F400747

General Info

Members Datasets Scaffolds Average Seq Length
310 214 620 236

Family's Representative Sequence

Representative Sequence 3300025905|Ga0207685_10159222|Ga0207685_101592221
Length 283
Sequence MKKISVFVVAALFLATYSFADNKKEVDRVENAGKVMSEILNVPEDIPQDLLDKADCVIVLPSVVKAAFIVGGSYGRGVMTCRSGENFSGKWGAPTMIALEGGSFGLQIGGQATDFVLLVMNDRGAQGILTSKVKLGADASAAAGPKGREVSAATDATMRAEILSYSRARGVFAGVSLEGSTLRPDNDGNKNLYGKELPAKDIVLKGAVETLNKKYEFQLKKVATGLGPSDQMTFYEKKIPVFFFFTARDHEKLIHRPKPGHDNATPAGNAVAAWALARLSASP

Samples

Sample ID Description Type Environment
1 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
85 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
86 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
87 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 2.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 2.26
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 22.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207685_10159222 3300025905 Bacteria 1029
2 MBSR1b_contig_11273090 2162886012 Bacteria 1234
3 LJNas_1000077 3300000546 Bacteria 13932
4 Ga0065712_10087576 3300005290 Unclassified 2568
5 Ga0065712_10100695 3300005290 Bacteria 2055
6 Ga0065712_10188835 3300005290 Bacteria 1157
7 Ga0065715_10041627 3300005293 Bacteria 1173
8 Ga0065715_10109209 3300005293 Bacteria 2679
9 Ga0065715_10235974 3300005293 Unclassified 1216
10 Ga0065707_10203575 3300005295 Bacteria 1299
11 Ga0070676_10137075 3300005328 Bacteria 1554
12 Ga0070683_100003308 3300005329 Bacteria 13037
13 Ga0070690_100098459 3300005330 Unclassified 1935
14 Ga0070670_100048814 3300005331 Bacteria 3641
15 Ga0070670_100532872 3300005331 Bacteria 1046
16 Ga0068869_100011622 3300005334 Bacteria 5782
17 Ga0068869_100016187 3300005334 Bacteria 5021
18 Ga0070666_10045355 3300005335 Bacteria 2946
19 Ga0070680_100490314 3300005336 Bacteria 1051
20 Ga0070687_100043821 3300005343 Bacteria 2276
21 Ga0070669_100195823 3300005353 Bacteria 1587
22 Ga0070675_100085079 3300005354 Bacteria 2642
23 Ga0070671_100085535 3300005355 Bacteria 2638
24 Ga0070671_100138308 3300005355 Bacteria 2054
25 Ga0070674_100029237 3300005356 Bacteria 3627
26 Ga0070674_100029489 3300005356 Bacteria 3615
27 Ga0070674_100139955 3300005356 Bacteria 1815
28 Ga0070673_100026400 3300005364 Bacteria 4289
29 Ga0070659_100459827 3300005366 Bacteria 1081
30 Ga0070667_100272855 3300005367 Bacteria 1517
31 Ga0070667_100321059 3300005367 Bacteria 1397
32 Ga0070714_100070499 3300005435 Bacteria 3021
33 Ga0070714_100217158 3300005435 Bacteria 1756
34 Ga0070713_100123094 3300005436 Bacteria 2277
35 Ga0070701_10009569 3300005438 Bacteria 4249
36 Ga0070711_100075072 3300005439 Bacteria 2393
37 Ga0070711_100095160 3300005439 Bacteria 2155
38 Ga0070700_100343156 3300005441 Bacteria 1104
39 Ga0070694_100911682 3300005444 Unclassified 726
40 Ga0070708_100105414 3300005445 Unclassified 2586
41 Ga0070708_100216522 3300005445 Unclassified 1795
42 Ga0070663_100028588 3300005455 Bacteria 3798
43 Ga0070678_100076521 3300005456 Bacteria 2521
44 Ga0070662_100130181 3300005457 Bacteria 1939
45 Ga0068867_100055567 3300005459 Unclassified 2928
