F400807

General Info

Members Datasets Scaffolds Average Seq Length
310 188 620 99

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0101000|Ga0373955_0101000_166_468
Length 100
Sequence MLVAFSVAPVGAGESVGDVVAEAVRVVRESGLPNRTDAMFTTIEGEWDEVMAVVKRAVDVVAGAGRVSLVLKADIRPGVTDGLTTKVAHVEEYLEQHPSA

Samples

Sample ID Description Type Environment
1 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
89 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
90 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
91 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
92 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
93 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
96 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
97 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
98 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
170 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
171 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
172 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
173 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
174 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2643221604 Nocardioides sp. Root190 Isolate Unclassified
180 2643221641 Nocardioides sp. Root122 Isolate Unclassified
181 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
182 2739367898 Nocardioides sp. CF479 Isolate Unclassified
183 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
184 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
185 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
186 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
187 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
188 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.13
Metatranscriptomes 0.65
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.94
Nodule 0.32
Rhizoplane 6.13
Rhizosphere 67.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373955_0101000 3300035172 Bacteria 1656
2 Ga0006562J51391_1053531 3300003578 Bacteria 2410
3 Ga0070683_100222210 3300005329 Bacteria 1795
4 Ga0070683_100949840 3300005329 Bacteria 825
5 Ga0070680_100078056 3300005336 Bacteria 2728
6 Ga0070682_101079006 3300005337 Bacteria 671
7 Ga0070660_101315011 3300005339 Bacteria 614
8 Ga0070689_100583377 3300005340 Bacteria 967
9 Ga0070691_10094342 3300005341 Bacteria 1479
10 Ga0070668_102186670 3300005347 Bacteria 511
11 Ga0070674_101285426 3300005356 Bacteria 652
12 Ga0070674_101447214 3300005356 Bacteria 616
13 Ga0070659_100361340 3300005366 Bacteria 1220
14 Ga0070667_101965138 3300005367 Bacteria 551
15 Ga0070714_101783333 3300005435 Bacteria 601
16 Ga0070700_100705722 3300005441 Bacteria 803
17 Ga0070700_100947325 3300005441 Bacteria 704
18 Ga0070681_10013493 3300005458 Bacteria 8120
19 Ga0070707_100000374 3300005468 Bacteria 44244
20 Ga0070698_100000294 3300005471 Bacteria 50876
21 Ga0070679_100001302 3300005530 Bacteria 22036
22 Ga0070672_100842423 3300005543 Bacteria 808
23 Ga0068857_100388971 3300005577 Bacteria 1296
24 Ga0068859_100929718 3300005617 Bacteria 954
25 Ga0068864_102123292 3300005618 Bacteria 568
26 Ga0068866_10373892 3300005718 Bacteria 912
27 Ga0068861_100354100 3300005719 Bacteria 1289
