592 Unclassified 1795
256 Ga0501077_0077201 3300049593 Bacteria 2110
257 Ga0501079_0003250 3300049741 Bacteria 11908
258 Ga0501079_0148989 3300049741 Bacteria 1824
259 Ga0501079_0868551 3300049741 Unclassified 710
260 Ga0501080_0008233 3300049742 Bacteria 9440
261 Ga0501080_0041472 3300049742 Bacteria 4288
262 Ga0501080_0541411 3300049742 Bacteria 1037
263 Ga0501083_0040690 3300049744 Bacteria 3154
264 Ga0501083_0080781 3300049744 Bacteria 2156
265 Ga0501083_0322527 3300049744 Unclassified 1004
266 Ga0501283_099545 3300049779 Bacteria 565
267 Ga0501035_0010994 3300049822 Bacteria 8379
268 Ga0501035_0012385 3300049822 Bacteria 7884
269 Ga0501035_0050739 3300049822 Bacteria 3717
270 Ga0501044_0021977 3300049823 Bacteria 6802
271 Ga0501044_0033988 3300049823 Bacteria 5352
272 Ga0501044_0103124 3300049823 Unclassified 2867
273 Ga0501045_0004027 3300049824 Bacteria 10126
274 Ga0501045_0107737 3300049824 Bacteria 2065
275 nmdc:mga0k408_171194_c1 3300050493 Bacteria 1294
276 nmdc:mga05p37_1224333_c1 3300050507 Unclassified 773
277 nmdc:mga05p37_240403_c1 3300050507 Bacteria 2177
278 nmdc:mga05p37_687_c1 3300050507 Bacteria 37482
279 nmdc:mga05p37_8525_c1 3300050507 Bacteria 12118
280 nmdc:mga09592_1054264_c1 3300050508 Unclassified 677
281 nmdc:mga09592_14086_c1 3300050508 Bacteria 6528
282 nmdc:mga09592_20255_c1 3300050508 Bacteria 5467
283 nmdc:mga09592_220413_c1 3300050508 Bacteria 1643
284 nmdc:mga09592_374148_c1 3300050508 Bacteria 1232
285 nmdc:mga0qj67_1009372_c1 3300050509 Bacteria 653
286 nmdc:mga0qj67_62477_c1 3300050509 Bacteria 2959
287 nmdc:mga06r32_259641_c1 3300050510 Bacteria 1725
288 nmdc:mga06r32_2906_c1 3300050510 Bacteria 15376
289 nmdc:mga06r32_73278_c1 3300050510 Bacteria 3317
290 nmdc:mga06r32_77851_c1 3300050510 Bacteria 3222
291 nmdc:mga08y16_14_c1 3300050511 Bacteria 398067
292 nmdc:mga08y16_358853_c1 3300050511 Bacteria 1496
293 nmdc:mga08y16_37089_c1 3300050511 Bacteria 3854
294 nmdc:mga08y16_492864_c1 3300050511 Bacteria 1246
295 nmdc:mga08y16_514330_c1 3300050511 Unclassified 1215
296 nmdc:mga08y16_940695_c1 3300050511 Bacteria 848
297 nmdc:mga0n895_1166034_c1 3300050512 Unclassified 745
298 nmdc:mga0n895_1518034_c1 3300050512 Bacteria 636
299 nmdc:mga0n895_4406_c1 3300050512 Bacteria 11564
300 nmdc:mga0rr50_1126497_c1 3300050513 Bacteria 667
301 nmdc:mga0a205_341083_c1 3300050515 Bacteria 1367
302 nmdc:mga0a205_512319_c1 3300050515 Bacteria 1056
303 Ga0501084_0019403 3300054114 Bacteria 5664
304 Ga0501084_0133214 3300054114 Bacteria 2092
305 Ga0501084_0332319 3300054114 Bacteria 1283
306 Ga0590071_014874 3300059421 Bacteria 1825
307 Ga0590075_000376 3300059424 Bacteria 12226
308 Ga0590077_000355 3300059426 Bacteria 12934
309 Ga0501082_0025451 3300060353 Bacteria 5099
310 Ga0501082_0061005 3300060353 Bacteria 3246
311 Ga0501081_0335324
312 Ga0065712_10089294
313 Ga0065712_10100129
314 Ga0065712_10180578