46 Ga0070706_100013217 3300005467 Bacteria 7638
47 Ga0070706_100247791 3300005467 Unclassified 1663
48 Ga0070707_100135530 3300005468 Bacteria 2395
49 Ga0070707_100307165 3300005468 Unclassified 1541
50 Ga0070698_100002613 3300005471 Bacteria 19844
51 Ga0070698_100057266 3300005471 Bacteria 3944
52 Ga0070698_100441639 3300005471 Unclassified 1236
53 Ga0070698_100452803 3300005471 Unclassified 1219
54 Ga0070699_100067777 3300005518 Bacteria 3099
55 Ga0070699_100108986 3300005518 Bacteria 2430
56 Ga0070699_100155666 3300005518 Bacteria 2022
57 Ga0070699_100319322 3300005518 Unclassified 1395
58 Ga0070684_100001961 3300005535 Bacteria 15114
59 Ga0070697_100006588 3300005536 Bacteria 9003
60 Ga0070697_100055639 3300005536 Bacteria 3217
61 Ga0070697_100431493 3300005536 Bacteria 1146
62 Ga0070672_100032958 3300005543 Bacteria 3918
63 Ga0070672_100047243 3300005543 Bacteria 3339
64 Ga0070686_100437765 3300005544 Bacteria 1002
65 Ga0070695_100193976 3300005545 Bacteria 1447
66 Ga0070696_100150858 3300005546 Bacteria 1706
67 Ga0070693_100005354 3300005547 Bacteria 6152
68 Ga0070693_100045971 3300005547 Bacteria 2477
69 Ga0070704_100010470 3300005549 Bacteria 5644
70 Ga0070664_100000447 3300005564 Bacteria 31176
71 Ga0070664_100197569 3300005564 Unclassified 1793
72 Ga0070702_100126951 3300005615 Bacteria 1605
73 Ga0068852_100005929 3300005616 Bacteria 8785
74 Ga0068852_100372496 3300005616 Unclassified 1399
75 Ga0068859_100432517 3300005617 Unclassified 1412
76 Ga0068864_100275122 3300005618 Bacteria 1570
77 Ga0068864_100346327 3300005618 Bacteria 1401
78 Ga0068858_100179494 3300005842 Bacteria 1998
79 Ga0068860_100227625 3300005843 Bacteria 1811
80 Ga0070717_10049790 3300006028 Bacteria 3441
81 Ga0070717_10146965 3300006028 Bacteria 2037
82 Ga0070717_10179904 3300006028 Unclassified 1842
83 Ga0070717_10206686 3300006028 Unclassified 1722
84 Ga0075365_10013343 3300006038 Bacteria 4909
85 Ga0075364_10030631 3300006051 Bacteria 3453
86 Ga0070715_10275143 3300006163 Unclassified 890
87 Ga0070712_100383130 3300006175 Bacteria 1158
88 Ga0075367_10002857 3300006178 Bacteria 8031
89 Ga0075367_10050308 3300006178 Bacteria 2460
90 Ga0075366_10078635 3300006195 Unclassified 1968
91 Ga0075370_10045310 3300006353 Bacteria 2487
92 Ga0075428_100007630 3300006844 Bacteria 11993
93 Ga0075434_100851335 3300006871 Unclassified 927
94 Ga0075429_100154965 3300006880 Bacteria 2006
95 Ga0097620_100432526 3300006931 Unclassified 1412
96 Ga0075435_100002206 3300007076 Bacteria 12847
97 Ga0099794_10000449 3300007265 Bacteria 13798
98 Ga0099794_10011651 3300007265 Bacteria 3771
99 Ga0099794_10204094 3300007265 Bacteria 1013
100 Ga0105240_10308409 3300009093 Unclassified 1808
101 Ga0111539_10272871 3300009094 Bacteria 1968
102 Ga0105245_10010670 3300009098 Bacteria 7992
103 Ga0114129_10005973 3300009147 Bacteria 17242
104 Ga0114129_10008768 3300009147 Bacteria 14422
105 Ga0105243_10025424 3300009148 Bacteria 4525
106 Ga0105241_10048575 3300009174 Unclassified 3229
107 Ga0105242_10113516 3300009176 Bacteria 2314
108 Ga0105242_10633659 3300009176 Bacteria 1037