28 Ga0068861_101028199 3300005719 Bacteria 788
29 Ga0068861_101795526 3300005719 Bacteria 608
30 Ga0068860_100000334 3300005843 Bacteria 63958
31 Ga0081539_10028704 3300005985 Bacteria 3494
32 Ga0075365_10020548 3300006038 Bacteria 4096
33 Ga0075365_10029957 3300006038 Bacteria 3482
34 Ga0075365_10059519 3300006038 Bacteria 2546
35 Ga0075365_10065566 3300006038 Bacteria 2434
36 Ga0075365_10070863 3300006038 Bacteria 2346
37 Ga0075365_10071208 3300006038 Bacteria 2340
38 Ga0075365_10094728 3300006038 Bacteria 2038
39 Ga0075365_10094954 3300006038 Bacteria 2036
40 Ga0075365_10106052 3300006038 Bacteria 1928
41 Ga0075365_10109799 3300006038 Bacteria 1895
42 Ga0075365_10326400 3300006038 Bacteria 1081
43 Ga0075365_10862169 3300006038 Bacteria 639
44 Ga0075368_10004865 3300006042 Bacteria 4579
45 Ga0075368_10007589 3300006042 Bacteria 3828
46 Ga0075363_100027248 3300006048 Bacteria 2928
47 Ga0075363_100121534 3300006048 Bacteria 1459
48 Ga0075363_100310954 3300006048 Bacteria 915
49 Ga0075364_10026659 3300006051 Bacteria 3688
50 Ga0075364_10038939 3300006051 Bacteria 3081
51 Ga0075364_10118325 3300006051 Bacteria 1772
52 Ga0075364_10485212 3300006051 Bacteria 845
53 Ga0075364_10497356 3300006051 Bacteria 833
54 Ga0075362_10012343 3300006177 Bacteria 3392
55 Ga0075367_10036857 3300006178 Bacteria 2838
56 Ga0075367_10476253 3300006178 Bacteria 791
57 Ga0075367_11106497 3300006178 Bacteria 507
58 Ga0075370_10005619 3300006353 Bacteria 6255
59 Ga0075370_10368964 3300006353 Bacteria 859
60 Ga0075370_10761349 3300006353 Bacteria 590
61 Ga0075434_101115006 3300006871 Bacteria 802
62 Ga0075429_101079239 3300006880 Bacteria 701
63 Ga0097620_100929771 3300006931 Bacteria 954
64 Ga0105251_10007727 3300009011 Bacteria 6564
65 Ga0105250_10020465 3300009092 Bacteria 2674
66 Ga0111539_13273662 3300009094 Bacteria 522
67 Ga0105245_11509442 3300009098 Bacteria 723
68 Ga0105243_10270742 3300009148 Bacteria 1525
69 Ga0105243_11317141 3300009148 Bacteria 740
70 Ga0105243_12199331 3300009148 Bacteria 588
71 Ga0105249_10855750 3300009553 Bacteria 975
72 Ga0105246_10858289 3300011119 Bacteria 810
73 Ga0105246_12441947 3300011119 Bacteria 513
74 Ga0157369_11811151 3300013105 Bacteria 620
75 Ga0157369_12634236 3300013105 Bacteria 508
76 Ga0157372_11868323 3300013307 Bacteria 690
77 Ga0157375_10113290 3300013308 Bacteria 2813
78 Ga0157375_10392793 3300013308 Bacteria 1554
79 Ga0163163_10978671 3300014325 Bacteria 909
80 Ga0163161_10941649 3300017792 Bacteria 734
81 Ga0206356_10286753 3300020070 Bacteria 652
82 Ga0207696_1143060 3300025711 Bacteria 640
83 Ga0207642_10242295 3300025899 Bacteria 1019
84 Ga0207688_10883009 3300025901 Bacteria 566
85 Ga0207684_10005082 3300025910 Bacteria 12263
86 Ga0207707_10075979 3300025912 Bacteria 2931
87 Ga0207662_10594270 3300025918 Bacteria 769
88 Ga0207657_10017134 3300025919 Bacteria 6959
89 Ga0207652_10038173 3300025921 Bacteria 4069
90 Ga0207646_10000314 3300025922 Bacteria 65494
91 Ga0207681_10649321 3300025923 Bacteria 875
92 Ga0207694_11153331 3300025924 Bacteria 656
93 Ga0207690_10425892 3300025932 Bacteria 1063
94 Ga0207709_10483044 3300025935 Bacteria 964
