F400828

General Info

Members Datasets Scaffolds Average Seq Length
310 160 620 189

Family's Representative Sequence

Representative Sequence 3300041453|Ga0451797_0510092|Ga0451797_0510092_123_692
Length 189
Sequence MAIHITGDERADQVLDGSSFALLIGMLLDQQYPMEHAFRGPSKILDRFGSIEPADIAAAEPESFAALCTVPPAIHRFPGSMAERTQALCAALVSDWGGDAQRLWTDGDPDGATILKRLKALPGFGEQKAKIFVALLGKQYGLTAPGWESAAGPYGEPGSHRSVADIVDASSLTKVREFKKAAKAAAKEK

Samples

Sample ID Description Type Environment
1 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
69 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
70 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
71 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
72 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
73 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
74 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
75 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
103 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
151 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
152 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
156 2643221615 Nocardioides sp. Root224 Isolate Unclassified
157 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
158 2643221696 Nocardioides sp. Root140 Isolate Unclassified
159 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
160 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0.32
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.32
Nodule 0.32
Rhizoplane 17.74
Rhizosphere 58.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451797_0510092 3300041453 Bacteria 754
2 LJQas_1002960 3300000549 Bacteria 2305
3 Ga0070683_100317419 3300005329 Bacteria 1483
4 Ga0070683_100529611 3300005329 Bacteria 1126
5 Ga0070677_10362586 3300005333 Bacteria 754
6 Ga0070682_100039369 3300005337 Bacteria 2905
7 Ga0068868_100148215 3300005338 Bacteria 1931
8 Ga0070689_100841305 3300005340 Bacteria 809
9 Ga0070687_100715464 3300005343 Bacteria 701
10 Ga0070675_100143961 3300005354 Bacteria 2039
11 Ga0070667_100092446 3300005367 Bacteria 2603
12 Ga0070700_100305997 3300005441 Bacteria 1162
13 Ga0070700_100529294 3300005441 Bacteria 912
14 Ga0070708_100199440 3300005445 Bacteria 1873
15 Ga0070678_100238724 3300005456 Bacteria 1519
16 Ga0070662_100351193 3300005457 Bacteria 1208
17 Ga0070685_10119119 3300005466 Bacteria 1637
18 Ga0070707_100689434 3300005468 Bacteria 984
19 Ga0070698_100036537 3300005471 Bacteria 5073
20 Ga0070684_100042658 3300005535 Bacteria 3917
21 Ga0070684_100731749 3300005535 Bacteria 923
22 Ga0070702_100145102 3300005615 Bacteria 1516
23 Ga0068852_100376937 3300005616 Bacteria 1391
24 Ga0068864_101027959 3300005618 Bacteria 818
25 Ga0068860_100283946 3300005843 Bacteria 1618
26 Ga0075365_10076827 3300006038 Bacteria 2255
27 Ga0075365_10095011 3300006038 Bacteria 2035
28 Ga0075365_10134558 3300006038 Bacteria 1712
29 Ga0075365_10146729 3300006038 Bacteria 1640
30 Ga0075365_10173518 3300006038 Bacteria 1505
31 Ga0075368_10001260 3300006042 Bacteria 8023
32 Ga0075368_10021024 3300006042 Bacteria 2476
33 Ga0075368_10083233 3300006042 Bacteria 1304
34 Ga0075363_100003523 3300006048 Bacteria 6677