315 Ga0065707_10132875
316 Ga0070658_11346762
317 Ga0070683_100048354
318 Ga0070670_100032185
319 Ga0070670_100785755
320 Ga0070666_10021152
321 Ga0068868_100711691
322 Ga0070689_100122228
323 Ga0070661_100025411
324 Ga0070692_11039382
325 Ga0070668_100024993
326 Ga0070669_100031816
327 Ga0070675_100062269
328 Ga0070671_100134301
329 Ga0070674_100439236
330 Ga0070673_100121415
331 Ga0070673_100172028
332 Ga0070688_100059666
333 Ga0070688_100082230
334 Ga0070701_10735048
335 Ga0070705_100294049
336 Ga0070705_101021099
337 Ga0070700_100020542
338 Ga0070700_100127463
339 Ga0070700_100201355
340 Ga0070694_100033431
341 Ga0070678_100577847
342 Ga0070678_100742674
343 Ga0070678_101194599
344 Ga0070678_101866914
345 Ga0070662_100059987
346 Ga0068867_100413629
347 Ga0068867_100668322
348 Ga0070706_100388491
349 Ga0070706_100964972
350 Ga0070699_100196517
351 Ga0070684_100008951
352 Ga0070697_100029370
353 Ga0070672_100023376
354 Ga0070672_100839264
355 Ga0070686_100029331
356 Ga0070686_100533228
357 Ga0070695_100087944
358 Ga0070695_100656659
359 Ga0070696_100004628
360 Ga0070696_100221888
361 Ga0070665_100233790
362 Ga0070665_100791884
363 Ga0070664_100002625
364 Ga0068852_101023705
365 Ga0068859_100990110
366 Ga0068859_100990256
367 Ga0068864_100356007
368 Ga0068861_100020190
369 Ga0068861_100084379
370 Ga0068861_100847845
371 Ga0068861_101302298
372 Ga0068863_100719082
373 Ga0068858_100272706
374 Ga0068862_100030144
375 Ga0068862_100135914
376 Ga0068862_100326609
377 Ga0068862_101769494
378 Ga0081540_1095623
379 Ga0075367_10054989
380 Ga0075366_10011976
381 Ga0097621_100211742
382 Ga0068871_100928351
383 Ga0075428_100000376
384 Ga0075428_100062347
385 Ga0075428_100255521
386 Ga0075428_100534412
387 Ga0075430_100017845
388 Ga0075430_101177484
389 Ga0075431_100078673
390 Ga0075431_100282877
391 Ga0075431_100291190
392 Ga0075431_100495476
393 Ga0075433_10343168
394 Ga0075433_10693378
395 Ga0075433_11770987
396 Ga0075434_100012163
397 Ga0075434_100163757
398 Ga0075429_100030768
399 Ga0075429_100088750
400 Ga0075429_100565939
401 Ga0075436_100013365
402 Ga0097620_100990001
403 Ga0097620_100990437
404 Ga0111539_10000019
405 Ga0111539_10000382
406 Ga0111539_10058171
407 Ga0111539_10215836
408 Ga0111539_10217774
409 Ga0114129_10001468
410 Ga0114129_10004447
411 Ga0114129_10412794
412 Ga0105243_10016220
413 Ga0105242_11872875
414 Ga0105248_10758375
415 Ga0163163_11750045
416 Ga0157380_10027726
417 Ga0157380_10129858
418 Ga0157380_10143740
419 Ga0157380_10672821
420 Ga0157380_10892592
421 Ga0157380_12083346
422 Ga0207697_10020760
423 Ga0207682_10223609
424 Ga0207680_11255537
425 Ga0207647_10170076
426 Ga0207645_10404109
427 Ga0207705_10631943
428 Ga0207662_10605848
429 Ga0207649_10004473
430 Ga0207646_11930923
431 Ga0207681_10004053
432 Ga0207681_10371247
433 Ga0207681_11392643
434 Ga0207650_10478498
435 Ga0207659_10093954
436 Ga0207659_10464098