95 Ga0207669_10780686 3300025937 Bacteria 791
96 Ga0207691_10201453 3300025940 Bacteria 1732
97 Ga0207661_10073661 3300025944 Bacteria 2798
98 Ga0207661_11243527 3300025944 Bacteria 685
99 Ga0207712_10479364 3300025961 Bacteria 1060
100 Ga0207640_11901070 3300025981 Bacteria 539
101 Ga0207708_10056566 3300026075 Bacteria 2992
102 Ga0207676_10980878 3300026095 Bacteria 832
103 Ga0207674_10515106 3300026116 Bacteria 1155
104 Ga0207675_100113481 3300026118 Bacteria 2559
105 Ga0207675_101752879 3300026118 Bacteria 640
106 Ga0207698_12740072 3300026142 Bacteria 501
107 Ga0209813_10115620 3300027866 Bacteria 929
108 Ga0207428_10712401 3300027907 Bacteria 717
109 Ga0268265_11585689 3300028380 Bacteria 659
110 Ga0268264_10002232 3300028381 Bacteria 17182
111 Ga0268264_12425396 3300028381 Bacteria 530
112 Ga0316178_1124893 3300030735 Bacteria 524
113 Ga0307408_100233997 3300031548 Bacteria 1506
114 Ga0307405_10267096 3300031731 Bacteria 1281
115 Ga0307413_10901592 3300031824 Bacteria 751
116 Ga0307410_10154722 3300031852 Bacteria 1711
117 Ga0307406_10178383 3300031901 Bacteria 1544
118 Ga0307412_11392079 3300031911 Bacteria 634
119 Ga0307409_100032523 3300031995 Bacteria 3783
120 Ga0307409_100081582 3300031995 Bacteria 2615
121 Ga0307414_11010139 3300032004 Bacteria 766
122 Ga0307415_100935141 3300032126 Bacteria 801
123 Ga0373927_1184831 3300035695 Bacteria 504
124 Ga0451789_0084063 3300041443 Bacteria 1020
125 Ga0451791_0253387 3300041451 Bacteria 853
126 Ga0451791_1397787 3300041451 Bacteria 964
127 Ga0451793_1779462 3300041452 Bacteria 679
128 Ga0451795_1091084 3300041456 Bacteria 698
129 Ga0451802_1916723 3300041460 Bacteria 536
130 Ga0451835_1177808 3300041492 Bacteria 913
131 Ga0451853_3785054 3300041512 Bacteria 568
132 Ga0439448_0223566 3300042005 Bacteria 662
133 Ga0439432_153719 3300042006 Bacteria 675
134 Ga0450900_026876 3300042136 Bacteria 824
135 Ga0450907_096382 3300042146 Bacteria 515
136 Ga0466972_0024272 3300044658 Bacteria 3009
137 Ga0466965_0003461 3300044683 Bacteria 6923
138 Ga0466965_0133919 3300044683 Bacteria 1286
139 Ga0466965_0324861 3300044683 Bacteria 839
140 Ga0466966_0012584 3300044684 Bacteria 5607
141 Ga0466966_0043740 3300044684 Bacteria 2869
142 Ga0466966_0409082 3300044684 Bacteria 815
143 Ga0466961_0008532 3300044693 Bacteria 6527
144 Ga0466961_0060207 3300044693 Bacteria 2414
145 Ga0466961_0093991 3300044693 Bacteria 1892
146 Ga0466963_0046324 3300044694 Bacteria 2867
147 Ga0466963_0306962 3300044694 Bacteria 1116
148 Ga0466964_0024318 3300044706 Bacteria 2360
149 Ga0466971_0161634 3300044719 Bacteria 1048
150 Ga0466971_0546507 3300044719 Bacteria 574
151 Ga0466968_0319248 3300044735 Bacteria 750
152 Ga0466970_0091858 3300044765 Bacteria 1648
153 Ga0466970_0223260 3300044765 Bacteria 1052
154 Ga0466970_0838282 3300044765 Bacteria 539
155 Ga0466957_0011763 3300044842 Bacteria 5059
156 Ga0466957_0030084 3300044842 Bacteria 3241
157 Ga0466957_0067576 3300044842 Bacteria 2205
158 Ga0466960_0000109 3300044901 Bacteria 27594
159 Ga0466960_0000932 3300044901 Bacteria 10337
160 Ga0466960_0066707 3300044901 Bacteria 1780
161 Ga0466960_0276333 3300044901 Bacteria 940
162 Ga0466958_0016877 3300045836 Bacteria 4213