35 Ga0075363_100003956 3300006048 Bacteria 6400
36 Ga0075363_100028215 3300006048 Bacteria 2885
37 Ga0075363_100093716 3300006048 Bacteria 1655
38 Ga0075363_100192287 3300006048 Bacteria 1164
39 Ga0075363_100205237 3300006048 Bacteria 1127
40 Ga0075364_10005015 3300006051 Bacteria 7676
41 Ga0075364_10007076 3300006051 Bacteria 6633
42 Ga0075364_10058844 3300006051 Bacteria 2519
43 Ga0075364_10096963 3300006051 Bacteria 1961
44 Ga0075364_10119491 3300006051 Bacteria 1763
45 Ga0075364_10218287 3300006051 Bacteria 1294
46 Ga0075367_10010136 3300006178 Bacteria 4942
47 Ga0075367_10057720 3300006178 Bacteria 2308
48 Ga0075367_10091329 3300006178 Bacteria 1852
49 Ga0075370_10005267 3300006353 Bacteria 6404
50 Ga0075370_10031174 3300006353 Bacteria 2976
51 Ga0075370_10128796 3300006353 Bacteria 1476
52 Ga0075370_10223010 3300006353 Bacteria 1114
53 Ga0075428_100574258 3300006844 Bacteria 1205
54 Ga0068865_101191362 3300006881 Bacteria 674
55 Ga0097620_100005537 3300006931 Bacteria 12863
56 Ga0075435_100410777 3300007076 Bacteria 1165
57 Ga0111539_10561659 3300009094 Bacteria 1329
58 Ga0111539_10969729 3300009094 Bacteria 988
59 Ga0105247_10004879 3300009101 Bacteria 8535
60 Ga0105243_10467421 3300009148 Bacteria 1187
61 Ga0105243_10569148 3300009148 Bacteria 1086
62 Ga0105243_10764415 3300009148 Bacteria 949
63 Ga0105239_10289293 3300010375 Bacteria 1845
64 Ga0105239_10413505 3300010375 Bacteria 1527
65 Ga0105246_10159429 3300011119 Bacteria 1717
66 Ga0157372_10239458 3300013307 Bacteria 2105
67 Ga0157372_10696332 3300013307 Bacteria 1182
68 Ga0157375_10112087 3300013308 Bacteria 2827
69 Ga0157375_10359944 3300013308 Bacteria 1621
70 Ga0163163_10237271 3300014325 Bacteria 1873
71 Ga0157380_10773043 3300014326 Bacteria 974
72 Ga0182008_10032878 3300014497 Bacteria 2604
73 Ga0157377_10114968 3300014745 Bacteria 1623
74 Ga0157377_10121714 3300014745 Bacteria 1582
75 Ga0163161_10042091 3300017792 Bacteria 3284
76 Ga0163161_10768025 3300017792 Bacteria 808
77 Ga0206353_10875158 3300020082 Bacteria 1054
78 Ga0207682_10251214 3300025893 Bacteria 823
79 Ga0207710_10015764 3300025900 Bacteria 3195
80 Ga0207646_10577373 3300025922 Bacteria 1010
81 Ga0207659_10292490 3300025926 Bacteria 1335
82 Ga0207709_10304399 3300025935 Bacteria 1187
83 Ga0207691_10064900 3300025940 Bacteria 3306
84 Ga0207711_10486363 3300025941 Bacteria 1150
85 Ga0207661_10171526 3300025944 Bacteria 1889
86 Ga0207661_10639881 3300025944 Bacteria 977
87 Ga0207651_10608419 3300025960 Bacteria 956
88 Ga0207678_10107909 3300026067 Bacteria 2375
89 Ga0207708_10155234 3300026075 Bacteria 1805
90 Ga0207676_10917616 3300026095 Bacteria 860
91 Ga0209813_10005739 3300027866 Bacteria 3029
92 Ga0307405_10084717 3300031731 Bacteria 2081
93 Ga0307405_10503862 3300031731 Bacteria 971
94 Ga0307406_10565781 3300031901 Bacteria 932
95 Ga0307407_10049408 3300031903 Bacteria 2400
96 Ga0307412_10043236 3300031911 Bacteria 2933
97 Ga0307409_100074688 3300031995 Bacteria 2710
98 Ga0307409_100150460 3300031995 Bacteria 2020
99 Ga0307409_100297156 3300031995 Bacteria 1500
100 Ga0307409_100582727 3300031995 Bacteria 1103