109 Ga0105248_10014871 3300009177 Bacteria 8572
110 Ga0105248_10036139 3300009177 Bacteria 5526
111 Ga0105249_10043488 3300009553 Bacteria 4085
112 Ga0105249_10056968 3300009553 Bacteria 3579
113 Ga0099796_10106197 3300010159 Unclassified 1063
114 Ga0105239_10255056 3300010375 Bacteria 1970
115 Ga0157378_10666632 3300013297 Bacteria 1057
116 Ga0163163_10015151 3300014325 Bacteria 7118
117 Ga0157380_10213590 3300014326 Bacteria 1721
118 Ga0157379_10009415 3300014968 Bacteria 8511
119 Ga0184597_111043 3300019162 Unclassified 1491
120 Ga0184595_110203 3300019166 Bacteria 1403
121 Ga0184596_128525 3300019176 Unclassified 980
122 Ga0224570_100842 3300022730 Unclassified 2446
123 Ga0224571_102876 3300022734 Bacteria 1101
124 Ga0224572_1003106 3300024225 Unclassified 2774
125 Ga0228598_1000916 3300024227 Bacteria 6388
126 Ga0228598_1002810 3300024227 Unclassified 3774
127 Ga0228598_1002962 3300024227 Unclassified 3685
128 Ga0207682_10094579 3300025893 Bacteria 1300
129 Ga0207682_10118090 3300025893 Bacteria 1174
130 Ga0207688_10090463 3300025901 Unclassified 1757
131 Ga0207645_10005933 3300025907 Bacteria 8799
132 Ga0207684_10009549 3300025910 Bacteria 8555
133 Ga0207684_10016900 3300025910 Bacteria 6266
134 Ga0207654_10203533 3300025911 Bacteria 1305
135 Ga0207693_10223123 3300025915 Bacteria 1480
136 Ga0207646_10007708 3300025922 Unclassified 10896
137 Ga0207646_10262664 3300025922 Unclassified 1560
138 Ga0207681_10391085 3300025923 Bacteria 1121
139 Ga0207694_10142622 3300025924 Bacteria 1927
140 Ga0207650_10093229 3300025925 Bacteria 2305
141 Ga0207650_10174439 3300025925 Bacteria 1710
142 Ga0207659_10350564 3300025926 Unclassified 1225
143 Ga0207700_10398289 3300025928 Bacteria 1206
144 Ga0207644_10215834 3300025931 Bacteria 1518
145 Ga0207706_10061007 3300025933 Bacteria 3321
146 Ga0207706_10469982 3300025933 Bacteria 1087
147 Ga0207709_10066485 3300025935 Unclassified 2271
148 Ga0207670_10008859 3300025936 Bacteria 5702
149 Ga0207669_10034852 3300025937 Bacteria 2857
150 Ga0207669_10188953 3300025937 Bacteria 1484
151 Ga0207665_10106327 3300025939 Bacteria 1966
152 Ga0207665_10420138 3300025939 Unclassified 1021
153 Ga0207691_10048163 3300025940 Unclassified 3909
154 Ga0207691_10117742 3300025940 Bacteria 2357
155 Ga0207711_10068952 3300025941 Bacteria 3064
156 Ga0207711_10113887 3300025941 Bacteria 2408
157 Ga0207689_10005159 3300025942 Bacteria 11738
158 Ga0207689_10010334 3300025942 Bacteria 8041
159 Ga0207661_10003176 3300025944 Bacteria 11397
160 Ga0207651_10019969 3300025960 Bacteria 4030
161 Ga0207640_10036436 3300025981 Bacteria 3088
162 Ga0207658_10282283 3300025986 Bacteria 1424
163 Ga0207677_10206338 3300026023 Bacteria 1566
164 Ga0207703_10734185 3300026035 Bacteria 940
165 Ga0207678_10135579 3300026067 Bacteria 2100
166 Ga0207708_10001490 3300026075 Bacteria 17452
167 Ga0207648_10083565 3300026089 Bacteria 2784
168 Ga0207676_10283196 3300026095 Bacteria 1506
169 Ga0207683_10093244 3300026121 Bacteria 2683
170 Ga0207683_10146532 3300026121 Bacteria 2129
171 Ga0207698_10787502 3300026142 Unclassified 952