163 Ga0466958_0315777 3300045836 Bacteria 1004
164 Ga0466958_0340787 3300045836 Bacteria 964
165 Ga0466967_0036719 3300045976 Bacteria 4185
166 Ga0466967_0832320 3300045976 Bacteria 917
167 Ga0466967_2090061 3300045976 Bacteria 563
168 Ga0466967_2490637 3300045976 Bacteria 512
169 Ga0495603_0122228 3300046455 Bacteria 1517
170 Ga0495580_0365854 3300046472 Bacteria 975
171 Ga0495596_0411215 3300046500 Bacteria 527
172 Ga0495665_0029007 3300046531 Bacteria 2965
173 Ga0495634_0414224 3300046642 Bacteria 799
174 Ga0495581_0024578 3300047315 Bacteria 3492
175 Ga0495581_0859512 3300047315 Bacteria 519
176 Ga0496101_0963908 3300048904 Bacteria 671
177 Ga0496102_0322961 3300048905 Bacteria 1454
178 Ga0496103_0617640 3300048906 Bacteria 690
179 Ga0496108_0774446 3300048911 Bacteria 829
180 Ga0496108_1093028 3300048911 Bacteria 678
181 Ga0496109_0228729 3300048912 Bacteria 1749
182 Ga0496109_0901241 3300048912 Bacteria 822
183 Ga0496110_0903096 3300048913 Bacteria 789
184 Ga0496110_1041024 3300048913 Bacteria 726
185 Ga0496112_0281514 3300048915 Bacteria 1610
186 Ga0496113_0017174 3300048916 Bacteria 5018
187 Ga0496114_0009990 3300048917 Bacteria 7546
188 Ga0496114_0475152 3300048917 Bacteria 1106
189 Ga0496124_0625926 3300048927 Bacteria 695
190 Ga0496126_0746365 3300048929 Bacteria 756
191 Ga0501031_0111592 3300049568 Bacteria 1786
192 Ga0501031_0375923 3300049568 Bacteria 919
193 Ga0501031_0785454 3300049568 Bacteria 611
194 Ga0501032_0526698 3300049569 Bacteria 754
195 Ga0501033_1163434 3300049570 Bacteria 512
196 Ga0501034_0546761 3300049571 Bacteria 1068
197 Ga0501036_0174265 3300049572 Bacteria 1812
198 Ga0501036_1200838 3300049572 Bacteria 618
199 Ga0501037_0797395 3300049573 Bacteria 624
200 Ga0501037_0987532 3300049573 Bacteria 549
201 Ga0501038_0673836 3300049574 Bacteria 777
202 Ga0501038_1286144 3300049574 Bacteria 529
203 Ga0501039_0102351 3300049575 Bacteria 2235
204 Ga0501039_1093286 3300049575 Bacteria 618
205 Ga0501040_0106352 3300049576 Bacteria 1961
206 Ga0501040_0169646 3300049576 Bacteria 1545
207 Ga0501040_0479029 3300049576 Bacteria 897
208 Ga0501041_0302328 3300049577 Bacteria 1008
209 Ga0501041_0585181 3300049577 Bacteria 712
210 Ga0501041_0703950 3300049577 Bacteria 646
211 Ga0501042_0388764 3300049578 Bacteria 1010
212 Ga0501042_0782189 3300049578 Bacteria 694
213 Ga0501046_0964015 3300049580 Bacteria 593
214 Ga0501048_0074408 3300049582 Bacteria 2397
215 Ga0501048_1314071 3300049582 Bacteria 520
216 Ga0501067_0220613 3300049583 Bacteria 1056
217 Ga0501067_0292001 3300049583 Bacteria 908
218 Ga0501068_0090439 3300049584 Bacteria 1888
219 Ga0501069_0268619 3300049585 Bacteria 997
220 Ga0501069_0399087 3300049585 Bacteria 814
221 Ga0501069_0918831 3300049585 Bacteria 533
222 Ga0501070_0433309 3300049586 Bacteria 1061
223 Ga0501071_0137886 3300049587 Bacteria 1816
224 Ga0501071_0171468 3300049587 Bacteria 1624
225 Ga0501071_0195180 3300049587 Bacteria 1519
226 Ga0501071_1273002 3300049587 Bacteria 568
227 Ga0501071_1334005 3300049587 Bacteria 554
228 Ga0501071_1356554 3300049587 Bacteria 549
229 Ga0501072_0139902 3300049588 Bacteria 1930
230 Ga0501072_0599798 3300049588 Bacteria 868