101 Ga0307409_101026334 3300031995 Bacteria 844
102 Ga0307416_100120635 3300032002 Bacteria 2335
103 Ga0307416_100218558 3300032002 Bacteria 1825
104 Ga0307416_100896415 3300032002 Bacteria 987
105 Ga0307416_101012975 3300032002 Bacteria 934
106 Ga0307414_10512964 3300032004 Bacteria 1063
107 Ga0307414_10612632 3300032004 Bacteria 978
108 Ga0307414_10766312 3300032004 Bacteria 878
109 Ga0307411_10249555 3300032005 Bacteria 1394
110 Ga0307415_100035506 3300032126 Bacteria 3256
111 Ga0307415_100062554 3300032126 Bacteria 2582
112 Ga0307415_100126334 3300032126 Bacteria 1928
113 Ga0242420_013101 3300038996 Bacteria 1410
114 Ga0439461_0016903 3300041410 Bacteria 1413
115 Ga0451849_0996326 3300041505 Bacteria 737
116 Ga0439431_0009907 3300041997 Bacteria 2157
117 Ga0439448_0044011 3300042005 Bacteria 1451
118 Ga0439449_0128981 3300042007 Bacteria 940
119 Ga0439446_0004116 3300042156 Bacteria 3666
120 Ga0439434_0008754 3300042435 Bacteria 2973
121 Ga0466965_0021768 3300044683 Bacteria 3089
122 Ga0466961_0036127 3300044693 Bacteria 3171
123 Ga0466964_0048115 3300044706 Bacteria 1743
124 Ga0466968_0074797 3300044735 Bacteria 1480
125 Ga0466970_0006578 3300044765 Bacteria 5811
126 Ga0466957_0010173 3300044842 Bacteria 5384
127 Ga0466960_0533725 3300044901 Bacteria 691
128 Ga0466967_0001727 3300045976 Bacteria 13024
129 Ga0466967_0105765 3300045976 Bacteria 2578
130 Ga0466967_0275725 3300045976 Bacteria 1612
131 Ga0495657_0130056 3300046675 Bacteria 1578
132 Ga0495674_0189650 3300047319 Bacteria 1709
133 Ga0496100_0262174 3300048903 Bacteria 1282
134 Ga0496100_0711281 3300048903 Bacteria 784
135 Ga0496101_0040865 3300048904 Bacteria 3304
136 Ga0496101_0100767 3300048904 Bacteria 2161
137 Ga0496101_0432181 3300048904 Bacteria 1038
138 Ga0496101_0934926 3300048904 Bacteria 682
139 Ga0496102_0000013 3300048905 Bacteria 311668
140 Ga0496102_0078695 3300048905 Bacteria 3035
141 Ga0496102_0078943 3300048905 Bacteria 3030
142 Ga0496102_0219294 3300048905 Bacteria 1793
143 Ga0496102_0992041 3300048905 Bacteria 760
144 Ga0496102_1173650 3300048905 Bacteria 687
145 Ga0496103_0000105 3300048906 Bacteria 92467
146 Ga0496103_0009844 3300048906 Bacteria 5661
147 Ga0496103_0239650 3300048906 Bacteria 1167
148 Ga0496103_0289037 3300048906 Bacteria 1055
149 Ga0496103_0299015 3300048906 Bacteria 1035
150 Ga0496104_0027962 3300048907 Bacteria 5222
151 Ga0496104_0509683 3300048907 Bacteria 1114
152 Ga0496104_0736778 3300048907 Bacteria 893
153 Ga0496104_1099888 3300048907 Bacteria 698
154 Ga0496105_0034670 3300048908 Bacteria 4152
155 Ga0496105_0153379 3300048908 Bacteria 1893
156 Ga0496105_0426568 3300048908 Bacteria 1049
157 Ga0496106_0064505 3300048909 Bacteria 2786
158 Ga0496106_0087691 3300048909 Bacteria 2398
159 Ga0496106_0795017 3300048909 Bacteria 750
160 Ga0496107_0141623 3300048910 Bacteria 1777
161 Ga0496108_0170607 3300048911 Bacteria 1882
162 Ga0496108_0198099 3300048911 Bacteria 1742
163 Ga0496108_0301714 3300048911 Bacteria 1395
164 Ga0496108_0673314 3300048911 Bacteria 898
165 Ga0496109_0016821 3300048912 Bacteria 6400
166 Ga0496109_0054848 3300048912 Bacteria 3635
167 Ga0496109_0062996 3300048912 Bacteria 3391