172 Ga0209588_1000213 3300027671 Bacteria 15625
173 Ga0209588_1024972 3300027671 Bacteria 1889
174 Ga0268266_10181649 3300028379 Bacteria 1916
175 Ga0268265_10018908 3300028380 Bacteria 4783
176 Ga0268264_10315349 3300028381 Unclassified 1477
177 Ga0265762_1001197 3300030760 Bacteria 4705
178 Ga0265762_1013527 3300030760 Bacteria 1469
179 Ga0265760_10000032 3300031090 Bacteria 49109
180 Ga0265760_10017873 3300031090 Unclassified 2038
181 Ga0307416_100409848 3300032002 Bacteria 1396
182 Ga0307416_100954846 3300032002 Bacteria 959
183 Ga0316212_1004967 3300033547 Bacteria 1930
184 Ga0373934_0000840 3300035086 Bacteria 11088
185 Ga0373923_0052328 3300035111 Bacteria 1715
186 Ga0373932_0032374 3300035112 Unclassified 1462
187 Ga0373945_0199412 3300035116 Bacteria 830
188 Ga0373954_0001413 3300035118 Bacteria 9730
189 Ga0373954_0014176 3300035118 Bacteria 3554
190 Ga0373956_0003119 3300035119 Bacteria 6699
191 Ga0373957_0092048 3300035120 Bacteria 1206
192 Ga0373955_0002752 3300035172 Bacteria 7714
193 Ga0373935_0078276 3300035692 Bacteria 2144
194 Ga0373927_0104118 3300035695 Bacteria 1847
195 Ga0373933_0000908 3300035724 Bacteria 18112
196 Ga0373947_0042813 3300035725 Bacteria 2703
197 Ga0373937_0008231 3300036401 Bacteria 9055
198 Ga0373937_0385417 3300036401 Bacteria 1329
199 Ga0265778_009803 3300036457 Bacteria 1083
200 Ga0373925_0105666 3300037068 Bacteria 2170
201 Ga0373925_0196730 3300037068 Unclassified 1602
202 Ga0439462_0015399 3300042015 Bacteria 1971
203 Ga0439446_0048949 3300042156 Unclassified 1259
204 Ga0439444_0021294 3300042437 Bacteria 1147
205 Ga0451577_0033227 3300042876 Bacteria 4650
206 Ga0453683_0004720 3300044673 Bacteria 9622
207 Ga0453684_0161565 3300044712 Unclassified 2649
208 Ga0451576_0340652 3300045051 Bacteria 1570
209 Ga0495592_0085367 3300046454 Bacteria 2276
210 Ga0495603_0029037 3300046455 Unclassified 3336
211 Ga0495651_0032365 3300046462 Bacteria 4079
212 Ga0495651_0047638 3300046462 Bacteria 3313
213 Ga0495651_0218856 3300046462 Bacteria 1319
214 Ga0495653_0007710 3300046463 Bacteria 8806
215 Ga0495653_0026008 3300046463 Bacteria 4697
216 Ga0495653_0040306 3300046463 Bacteria 3651
217 Ga0495580_0132359 3300046472 Bacteria 1729
218 Ga0495580_0172198 3300046472 Unclassified 1496
219 Ga0495580_0422993 3300046472 Unclassified 896
220 Ga0495605_0084735 3300046474 Unclassified 1477
221 Ga0495664_0041822 3300046477 Bacteria 2713
222 Ga0495664_0110156 3300046477 Bacteria 1662
223 Ga0495585_0035227 3300046492 Unclassified 2830
224 Ga0495594_0000702 3300046499 Bacteria 17202
225 Ga0495594_0095909 3300046499 Unclassified 1666
226 Ga0495596_0043013 3300046500 Unclassified 1780
227 Ga0495608_0011102 3300046511 Bacteria 6272
228 Ga0495608_0031944 3300046511 Bacteria 3558
229 Ga0495608_0175718 3300046511 Bacteria 1357
230 Ga0495618_0034746 3300046514 Unclassified 3163
231 Ga0495628_0002691 3300046516 Bacteria 15897
232 Ga0495628_0023006 3300046516 Bacteria 5116
233 Ga0495628_0103826 3300046516 Bacteria 2191
234 Ga0495630_0056312 3300046517 Bacteria 2946
235 Ga0495630_0293534 3300046517 Bacteria 1242