231 Ga0501073_0707706 3300049589 Bacteria 695
232 Ga0501074_0655649 3300049590 Bacteria 741
233 Ga0501075_0251455 3300049591 Bacteria 1347
234 Ga0501075_0760725 3300049591 Bacteria 737
235 Ga0501075_1315905 3300049591 Bacteria 548
236 Ga0501076_0091215 3300049592 Bacteria 2451
237 Ga0501076_0169026 3300049592 Bacteria 1782
238 Ga0501076_0311391 3300049592 Bacteria 1291
239 Ga0501076_0625195 3300049592 Bacteria 888
240 Ga0501079_0348576 3300049741 Bacteria 1160
241 Ga0501079_1313530 3300049741 Bacteria 569
242 Ga0501080_0796946 3300049742 Bacteria 829
243 Ga0501080_1008997 3300049742 Bacteria 722
244 Ga0501081_0138262 3300049743 Bacteria 1745
245 Ga0501081_0935699 3300049743 Bacteria 654
246 Ga0501083_0903410 3300049744 Bacteria 575
247 Ga0501035_0939320 3300049822 Bacteria 683
248 Ga0501044_0618651 3300049823 Bacteria 975
249 Ga0501045_0144267 3300049824 Bacteria 1771
250 Ga0501045_0489810 3300049824 Bacteria 913
251 Ga0501045_0563147 3300049824 Bacteria 845
252 nmdc:mga03683_34104_c1 3300050489 Bacteria 2058
253 nmdc:mga03n38_13910_c1 3300050490 Bacteria 3071
254 nmdc:mga03n38_47537_c1 3300050490 Bacteria 1899
255 nmdc:mga03n38_59501_c1 3300050490 Bacteria 1734
256 nmdc:mga03n38_806466_c1 3300050490 Bacteria 547
257 nmdc:mga00v17_203297_c1 3300050491 Bacteria 1281
258 nmdc:mga00v17_221655_c1 3300050491 Bacteria 1224
259 nmdc:mga00v17_41477_c1 3300050491 Bacteria 2765
260 nmdc:mga00v17_618213_c1 3300050491 Bacteria 698
261 nmdc:mga00v17_620255_c1 3300050491 Bacteria 697
262 nmdc:mga0yw44_1497_c1 3300050492 Bacteria 9314
263 nmdc:mga0yw44_22178_c1 3300050492 Bacteria 3556
264 nmdc:mga0yw44_226122_c1 3300050492 Bacteria 1241
265 nmdc:mga0yw44_32008_c1 3300050492 Bacteria 3062
266 nmdc:mga0yw44_51115_c1 3300050492 Bacteria 2502
267 nmdc:mga0yw44_63538_c1 3300050492 Bacteria 2270
268 nmdc:mga0yw44_684875_c1 3300050492 Bacteria 697
269 nmdc:mga0yw44_726427_c1 3300050492 Bacteria 675
270 nmdc:mga0yw44_78275_c1 3300050492 Bacteria 2067
271 nmdc:mga0yw44_799120_c1 3300050492 Bacteria 641
272 nmdc:mga0yw44_811177_c1 3300050492 Bacteria 635
273 nmdc:mga0yw44_816191_c1 3300050492 Bacteria 633
274 nmdc:mga0yw44_836393_c1 3300050492 Bacteria 625
275 nmdc:mga06z11_114238_c1 3300050494 Bacteria 1499
276 nmdc:mga06z11_230899_c1 3300050494 Bacteria 1084
277 nmdc:mga06z11_86277_c1 3300050494 Bacteria 1695
278 nmdc:mga04h51_100873_c1 3300050495 Bacteria 1052
279 nmdc:mga04h51_14623_c1 3300050495 Bacteria 2247
280 nmdc:mga07m45_294800_c1 3300050496 Bacteria 943
281 nmdc:mga07m45_32510_c1 3300050496 Bacteria 2893
282 nmdc:mga07m45_44789_c1 3300050496 Bacteria 2483
283 nmdc:mga07m45_70172_c1 3300050496 Bacteria 1993
284 nmdc:mga09592_1158530_c1 3300050508 Bacteria 640
285 nmdc:mga0n895_1342357_c1 3300050512 Bacteria 685
286 Ga0495601_0781213 3300053077 Bacteria 607
287 Ga0500644_0010491 3300053088 Bacteria 2510
288 Ga0500641_0006647 3300053096 Bacteria 4106
289 Ga0500562_021485 3300053108 Bacteria 1680
290 Ga0500593_000564 3300053117 Bacteria 14339
291 Ga0500573_0201175 3300053140 Bacteria 1057
292 Ga0500604_0067812 3300053151 Bacteria 1133
293 Ga0501084_0146514 3300054114 Bacteria 1989