168 Ga0496109_0249100 3300048912 Bacteria 1673
169 Ga0496109_0321146 3300048912 Bacteria 1461
170 Ga0496110_0312557 3300048913 Bacteria 1431
171 Ga0496110_0547701 3300048913 Bacteria 1051
172 Ga0496110_0670031 3300048913 Bacteria 938
173 Ga0496111_0037898 3300048914 Bacteria 3451
174 Ga0496112_0052891 3300048915 Bacteria 3987
175 Ga0496112_0802621 3300048915 Bacteria 866
176 Ga0496113_0168511 3300048916 Bacteria 1734
177 Ga0496113_0595750 3300048916 Bacteria 885
178 Ga0496114_0044022 3300048917 Bacteria 3702
179 Ga0496114_0281091 3300048917 Bacteria 1467
180 Ga0496114_0322770 3300048917 Bacteria 1364
181 Ga0496114_0653502 3300048917 Bacteria 925
182 Ga0496114_0846750 3300048917 Bacteria 794
183 Ga0496114_1217166 3300048917 Bacteria 639
184 Ga0496115_0128379 3300048918 Bacteria 2089
185 Ga0496115_0215946 3300048918 Bacteria 1583
186 Ga0496115_0260188 3300048918 Bacteria 1427
187 Ga0496116_0066010 3300048919 Bacteria 2318
188 Ga0496118_0021828 3300048921 Bacteria 5619
189 Ga0496119_0039828 3300048922 Bacteria 3016
190 Ga0496124_0331973 3300048927 Bacteria 1084
191 Ga0501031_0016938 3300049568 Bacteria 4734
192 Ga0501031_0102582 3300049568 Bacteria 1867
193 Ga0501032_0069812 3300049569 Bacteria 2344
194 Ga0501033_0065092 3300049570 Bacteria 2682
195 Ga0501033_0240315 3300049570 Bacteria 1285
196 Ga0501034_0172569 3300049571 Bacteria 2129
197 Ga0501036_0011902 3300049572 Bacteria 7213
198 Ga0501036_0049615 3300049572 Bacteria 3554
199 Ga0501036_0222666 3300049572 Bacteria 1584
200 Ga0501037_0030370 3300049573 Bacteria 3994
201 Ga0501038_0131106 3300049574 Bacteria 2058
202 Ga0501039_0072492 3300049575 Bacteria 2676
203 Ga0501039_0098549 3300049575 Bacteria 2280
204 Ga0501039_0161073 3300049575 Bacteria 1764
205 Ga0501039_0608714 3300049575 Bacteria 856
206 Ga0501040_0087819 3300049576 Bacteria 2159
207 Ga0501040_0141551 3300049576 Bacteria 1695
208 Ga0501041_0037509 3300049577 Bacteria 2937
209 Ga0501042_0013512 3300049578 Bacteria 5559
210 Ga0501042_0128390 3300049578 Bacteria 1826
211 Ga0501042_0156409 3300049578 Bacteria 1644
212 Ga0501042_0209377 3300049578 Bacteria 1406
213 Ga0501046_0237301 3300049580 Bacteria 1346
214 Ga0501047_0113860 3300049581 Bacteria 2587
215 Ga0501048_0006810 3300049582 Bacteria 8680
216 Ga0501048_0101784 3300049582 Bacteria 2027
217 Ga0501048_0156307 3300049582 Bacteria 1613
218 Ga0501048_0361158 3300049582 Bacteria 1036
219 Ga0501067_0001276 3300049583 Bacteria 13677
220 Ga0501067_0041817 3300049583 Bacteria 2545
221 Ga0501067_0165633 3300049583 Bacteria 1231
222 Ga0501068_0073774 3300049584 Bacteria 2085
223 Ga0501069_0018976 3300049585 Bacteria 3714
224 Ga0501069_0038227 3300049585 Bacteria 2649
225 Ga0501069_0137282 3300049585 Bacteria 1402
226 Ga0501070_0170663 3300049586 Bacteria 1792
227 Ga0501070_0197189 3300049586 Bacteria 1653
228 Ga0501071_0040607 3300049587 Bacteria 3329
229 Ga0501071_0043271 3300049587 Bacteria 3228
230 Ga0501072_0004726 3300049588 Bacteria 10376
231 Ga0501072_0061260 3300049588 Bacteria 2967
232 Ga0501072_0154299 3300049588 Bacteria 1831
233 Ga0501072_0253642 3300049588 Bacteria 1401
234 Ga0501072_0792967 3300049588 Bacteria 742