236 Ga0495631_0107513 3300046518 Unclassified 1199
237 Ga0495644_0000421 3300046523 Bacteria 18888
238 Ga0495648_0153594 3300046524 Unclassified 1198
239 Ga0495666_0074901 3300046526 Bacteria 1605
240 Ga0495642_0028182 3300046528 Bacteria 2237
241 Ga0495652_0004489 3300046529 Bacteria 13322
242 Ga0495652_0009953 3300046529 Bacteria 8618
243 Ga0495652_0079430 3300046529 Bacteria 2712
244 Ga0495665_0030795 3300046531 Bacteria 2870
245 Ga0495587_0005667 3300046536 Bacteria 8140
246 Ga0495587_0006258 3300046536 Bacteria 7771
247 Ga0495609_0037594 3300046538 Bacteria 2183
248 Ga0495645_0014616 3300046543 Bacteria 5574
249 Ga0495633_0038978 3300046558 Bacteria 2268
250 Ga0495667_0018217 3300046559 Bacteria 4744
251 Ga0495667_0138527 3300046559 Bacteria 1568
252 Ga0495668_0131241 3300046616 Unclassified 1371
253 Ga0495611_0102861 3300046648 Unclassified 1327
254 Ga0495625_0048283 3300046660 Bacteria 3066
255 Ga0495635_0007433 3300046663 Bacteria 7646
256 Ga0495635_0095452 3300046663 Bacteria 2033
257 Ga0495635_0291952 3300046663 Unclassified 1094
258 Ga0495657_0034176 3300046675 Bacteria 3533
259 Ga0495657_0048820 3300046675 Bacteria 2854
260 Ga0495657_0151134 3300046675 Bacteria 1441
261 Ga0495623_0066810 3300046679 Bacteria 2245
262 Ga0495623_0136574 3300046679 Bacteria 1463
263 Ga0495646_0000534 3300046680 Bacteria 20391
264 Ga0495669_0027937 3300046684 Unclassified 2468
265 Ga0495624_0001421 3300046690 Bacteria 18642
266 Ga0495670_0078120 3300046691 Unclassified 1683
267 Ga0495589_0079375 3300046794 Bacteria 1597
268 Ga0495600_0008609 3300046809 Bacteria 6276
269 Ga0495604_0002037 3300047317 Bacteria 16333
270 Ga0495604_0002593 3300047317 Bacteria 14486
271 Ga0495674_0023587 3300047319 Bacteria 5668
272 Ga0495674_0069329 3300047319 Unclassified 3049
273 Ga0495674_0095110 3300047319 Bacteria 2541
274 Ga0495680_0028062 3300047322 Bacteria 4618
275 Ga0495680_0121206 3300047322 Bacteria 1931
276 Ga0495675_0000750 3300047444 Bacteria 20283
277 Ga0495675_0005819 3300047444 Bacteria 7533
278 Ga0495677_0013953 3300047445 Bacteria 2925
279 Ga0495685_085390 3300047447 Unclassified 1049
280 Ga0495673_0025548 3300047469 Bacteria 2833
281 Ga0495681_0068285 3300047470 Unclassified 1618
282 Ga0495684_0001590 3300047471 Bacteria 18202
283 Ga0495684_0004653 3300047471 Bacteria 10708
284 Ga0495684_0025188 3300047471 Unclassified 4574
285 Ga0495684_0062538 3300047471 Bacteria 2831
286 Ga0495593_0049030 3300047673 Bacteria 2242
287 Ga0495602_0016430 3300048088 Bacteria 7444
288 Ga0495602_0020595 3300048088 Bacteria 6515
289 Ga0495602_0027194 3300048088 Bacteria 5503
290 Ga0495602_0215771 3300048088 Unclassified 1452
291 Ga0495602_0243719 3300048088 Bacteria 1343
292 Ga0495602_0360395 3300048088 Bacteria 1047
293 Ga0495614_0031344 3300048089 Bacteria 2288
294 Ga0496102_0197164 3300048905 Unclassified 1898
295 Ga0496107_0231435 3300048910 Unclassified 1375
296 Ga0496108_0010136 3300048911 Bacteria 7647
297 Ga0496109_0120299 3300048912 Bacteria 2446
298 Ga0496110_0006108 3300048913 Bacteria 9493
299 Ga0496111_0053851 3300048914 Bacteria 2907
300 Ga0496112_0002392 3300048915 Bacteria 15085