294 Ga0501084_0270927 3300054114 Bacteria 1433
295 Ga0501082_0132199 3300060353 Bacteria 2165
296 Ga0501082_0796085 3300060353 Bacteria 827
297 Ga0466962_0056313 3300061719 Bacteria 1878
298 Ga0466962_0114873 3300061719 Bacteria 1297
299 Ga0466962_0666018 3300061719 Bacteria 533
300 Ga0530510_0653898 3300061734 Bacteria 800
301 2644034425 2643221604 Bacteria 5014917
302 2644230313 2643221641 Bacteria 4490190
303 2676494769 2675903060 Bacteria 10051191
304 2740169014 2739367898 Bacteria 4367674
305 2870726877 2870721527 Bacteria 9689237
306 2884695560 2884693830 Bacteria 11273186
307 2895445733 2895442618 Bacteria 11027144
308 2929225052 2929219909 Bacteria 6984360
309 8047715420 8047710418 Bacteria 11023148
310 8054611155 8054609563 Bacteria 5170090
311 Ga0373955_0101000
312 Ga0006562J51391_1053531
313 Ga0070683_100222210
314 Ga0070683_100949840
315 Ga0070680_100078056
316 Ga0070682_101079006
317 Ga0070660_101315011
318 Ga0070689_100583377
319 Ga0070691_10094342
320 Ga0070668_102186670
321 Ga0070674_101285426
322 Ga0070674_101447214
323 Ga0070659_100361340
324 Ga0070667_101965138
325 Ga0070714_101783333
326 Ga0070700_100705722
327 Ga0070700_100947325
328 Ga0070681_10013493
329 Ga0070707_100000374
330 Ga0070698_100000294
331 Ga0070679_100001302
332 Ga0070672_100842423
333 Ga0068857_100388971
334 Ga0068859_100929718
335 Ga0068864_102123292
336 Ga0068866_10373892
337 Ga0068861_100354100
338 Ga0068861_101028199
339 Ga0068861_101795526
340 Ga0068860_100000334
341 Ga0081539_10028704
342 Ga0075365_10020548
343 Ga0075365_10029957
344 Ga0075365_10059519
345 Ga0075365_10065566
346 Ga0075365_10070863
347 Ga0075365_10071208
348 Ga0075365_10094728
349 Ga0075365_10094954
350 Ga0075365_10106052
351 Ga0075365_10109799
352 Ga0075365_10326400
353 Ga0075365_10862169
354 Ga0075368_10004865
355 Ga0075368_10007589
356 Ga0075363_100027248
357 Ga0075363_100121534
358 Ga0075363_100310954
359 Ga0075364_10026659
360 Ga0075364_10038939
361 Ga0075364_10118325
362 Ga0075364_10485212
363 Ga0075364_10497356
364 Ga0075362_10012343
365 Ga0075367_10036857
366 Ga0075367_10476253
367 Ga0075367_11106497
368 Ga0075370_10005619
369 Ga0075370_10368964
370 Ga0075370_10761349
371 Ga0075434_101115006
372 Ga0075429_101079239
373 Ga0097620_100929771
374 Ga0105251_10007727
375 Ga0105250_10020465
376 Ga0111539_13273662
377 Ga0105245_11509442
378 Ga0105243_10270742
379 Ga0105243_11317141
380 Ga0105243_12199331
381 Ga0105249_10855750
382 Ga0105246_10858289
383 Ga0105246_12441947
384 Ga0157369_11811151
385 Ga0157369_12634236
386 Ga0157372_11868323
387 Ga0157375_10113290
388 Ga0157375_10392793
389 Ga0163163_10978671
390 Ga0163161_10941649
391 Ga0206356_10286753
392 Ga0207696_1143060
393 Ga0207642_10242295
394 Ga0207688_10883009
395 Ga0207684_10005082
396 Ga0207707_10075979
397 Ga0207662_10594270
398 Ga0207657_10017134
399 Ga0207652_10038173
400 Ga0207646_10000314
401 Ga0207681_10649321
402 Ga0207694_11153331
403 Ga0207690_10425892
404 Ga0207709_10483044
405 Ga0207669_10780686
406 Ga0207691_10201453
407 Ga0207661_10073661
408 Ga0207661_11243527
409 Ga0207712_10479364
410 Ga0207640_11901070
411 Ga0207708_10056566
412 Ga0207676_10980878
413 Ga0207674_10515106
414 Ga0207675_100113481