235 Ga0501073_0098750 3300049589 Bacteria 2027
236 Ga0501074_0001216 3300049590 Bacteria 16960
237 Ga0501075_0122268 3300049591 Bacteria 1981
238 Ga0501075_0207452 3300049591 Bacteria 1495
239 Ga0501075_0214883 3300049591 Bacteria 1467
240 Ga0501075_0622147 3300049591 Bacteria 823
241 Ga0501077_0141669 3300049593 Bacteria 1525
242 Ga0501079_0020133 3300049741 Bacteria 5099
243 Ga0501079_0337784 3300049741 Bacteria 1180
244 Ga0501079_0414612 3300049741 Bacteria 1057
245 Ga0501079_0631706 3300049741 Bacteria 843
246 Ga0501079_0668764 3300049741 Bacteria 817
247 Ga0501080_0002554 3300049742 Bacteria 15934
248 Ga0501080_0245972 3300049742 Bacteria 1631
249 Ga0501081_0086614 3300049743 Bacteria 2199
250 Ga0501083_0067551 3300049744 Bacteria 2379
251 Ga0501035_0191962 3300049822 Bacteria 1756
252 Ga0501044_0423949 3300049823 Bacteria 1240
253 Ga0501045_0039865 3300049824 Bacteria 3418
254 Ga0501045_0073135 3300049824 Bacteria 2524
255 Ga0501045_0830741 3300049824 Bacteria 680
256 nmdc:mga03n38_23580_c1 3300050490 Bacteria 2506
257 nmdc:mga00v17_12444_c1 3300050491 Bacteria 4696
258 nmdc:mga00v17_52121_c1 3300050491 Bacteria 2489
259 nmdc:mga00v17_61780_c1 3300050491 Bacteria 2303
260 nmdc:mga00v17_97206_c1 3300050491 Bacteria 1856
261 nmdc:mga0yw44_13461_c1 3300050492 Bacteria 4310
262 nmdc:mga0yw44_142487_c1 3300050492 Bacteria 1558
263 nmdc:mga0yw44_153004_c1 3300050492 Bacteria 1506
264 nmdc:mga0yw44_19199_c1 3300050492 Bacteria 3764
265 nmdc:mga0yw44_208860_c1 3300050492 Bacteria 1291
266 nmdc:mga0yw44_229630_c1 3300050492 Bacteria 1231
267 nmdc:mga0yw44_397168_c1 3300050492 Bacteria 932
268 nmdc:mga0yw44_51186_c1 3300050492 Bacteria 1291
269 nmdc:mga0yw44_52130_c1 3300050492 Bacteria 2480
270 nmdc:mga0yw44_86828_c1 3300050492 Bacteria 1971
271 nmdc:mga0yw44_95819_c2 3300050492 Bacteria 1575
272 nmdc:mga06z11_103851_c1 3300050494 Bacteria 1564
273 nmdc:mga06z11_28558_c1 3300050494 Bacteria 1917
274 nmdc:mga06z11_325679_c1 3300050494 Bacteria 917
275 nmdc:mga06z11_34111_c1 3300050494 Bacteria 2496
276 nmdc:mga06z11_4471_c1 3300050494 Bacteria 5503
277 nmdc:mga04h51_106692_c1 3300050495 Bacteria 1027
278 nmdc:mga04h51_26443_c1 3300050495 Bacteria 1795
279 nmdc:mga04h51_44402_c1 3300050495 Bacteria 1465
280 nmdc:mga07m45_113391_c1 3300050496 Bacteria 1563
281 nmdc:mga07m45_13369_c1 3300050496 Bacteria 4356
282 nmdc:mga07m45_86466_c1 3300050496 Bacteria 1794
283 nmdc:mga08y16_576672_c1 3300050511 Bacteria 1136
284 nmdc:mga0rr50_396693_c1 3300050513 Bacteria 1165
285 Ga0495601_0011329 3300053077 Bacteria 5330
286 Ga0495595_0323285 3300053084 Bacteria 777
287 Ga0495619_0272124 3300053085 Bacteria 1174
288 Ga0495619_0500749 3300053085 Bacteria 835
289 Ga0500644_0000014 3300053088 Bacteria 109650
290 Ga0500644_0005585 3300053088 Bacteria 3181
291 Ga0500641_0007363 3300053096 Bacteria 3923
292 Ga0500641_0210077 3300053096 Bacteria 828
293 Ga0500556_0000329 3300053104 Bacteria 35641
294 Ga0500593_000395 3300053117 Bacteria 17370
295 Ga0500573_0013771 3300053140 Bacteria 4564
296 Ga0500573_0051859 3300053140 Bacteria 2359
297 Ga0501084_0018094 3300054114 Bacteria 5868