301 Ga0501073_0170386 3300049589 Unclassified 1507
302 nmdc:mga09592_235585_c1 3300050508 Unclassified 1586
303 nmdc:mga0n895_496441_c1 3300050512 Unclassified 1230
304 nmdc:mga0rr50_23657_c1 3300050513 Bacteria 4241
305 nmdc:mga0rr50_280570_c1 3300050513 Bacteria 1390
306 nmdc:mga0rr50_617137_c1 3300050513 Bacteria 925
307 Ga0495601_0109406 3300053077 Unclassified 1789
308 Ga0495612_0001292 3300053078 Bacteria 10332
309 Ga0495619_0005170 3300053085 Bacteria 8278
310 Ga0495619_0172392 3300053085 Bacteria 1496
311 Ga0207685_10159222
312 MBSR1b_contig_11273090
313 LJNas_1000077
314 Ga0065712_10087576
315 Ga0065712_10100695
316 Ga0065712_10188835
317 Ga0065715_10041627
318 Ga0065715_10109209
319 Ga0065715_10235974
320 Ga0065707_10203575
321 Ga0070676_10137075
322 Ga0070683_100003308
323 Ga0070690_100098459
324 Ga0070670_100048814
325 Ga0070670_100532872
326 Ga0068869_100011622
327 Ga0068869_100016187
328 Ga0070666_10045355
329 Ga0070680_100490314
330 Ga0070687_100043821
331 Ga0070669_100195823
332 Ga0070675_100085079
333 Ga0070671_100085535
334 Ga0070671_100138308
335 Ga0070674_100029237
336 Ga0070674_100029489
337 Ga0070674_100139955
338 Ga0070673_100026400
339 Ga0070659_100459827
340 Ga0070667_100272855
341 Ga0070667_100321059
342 Ga0070714_100070499
343 Ga0070714_100217158
344 Ga0070713_100123094
345 Ga0070701_10009569
346 Ga0070711_100075072
347 Ga0070711_100095160
348 Ga0070700_100343156
349 Ga0070694_100911682
350 Ga0070708_100105414
351 Ga0070708_100216522
352 Ga0070663_100028588
353 Ga0070678_100076521
354 Ga0070662_100130181
355 Ga0068867_100055567
356 Ga0070706_100013217
357 Ga0070706_100247791
358 Ga0070707_100135530
359 Ga0070707_100307165
360 Ga0070698_100002613
361 Ga0070698_100057266
362 Ga0070698_100441639
363 Ga0070698_100452803
364 Ga0070699_100067777
365 Ga0070699_100108986
366 Ga0070699_100155666
367 Ga0070699_100319322
368 Ga0070684_100001961
369 Ga0070697_100006588
370 Ga0070697_100055639
371 Ga0070697_100431493
372 Ga0070672_100032958
373 Ga0070672_100047243
374 Ga0070686_100437765
375 Ga0070695_100193976
376 Ga0070696_100150858
377 Ga0070693_100005354
378 Ga0070693_100045971
379 Ga0070704_100010470
380 Ga0070664_100000447
381 Ga0070664_100197569
382 Ga0070702_100126951
383 Ga0068852_100005929
384 Ga0068852_100372496
385 Ga0068859_100432517
386 Ga0068864_100275122
387 Ga0068864_100346327
388 Ga0068858_100179494
389 Ga0068860_100227625
390 Ga0070717_10049790
391 Ga0070717_10146965
392 Ga0070717_10179904
393 Ga0070717_10206686
394 Ga0075365_10013343
395 Ga0075364_10030631
396 Ga0070715_10275143
397 Ga0070712_100383130
398 Ga0075367_10002857
399 Ga0075367_10050308
400 Ga0075366_10078635
401 Ga0075370_10045310
402 Ga0075428_100007630
403 Ga0075434_100851335
404 Ga0075429_100154965
405 Ga0097620_100432526
406 Ga0075435_100002206
407 Ga0099794_10000449
408 Ga0099794_10011651
409 Ga0099794_10204094
410 Ga0105240_10308409
411 Ga0111539_10272871
412 Ga0105245_10010670
413 Ga0114129_10005973
414 Ga0114129_10008768
415 Ga0105243_10025424
416 Ga0105241_10048575
417 Ga0105242_10113516
418 Ga0105242_10633659