415 Ga0207675_101752879
416 Ga0207698_12740072
417 Ga0209813_10115620
418 Ga0207428_10712401
419 Ga0268265_11585689
420 Ga0268264_10002232
421 Ga0268264_12425396
422 Ga0316178_1124893
423 Ga0307408_100233997
424 Ga0307405_10267096
425 Ga0307413_10901592
426 Ga0307410_10154722
427 Ga0307406_10178383
428 Ga0307412_11392079
429 Ga0307409_100032523
430 Ga0307409_100081582
431 Ga0307414_11010139
432 Ga0307415_100935141
433 Ga0373927_1184831
434 Ga0451789_0084063
435 Ga0451791_0253387
436 Ga0451791_1397787
437 Ga0451793_1779462
438 Ga0451795_1091084
439 Ga0451802_1916723
440 Ga0451835_1177808
441 Ga0451853_3785054
442 Ga0439448_0223566
443 Ga0439432_153719
444 Ga0450900_026876
445 Ga0450907_096382
446 Ga0466972_0024272
447 Ga0466965_0003461
448 Ga0466965_0133919
449 Ga0466965_0324861
450 Ga0466966_0012584
451 Ga0466966_0043740
452 Ga0466966_0409082
453 Ga0466961_0008532
454 Ga0466961_0060207
455 Ga0466961_0093991
456 Ga0466963_0046324
457 Ga0466963_0306962
458 Ga0466964_0024318
459 Ga0466971_0161634
460 Ga0466971_0546507
461 Ga0466968_0319248
462 Ga0466970_0091858
463 Ga0466970_0223260
464 Ga0466970_0838282
465 Ga0466957_0011763
466 Ga0466957_0030084
467 Ga0466957_0067576
468 Ga0466960_0000109
469 Ga0466960_0000932
470 Ga0466960_0066707
471 Ga0466960_0276333
472 Ga0466958_0016877
473 Ga0466958_0315777
474 Ga0466958_0340787
475 Ga0466967_0036719
476 Ga0466967_0832320
477 Ga0466967_2090061
478 Ga0466967_2490637
479 Ga0495603_0122228
480 Ga0495580_0365854
481 Ga0495596_0411215
482 Ga0495665_0029007
483 Ga0495634_0414224
484 Ga0495581_0024578
485 Ga0495581_0859512
486 Ga0496101_0963908
487 Ga0496102_0322961
488 Ga0496103_0617640
489 Ga0496108_0774446
490 Ga0496108_1093028
491 Ga0496109_0228729
492 Ga0496109_0901241
493 Ga0496110_0903096
494 Ga0496110_1041024
495 Ga0496112_0281514
496 Ga0496113_0017174
497 Ga0496114_0009990
498 Ga0496114_0475152
499 Ga0496124_0625926
500 Ga0496126_0746365
501 Ga0501031_0111592
502 Ga0501031_0375923
503 Ga0501031_0785454
504 Ga0501032_0526698
505 Ga0501033_1163434
506 Ga0501034_0546761
507 Ga0501036_0174265
508 Ga0501036_1200838
509 Ga0501037_0797395
510 Ga0501037_0987532
511 Ga0501038_0673836
512 Ga0501038_1286144
513 Ga0501039_0102351
514 Ga0501039_1093286
515 Ga0501040_0106352
516 Ga0501040_0169646
517 Ga0501040_0479029
518 Ga0501041_0302328
519 Ga0501041_0585181
520 Ga0501041_0703950
521 Ga0501042_0388764
522 Ga0501042_0782189
523 Ga0501046_0964015
524 Ga0501048_0074408
525 Ga0501048_1314071
526 Ga0501067_0220613
527 Ga0501067_0292001
528 Ga0501068_0090439
529 Ga0501069_0268619
530 Ga0501069_0399087
531 Ga0501069_0918831
532 Ga0501070_0433309
533 Ga0501071_0137886
534 Ga0501071_0171468
535 Ga0501071_0195180
536 Ga0501071_1273002
537 Ga0501071_1334005
538 Ga0501071_1356554
539 Ga0501072_0139902
540 Ga0501072_0599798
541 Ga0501073_0707706
542 Ga0501074_0655649
543 Ga0501075_0251455
544 Ga0501075_0760725
545 Ga0501075_1315905
546 Ga0501076_0091215
547 Ga0501076_0169026
548 Ga0501076_0311391
549 Ga0501076_0625195
550 Ga0501079_0348576
551 Ga0501079_1313530
552 Ga0501080_0796946
553 Ga0501080_1008997
554 Ga0501081_0138262
555 Ga0501081_0935699
556 Ga0501083_0903410