298 Ga0501084_0093273 3300054114 Bacteria 2528
299 Ga0501082_0013196 3300060353 Bacteria 7105
300 Ga0501082_0247717 3300060353 Bacteria 1551
301 Ga0501082_0306279 3300060353 Bacteria 1383
302 Ga0530510_0125408 3300061734 Bacteria 1887
303 Ga0530510_0199197 3300061734 Bacteria 1487
304 Ga0530510_0315232 3300061734 Bacteria 1172
305 Ga0530510_0426190 3300061734 Bacteria 1002
306 2644089485 2643221615 Bacteria 5487866
307 2644319330 2643221657 Bacteria 5490246
308 2644531665 2643221696 Bacteria 5431823
309 2855387895 2855386786 Bacteria 4752232
310 8054611107 8054609563 Bacteria 5170090
311 Ga0451797_0510092
312 LJQas_1002960
313 Ga0070683_100317419
314 Ga0070683_100529611
315 Ga0070677_10362586
316 Ga0070682_100039369
317 Ga0068868_100148215
318 Ga0070689_100841305
319 Ga0070687_100715464
320 Ga0070675_100143961
321 Ga0070667_100092446
322 Ga0070700_100305997
323 Ga0070700_100529294
324 Ga0070708_100199440
325 Ga0070678_100238724
326 Ga0070662_100351193
327 Ga0070685_10119119
328 Ga0070707_100689434
329 Ga0070698_100036537
330 Ga0070684_100042658
331 Ga0070684_100731749
332 Ga0070702_100145102
333 Ga0068852_100376937
334 Ga0068864_101027959
335 Ga0068860_100283946
336 Ga0075365_10076827
337 Ga0075365_10095011
338 Ga0075365_10134558
339 Ga0075365_10146729
340 Ga0075365_10173518
341 Ga0075368_10001260
342 Ga0075368_10021024
343 Ga0075368_10083233
344 Ga0075363_100003523
345 Ga0075363_100003956
346 Ga0075363_100028215
347 Ga0075363_100093716
348 Ga0075363_100192287
349 Ga0075363_100205237
350 Ga0075364_10005015
351 Ga0075364_10007076
352 Ga0075364_10058844
353 Ga0075364_10096963
354 Ga0075364_10119491
355 Ga0075364_10218287
356 Ga0075367_10010136
357 Ga0075367_10057720
358 Ga0075367_10091329
359 Ga0075370_10005267
360 Ga0075370_10031174
361 Ga0075370_10128796
362 Ga0075370_10223010
363 Ga0075428_100574258
364 Ga0068865_101191362
365 Ga0097620_100005537
366 Ga0075435_100410777
367 Ga0111539_10561659
368 Ga0111539_10969729
369 Ga0105247_10004879
370 Ga0105243_10467421
371 Ga0105243_10569148
372 Ga0105243_10764415
373 Ga0105239_10289293
374 Ga0105239_10413505
375 Ga0105246_10159429
376 Ga0157372_10239458
377 Ga0157372_10696332
378 Ga0157375_10112087
379 Ga0157375_10359944
380 Ga0163163_10237271
381 Ga0157380_10773043
382 Ga0182008_10032878
383 Ga0157377_10114968
384 Ga0157377_10121714
385 Ga0163161_10042091
386 Ga0163161_10768025
387 Ga0206353_10875158
388 Ga0207682_10251214
389 Ga0207710_10015764
390 Ga0207646_10577373
391 Ga0207659_10292490
392 Ga0207709_10304399
393 Ga0207691_10064900
394 Ga0207711_10486363
395 Ga0207661_10171526
396 Ga0207661_10639881
397 Ga0207651_10608419
398 Ga0207678_10107909
399 Ga0207708_10155234
400 Ga0207676_10917616
401 Ga0209813_10005739
402 Ga0307405_10084717
403 Ga0307405_10503862
404 Ga0307406_10565781
405 Ga0307407_10049408
406 Ga0307412_10043236
407 Ga0307409_100074688
408 Ga0307409_100150460
409 Ga0307409_100297156
410 Ga0307409_100582727
411 Ga0307409_101026334
412 Ga0307416_100120635
413 Ga0307416_100218558
414 Ga0307416_100896415
415 Ga0307416_101012975
416 Ga0307414_10512964
417 Ga0307414_10612632
418 Ga0307414_10766312
419 Ga0307411_10249555