419 Ga0105248_10014871
420 Ga0105248_10036139
421 Ga0105249_10043488
422 Ga0105249_10056968
423 Ga0099796_10106197
424 Ga0105239_10255056
425 Ga0157378_10666632
426 Ga0163163_10015151
427 Ga0157380_10213590
428 Ga0157379_10009415
429 Ga0184597_111043
430 Ga0184595_110203
431 Ga0184596_128525
432 Ga0224570_100842
433 Ga0224571_102876
434 Ga0224572_1003106
435 Ga0228598_1000916
436 Ga0228598_1002810
437 Ga0228598_1002962
438 Ga0207682_10094579
439 Ga0207682_10118090
440 Ga0207688_10090463
441 Ga0207645_10005933
442 Ga0207684_10009549
443 Ga0207684_10016900
444 Ga0207654_10203533
445 Ga0207693_10223123
446 Ga0207646_10007708
447 Ga0207646_10262664
448 Ga0207681_10391085
449 Ga0207694_10142622
450 Ga0207650_10093229
451 Ga0207650_10174439
452 Ga0207659_10350564
453 Ga0207700_10398289
454 Ga0207644_10215834
455 Ga0207706_10061007
456 Ga0207706_10469982
457 Ga0207709_10066485
458 Ga0207670_10008859
459 Ga0207669_10034852
460 Ga0207669_10188953
461 Ga0207665_10106327
462 Ga0207665_10420138
463 Ga0207691_10048163
464 Ga0207691_10117742
465 Ga0207711_10068952
466 Ga0207711_10113887
467 Ga0207689_10005159
468 Ga0207689_10010334
469 Ga0207661_10003176
470 Ga0207651_10019969
471 Ga0207640_10036436
472 Ga0207658_10282283
473 Ga0207677_10206338
474 Ga0207703_10734185
475 Ga0207678_10135579
476 Ga0207708_10001490
477 Ga0207648_10083565
478 Ga0207676_10283196
479 Ga0207683_10093244
480 Ga0207683_10146532
481 Ga0207698_10787502
482 Ga0209588_1000213
483 Ga0209588_1024972
484 Ga0268266_10181649
485 Ga0268265_10018908
486 Ga0268264_10315349
487 Ga0265762_1001197
488 Ga0265762_1013527
489 Ga0265760_10000032
490 Ga0265760_10017873
491 Ga0307416_100409848
492 Ga0307416_100954846
493 Ga0316212_1004967
494 Ga0373934_0000840
495 Ga0373923_0052328
496 Ga0373932_0032374
497 Ga0373945_0199412
498 Ga0373954_0001413
499 Ga0373954_0014176
500 Ga0373956_0003119
501 Ga0373957_0092048
502 Ga0373955_0002752
503 Ga0373935_0078276
504 Ga0373927_0104118
505 Ga0373933_0000908
506 Ga0373947_0042813
507 Ga0373937_0008231
508 Ga0373937_0385417
509 Ga0265778_009803
510 Ga0373925_0105666
511 Ga0373925_0196730
512 Ga0439462_0015399
513 Ga0439446_0048949
514 Ga0439444_0021294
515 Ga0451577_0033227
516 Ga0453683_0004720
517 Ga0453684_0161565
518 Ga0451576_0340652
519 Ga0495592_0085367
520 Ga0495603_0029037
521 Ga0495651_0032365
522 Ga0495651_0047638
523 Ga0495651_0218856
524 Ga0495653_0007710
525 Ga0495653_0026008
526 Ga0495653_0040306
527 Ga0495580_0132359
528 Ga0495580_0172198
529 Ga0495580_0422993
530 Ga0495605_0084735
531 Ga0495664_0041822
532 Ga0495664_0110156
533 Ga0495585_0035227
534 Ga0495594_0000702
535 Ga0495594_0095909
536 Ga0495596_0043013
537 Ga0495608_0011102
538 Ga0495608_0031944
539 Ga0495608_0175718
540 Ga0495618_0034746
541 Ga0495628_0002691
542 Ga0495628_0023006
543 Ga0495628_0103826
544 Ga0495630_0056312
545 Ga0495630_0293534
546 Ga0495631_0107513
547 Ga0495644_0000421
548 Ga0495648_0153594
549 Ga0495666_0074901
550 Ga0495642_0028182
551 Ga0495652_0004489
552 Ga0495652_0009953
553 Ga0495652_0079430
554 Ga0495665_0030795
555 Ga0495587_0005667
556 Ga0495587_0006258