557 Ga0501035_0939320
558 Ga0501044_0618651
559 Ga0501045_0144267
560 Ga0501045_0489810
561 Ga0501045_0563147
562 nmdc:mga03683_34104_c1
563 nmdc:mga03n38_13910_c1
564 nmdc:mga03n38_47537_c1
565 nmdc:mga03n38_59501_c1
566 nmdc:mga03n38_806466_c1
567 nmdc:mga00v17_203297_c1
568 nmdc:mga00v17_221655_c1
569 nmdc:mga00v17_41477_c1
570 nmdc:mga00v17_618213_c1
571 nmdc:mga00v17_620255_c1
572 nmdc:mga0yw44_1497_c1
573 nmdc:mga0yw44_22178_c1
574 nmdc:mga0yw44_226122_c1
575 nmdc:mga0yw44_32008_c1
576 nmdc:mga0yw44_51115_c1
577 nmdc:mga0yw44_63538_c1
578 nmdc:mga0yw44_684875_c1
579 nmdc:mga0yw44_726427_c1
580 nmdc:mga0yw44_78275_c1
581 nmdc:mga0yw44_799120_c1
582 nmdc:mga0yw44_811177_c1
583 nmdc:mga0yw44_816191_c1
584 nmdc:mga0yw44_836393_c1
585 nmdc:mga06z11_114238_c1
586 nmdc:mga06z11_230899_c1
587 nmdc:mga06z11_86277_c1
588 nmdc:mga04h51_100873_c1
589 nmdc:mga04h51_14623_c1
590 nmdc:mga07m45_294800_c1
591 nmdc:mga07m45_32510_c1
592 nmdc:mga07m45_44789_c1
593 nmdc:mga07m45_70172_c1
594 nmdc:mga09592_1158530_c1
595 nmdc:mga0n895_1342357_c1
596 Ga0495601_0781213
597 Ga0500644_0010491
598 Ga0500641_0006647
599 Ga0500562_021485
600 Ga0500593_000564
601 Ga0500573_0201175
602 Ga0500604_0067812
603 Ga0501084_0146514
604 Ga0501084_0270927
605 Ga0501082_0132199
606 Ga0501082_0796085
607 Ga0466962_0056313
608 Ga0466962_0114873
609 Ga0466962_0666018
610 Ga0530510_0653898
611 2644034425
612 2644230313
613 2676494769
614 2740169014
615 2870726877
616 2884695560
617 2895445733
618 2929225052
619 8047715420
620 8054611155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01910

Thiamine_BP

Thiamine-binding protein

3

91

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sbr-assembly1.cif.gz_B the structure and function of b. subtilis ykof gene product: the complex with thiamin 0.9207 2 74
1sbr-assembly1.cif.gz_A the structure and function of b. subtilis ykof gene product: the complex with thiamin 0.918 2 74
1s7h-assembly2.cif.gz_D structural genomics, 2.2a crystal structure of protein ykof from bacillus subtilis 0.9172 2 74
1s99-assembly1.cif.gz_B the structure and function of b. subtilis ykof gene product: ligand free protein 0.9164 2 74
1s7h-assembly1.cif.gz_B structural genomics, 2.2a crystal structure of protein ykof from bacillus subtilis 0.9146 2 74
ID Description Score Start End Superfamily
2iboA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8167 2 89 3.30.70.930
2ekyH00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7985 2 94 3.30.70.930
1yqhB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.797 2 87 3.30.70.930
af_Q2FZ03_3_97_3.30.70.930 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7907 2 89 3.30.70.930
1lxnD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7834 1 96 3.30.70.930
ID Description Score Start End GO Terms
AF-A0A7Y5WLM5-F1-model_v4 Thiamine-binding protein 0.9842 1 71 GO:0005829
AF-A0A3M0XYJ3-F1-model_v4 Thiamine-binding protein 0.9536 1 73 GO:0005829
AF-A0A7C4MUM7-F1-model_v4 Thiamine-binding protein 0.9499 1 63 GO:0005829
AF-A0A7Y5WLM5-F1-model_v4 Thiamine-binding protein 0.9448 1 71 GO:0005829
AF-A0A7V3K324-F1-model_v4 Thiamine-binding protein 0.9243 2 75 GO:0005829

Map