420 Ga0307415_100035506
421 Ga0307415_100062554
422 Ga0307415_100126334
423 Ga0242420_013101
424 Ga0439461_0016903
425 Ga0451849_0996326
426 Ga0439431_0009907
427 Ga0439448_0044011
428 Ga0439449_0128981
429 Ga0439446_0004116
430 Ga0439434_0008754
431 Ga0466965_0021768
432 Ga0466961_0036127
433 Ga0466964_0048115
434 Ga0466968_0074797
435 Ga0466970_0006578
436 Ga0466957_0010173
437 Ga0466960_0533725
438 Ga0466967_0001727
439 Ga0466967_0105765
440 Ga0466967_0275725
441 Ga0495657_0130056
442 Ga0495674_0189650
443 Ga0496100_0262174
444 Ga0496100_0711281
445 Ga0496101_0040865
446 Ga0496101_0100767
447 Ga0496101_0432181
448 Ga0496101_0934926
449 Ga0496102_0000013
450 Ga0496102_0078695
451 Ga0496102_0078943
452 Ga0496102_0219294
453 Ga0496102_0992041
454 Ga0496102_1173650
455 Ga0496103_0000105
456 Ga0496103_0009844
457 Ga0496103_0239650
458 Ga0496103_0289037
459 Ga0496103_0299015
460 Ga0496104_0027962
461 Ga0496104_0509683
462 Ga0496104_0736778
463 Ga0496104_1099888
464 Ga0496105_0034670
465 Ga0496105_0153379
466 Ga0496105_0426568
467 Ga0496106_0064505
468 Ga0496106_0087691
469 Ga0496106_0795017
470 Ga0496107_0141623
471 Ga0496108_0170607
472 Ga0496108_0198099
473 Ga0496108_0301714
474 Ga0496108_0673314
475 Ga0496109_0016821
476 Ga0496109_0054848
477 Ga0496109_0062996
478 Ga0496109_0249100
479 Ga0496109_0321146
480 Ga0496110_0312557
481 Ga0496110_0547701
482 Ga0496110_0670031
483 Ga0496111_0037898
484 Ga0496112_0052891
485 Ga0496112_0802621
486 Ga0496113_0168511
487 Ga0496113_0595750
488 Ga0496114_0044022
489 Ga0496114_0281091
490 Ga0496114_0322770
491 Ga0496114_0653502
492 Ga0496114_0846750
493 Ga0496114_1217166
494 Ga0496115_0128379
495 Ga0496115_0215946
496 Ga0496115_0260188
497 Ga0496116_0066010
498 Ga0496118_0021828
499 Ga0496119_0039828
500 Ga0496124_0331973
501 Ga0501031_0016938
502 Ga0501031_0102582
503 Ga0501032_0069812
504 Ga0501033_0065092
505 Ga0501033_0240315
506 Ga0501034_0172569
507 Ga0501036_0011902
508 Ga0501036_0049615
509 Ga0501036_0222666
510 Ga0501037_0030370
511 Ga0501038_0131106
512 Ga0501039_0072492
513 Ga0501039_0098549
514 Ga0501039_0161073
515 Ga0501039_0608714
516 Ga0501040_0087819
517 Ga0501040_0141551
518 Ga0501041_0037509
519 Ga0501042_0013512
520 Ga0501042_0128390
521 Ga0501042_0156409
522 Ga0501042_0209377
523 Ga0501046_0237301
524 Ga0501047_0113860
525 Ga0501048_0006810
526 Ga0501048_0101784
527 Ga0501048_0156307
528 Ga0501048_0361158
529 Ga0501067_0001276
530 Ga0501067_0041817
531 Ga0501067_0165633
532 Ga0501068_0073774
533 Ga0501069_0018976
534 Ga0501069_0038227
535 Ga0501069_0137282
536 Ga0501070_0170663
537 Ga0501070_0197189
538 Ga0501071_0040607
539 Ga0501071_0043271
540 Ga0501072_0004726
541 Ga0501072_0061260
542 Ga0501072_0154299
543 Ga0501072_0253642
544 Ga0501072_0792967
545 Ga0501073_0098750
546 Ga0501074_0001216
547 Ga0501075_0122268
548 Ga0501075_0207452
549 Ga0501075_0214883
550 Ga0501075_0622147
551 Ga0501077_0141669
552 Ga0501079_0020133
553 Ga0501079_0337784
554 Ga0501079_0414612
555 Ga0501079_0631706
556 Ga0501079_0668764
557 Ga0501080_0002554
558 Ga0501080_0245972
559 Ga0501081_0086614
560 Ga0501083_0067551
561 Ga0501035_0191962