557 Ga0495609_0037594
558 Ga0495645_0014616
559 Ga0495633_0038978
560 Ga0495667_0018217
561 Ga0495667_0138527
562 Ga0495668_0131241
563 Ga0495611_0102861
564 Ga0495625_0048283
565 Ga0495635_0007433
566 Ga0495635_0095452
567 Ga0495635_0291952
568 Ga0495657_0034176
569 Ga0495657_0048820
570 Ga0495657_0151134
571 Ga0495623_0066810
572 Ga0495623_0136574
573 Ga0495646_0000534
574 Ga0495669_0027937
575 Ga0495624_0001421
576 Ga0495670_0078120
577 Ga0495589_0079375
578 Ga0495600_0008609
579 Ga0495604_0002037
580 Ga0495604_0002593
581 Ga0495674_0023587
582 Ga0495674_0069329
583 Ga0495674_0095110
584 Ga0495680_0028062
585 Ga0495680_0121206
586 Ga0495675_0000750
587 Ga0495675_0005819
588 Ga0495677_0013953
589 Ga0495685_085390
590 Ga0495673_0025548
591 Ga0495681_0068285
592 Ga0495684_0001590
593 Ga0495684_0004653
594 Ga0495684_0025188
595 Ga0495684_0062538
596 Ga0495593_0049030
597 Ga0495602_0016430
598 Ga0495602_0020595
599 Ga0495602_0027194
600 Ga0495602_0215771
601 Ga0495602_0243719
602 Ga0495602_0360395
603 Ga0495614_0031344
604 Ga0496102_0197164
605 Ga0496107_0231435
606 Ga0496108_0010136
607 Ga0496109_0120299
608 Ga0496110_0006108
609 Ga0496111_0053851
610 Ga0496112_0002392
611 Ga0501073_0170386
612 nmdc:mga09592_235585_c1
613 nmdc:mga0n895_496441_c1
614 nmdc:mga0rr50_23657_c1
615 nmdc:mga0rr50_280570_c1
616 nmdc:mga0rr50_617137_c1
617 Ga0495601_0109406
618 Ga0495612_0001292
619 Ga0495619_0005170
620 Ga0495619_0172392

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04366

Ysc84

Las17-binding protein actin regulator

100

222

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uc0-assembly1.cif.gz_A crystal structure of beta-barrel-like, uncharacterized protein of cog5400 from brucella abortus 0.5947 59 188
7rfq-assembly1.cif.gz_A structure of bacterial sylf domain containing protein, beta cell expansion factor a (befa) 0.5762 25 190
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.5665 51 188
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.4705 51 188
6xu7-assembly1.cif.gz_AL drosophila melanogaster testis polysome ribosome 0.4551 60 122
ID Description Score Start End Superfamily
af_A0A1D6LAI1_28_181_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6796 21 56 1.20.140.40
6d34B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5705 60 115 3.10.450.50
4peaQ00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.4444 62 120 2.40.50.140
af_Q9UUB0_2_90_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.4431 60 128 2.40.50.140
af_O94647_115_459_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4381 63 110 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A2V8UMF5-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.8972 29 134 GO:0035091
AF-A0A1F2RBR5-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.883 25 234 GO:0035091
AF-A0A2V9BQ86-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.8582 20 230 GO:0035091
AF-A0A7C1C4V0-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.8569 29 222 GO:0035091
AF-A0A2V9A0Q7-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.8566 27 237 GO:0035091

Map