437 Ga0207687_10648357
438 Ga0207706_10045496
439 Ga0207670_10085116
440 Ga0207669_10106622
441 Ga0207669_10672346
442 Ga0207669_11438534
443 Ga0207704_11750797
444 Ga0207691_10038719
445 Ga0207691_10782078
446 Ga0207711_10145693
447 Ga0207661_10036533
448 Ga0207661_11611112
449 Ga0207679_10024498
450 Ga0207712_10378771
451 Ga0207668_11179011
452 Ga0207640_10006353
453 Ga0207678_10677858
454 Ga0207708_10002297
455 Ga0207708_10128013
456 Ga0207708_10391938
457 Ga0207641_10568884
458 Ga0207676_10143188
459 Ga0207676_10696798
460 Ga0207675_100019259
461 Ga0207675_100097014
462 Ga0207675_100116651
463 Ga0207683_10736877
464 Ga0207683_10767522
465 Ga0207698_11082649
466 Ga0207428_10000248
467 Ga0207428_10037167
468 Ga0207428_10600254
469 Ga0268266_10225435
470 Ga0268265_10011661
471 Ga0268265_10102817
472 Ga0268265_10324239
473 Ga0268264_10697089
474 Ga0307408_100146655
475 Ga0307408_100255248
476 Ga0307408_100469226
477 Ga0307405_10141609
478 Ga0307412_10277003
479 Ga0307416_100148505
480 Ga0307416_100321788
481 Ga0307411_10222615
482 Ga0307415_100251491
483 Ga0307415_101277594
484 Ga0395900_0012567
485 Ga0395898_0100434
486 Ga0395905_0018524
487 Ga0436364_1518084
488 Ga0436365_0485201
489 Ga0439453_0096770
490 Ga0439461_0010494
491 Ga0439431_0144135
492 Ga0439441_020127
493 Ga0450908_051328
494 Ga0439434_0148774
495 Ga0439435_0166115
496 Ga0439435_0226668
497 Ga0450918_044972
498 Ga0450893_0096134
499 Ga0439440_0032722
500 Ga0451576_0665927
501 Ga0495644_0372074
502 Ga0495658_0516077
503 Ga0495669_0070474
504 Ga0496109_0215840
505 Ga0501031_0001130
506 Ga0501032_0042841
507 Ga0501032_0210545
508 Ga0501033_0013790
509 Ga0501033_0169508
510 Ga0501034_0025357
511 Ga0501034_0060297
512 Ga0501034_0151874
513 Ga0501034_0419569
514 Ga0501036_0003498
515 Ga0501036_0004780
516 Ga0501036_0011254
517 Ga0501037_0006115
518 Ga0501037_0011082
519 Ga0501037_0041365
520 Ga0501038_0010091
521 Ga0501038_0619161
522 Ga0501039_0006730
523 Ga0501039_0021547
524 Ga0501041_0671685
525 Ga0501042_0026332
526 Ga0501043_0026290
527 Ga0501043_0045435
528 Ga0501043_0049697
529 Ga0501043_0339241
530 Ga0501043_0442321
531 Ga0501046_0001279
532 Ga0501046_0018414
533 Ga0501046_0058169
534 Ga0501046_0391608
535 Ga0501047_0000366
536 Ga0501047_0031698
537 Ga0501047_0053186
538 Ga0501047_0072561
539 Ga0501047_0273660
540 Ga0501048_0002700
541 Ga0501048_0094380
542 Ga0501048_0119565
543 Ga0501048_0182600
544 Ga0501048_0407302
545 Ga0501067_0000994
546 Ga0501067_0254057
547 Ga0501068_0011779
548 Ga0501068_0018799
549 Ga0501068_0155963
550 Ga0501068_0262733
551 Ga0501069_0000337
552 Ga0501069_0020799
553 Ga0501070_0066553
554 Ga0501071_0001471
555 Ga0501072_0344747
556 Ga0501072_0806645
557 Ga0501073_0016208
558 Ga0501073_0158458
559 Ga0501073_0308576
560 Ga0501073_0868278
561 Ga0501074_0008532
562 Ga0501075_0013651
563 Ga0501076_0087655
564 Ga0501076_0130362