562 Ga0501044_0423949
563 Ga0501045_0039865
564 Ga0501045_0073135
565 Ga0501045_0830741
566 nmdc:mga03n38_23580_c1
567 nmdc:mga00v17_12444_c1
568 nmdc:mga00v17_52121_c1
569 nmdc:mga00v17_61780_c1
570 nmdc:mga00v17_97206_c1
571 nmdc:mga0yw44_13461_c1
572 nmdc:mga0yw44_142487_c1
573 nmdc:mga0yw44_153004_c1
574 nmdc:mga0yw44_19199_c1
575 nmdc:mga0yw44_208860_c1
576 nmdc:mga0yw44_229630_c1
577 nmdc:mga0yw44_397168_c1
578 nmdc:mga0yw44_51186_c1
579 nmdc:mga0yw44_52130_c1
580 nmdc:mga0yw44_86828_c1
581 nmdc:mga0yw44_95819_c2
582 nmdc:mga06z11_103851_c1
583 nmdc:mga06z11_28558_c1
584 nmdc:mga06z11_325679_c1
585 nmdc:mga06z11_34111_c1
586 nmdc:mga06z11_4471_c1
587 nmdc:mga04h51_106692_c1
588 nmdc:mga04h51_26443_c1
589 nmdc:mga04h51_44402_c1
590 nmdc:mga07m45_113391_c1
591 nmdc:mga07m45_13369_c1
592 nmdc:mga07m45_86466_c1
593 nmdc:mga08y16_576672_c1
594 nmdc:mga0rr50_396693_c1
595 Ga0495601_0011329
596 Ga0495595_0323285
597 Ga0495619_0272124
598 Ga0495619_0500749
599 Ga0500644_0000014
600 Ga0500644_0005585
601 Ga0500641_0007363
602 Ga0500641_0210077
603 Ga0500556_0000329
604 Ga0500593_000395
605 Ga0500573_0013771
606 Ga0500573_0051859
607 Ga0501084_0018094
608 Ga0501084_0093273
609 Ga0501082_0013196
610 Ga0501082_0247717
611 Ga0501082_0306279
612 Ga0530510_0125408
613 Ga0530510_0199197
614 Ga0530510_0315232
615 Ga0530510_0426190
616 2644089485
617 2644319330
618 2644531665
619 2855387895
620 8054611107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

24

188

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3knt-assembly1.cif.gz_A crystal structure of methanocaldococcus jannaschii 8-oxoguanine glycosylase/lyase in complex with 15mer dna containing 8-oxoguanine 0.7176 6 133
7kz1-assembly1.cif.gz_A human mbd4 glycosylase domain bound to dna containing an abasic site 0.7096 11 129
3fhf-assembly1.cif.gz_A crystal structure of methanocaldococcus jannaschii 8-oxoguanine dna glycosylase (mjogg) 0.7065 10 133
4ea4-assembly1.cif.gz_A structure of the glycosylase domain of mbd4 bound to 5hmu-containing dna 0.7058 11 132
7yho-assembly1.cif.gz_A cryoem structure of arabidopsis ros1 in complex with tg mismatch dsdna at 3.3 angstroms resolution 0.6896 5 134
ID Description Score Start End Superfamily
af_Q9SIC4_169_271_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8179 20 131 1.10.340.30
af_P95145_45_158_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8155 20 131 1.10.340.30
af_I1JZX0_85_197_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8143 20 128 1.10.340.30
4unfA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.803 19 142 1.10.340.30
af_Q58829_25_138_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8 17 128 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A542VT89-F1-model_v4 deleted 1.001 1 186
AF-A0A7Y9H4T7-F1-model_v4 Putative HhH-GPD family protein 0.9992 1 186 GO:0003824
GO:0006284
AF-A0A2P2CAC1-F1-model_v4 HhH-GPD family protein 0.9989 1 186 GO:0003824
GO:0006284
AF-A0A3G8JUX8-F1-model_v4 HhH-GPD domain-containing protein 0.9983 5 187 GO:0003824
GO:0006284
AF-A0A5M4FFT2-F1-model_v4 Fe-S cluster assembly protein HesB 0.9962 1 185 GO:0003824
GO:0006284

Map