565 Ga0501076_0166794
566 Ga0501077_0077201
567 Ga0501079_0003250
568 Ga0501079_0148989
569 Ga0501079_0868551
570 Ga0501080_0008233
571 Ga0501080_0041472
572 Ga0501080_0541411
573 Ga0501083_0040690
574 Ga0501083_0080781
575 Ga0501083_0322527
576 Ga0501283_099545
577 Ga0501035_0010994
578 Ga0501035_0012385
579 Ga0501035_0050739
580 Ga0501044_0021977
581 Ga0501044_0033988
582 Ga0501044_0103124
583 Ga0501045_0004027
584 Ga0501045_0107737
585 nmdc:mga0k408_171194_c1
586 nmdc:mga05p37_1224333_c1
587 nmdc:mga05p37_240403_c1
588 nmdc:mga05p37_687_c1
589 nmdc:mga05p37_8525_c1
590 nmdc:mga09592_1054264_c1
591 nmdc:mga09592_14086_c1
592 nmdc:mga09592_20255_c1
593 nmdc:mga09592_220413_c1
594 nmdc:mga09592_374148_c1
595 nmdc:mga0qj67_1009372_c1
596 nmdc:mga0qj67_62477_c1
597 nmdc:mga06r32_259641_c1
598 nmdc:mga06r32_2906_c1
599 nmdc:mga06r32_73278_c1
600 nmdc:mga06r32_77851_c1
601 nmdc:mga08y16_14_c1
602 nmdc:mga08y16_358853_c1
603 nmdc:mga08y16_37089_c1
604 nmdc:mga08y16_492864_c1
605 nmdc:mga08y16_514330_c1
606 nmdc:mga08y16_940695_c1
607 nmdc:mga0n895_1166034_c1
608 nmdc:mga0n895_1518034_c1
609 nmdc:mga0n895_4406_c1
610 nmdc:mga0rr50_1126497_c1
611 nmdc:mga0a205_341083_c1
612 nmdc:mga0a205_512319_c1
613 Ga0501084_0019403
614 Ga0501084_0133214
615 Ga0501084_0332319
616 Ga0590071_014874
617 Ga0590075_000376
618 Ga0590077_000355
619 Ga0501082_0025451
620 Ga0501082_0061005

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

76

144

0.96

PF02311

AraC_binding

AraC-like ligand binding domain

70

150

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u9e-assembly1.cif.gz_B structure of the regulatory domain of the arac family transcriptional activator rhar 0.9423 82 142
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.9303 67 141
3h8u-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution 0.9232 67 141
3h8u-assembly1.cif.gz_B crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution 0.9206 67 141
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9159 68 144
ID Description Score Start End Superfamily
af_O86372_11_115_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9146 54 144 2.60.120.10
1sfnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9124 54 145 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9088 66 143 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9082 65 140 2.60.120.10
3h8uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9078 67 141 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q5UN75-F1-model_v4 Cupin domain-containing protein 0.9767 50 143
AF-A0A858RBT1-F1-model_v4 Cupin domain-containing protein 0.9716 33 145
AF-F0BC62-F1-model_v4 Lysophospholipase L1-like esterase 0.9709 27 145 GO:0052689
AF-A0A0P6VBF6-F1-model_v4 Rhamnogalacturonan acetylesterase 0.9665 27 143 GO:0052689
AF-A0A2V7ZHL8-F1-model_v4 Cupin type-2 domain-containing protein 0.9663 63 143 GO:0046872

Map