F400712

General Info

Members Datasets Scaffolds Average Seq Length
310 196 620 174

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10054798|Ga0105238_100547983
Length 198
Sequence MSNPFVAEVRIFTGNFAPTGWAQCNGQLMPISQNTALFSLLGTFYGGDGKSTFALPNLQGSAPMQAGQGPGLSLRDLGEIGGEQTVTLLQTEMPAHAHTAQGSTGSDQTTPVANAWASGAKLGGGNLYFPSTPASNVQMSPFGTSIAGASLPHNNMMPYLGLTFIIALQESSRQDPSSGPVLFVKGYAQLHSLYFFDT

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
78 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
123 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
124 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
125 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.81
Metatranscriptomes 4.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 3.87
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 10.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10054798 3300009551 Bacteria 4003
2 JGI24034J14986_101632 3300001432 Bacteria 1257
3 JGI24748J21848_1000038 3300002074 Bacteria 69882
4 JGI24034J26672_10000041 3300002239 Bacteria 69886
5 JGI25406J46586_10017123 3300003203 Bacteria 3003
6 rootH2_10045752 3300003320 Bacteria 1489
7 Ga0058860_11848372 3300004801 Bacteria 843
8 Ga0058862_12485591 3300004803 Bacteria 1651
9 Ga0065715_10446836 3300005293 Unclassified 830
10 Ga0070658_10187415 3300005327 Bacteria 1743
11 Ga0070683_100038919 3300005329 Bacteria 4362
12 Ga0070683_100083000 3300005329 Bacteria 3002
13 Ga0070670_100005938 3300005331 Bacteria 10326
14 Ga0068869_100062193 3300005334 Bacteria 2740
15 Ga0070682_100000096 3300005337 Bacteria 79913
16 Ga0070682_100316056 3300005337 Bacteria 1151
17 Ga0070689_100029297 3300005340 Bacteria 4165
18 Ga0070689_100040981 3300005340 Bacteria 3553
19 Ga0070689_100359337 3300005340 Unclassified 1223
20 Ga0070687_100032632 3300005343 Unclassified 2563
21 Ga0070669_100015293 3300005353 Bacteria 5467
22 Ga0070675_100074405 3300005354 Bacteria 2822
23 Ga0070675_100145194 3300005354 Bacteria 2031
24 Ga0070671_100023908 3300005355 Bacteria 5000
25 Ga0070671_100863886 3300005355 Unclassified 789
26 Ga0070673_100202681 3300005364 Bacteria 1709
27 Ga0070709_10018088 3300005434 Bacteria 4052
28 Ga0070714_100027525 3300005435 Bacteria 4708
29 Ga0070714_100039174 3300005435 Bacteria 3988
30 Ga0070714_100053321 3300005435 Bacteria 3451
31 Ga0070714_100348473 3300005435 Bacteria 1390
32 Ga0070714_100610892 3300005435 Bacteria 1048
33 Ga0070713_100036604 3300005436 Bacteria 3961
34 Ga0070713_100051515 3300005436 Bacteria 3404
35 Ga0070713_100085350 3300005436 Bacteria 2704
36 Ga0070710_10177065 3300005437 Bacteria 1333
37 Ga0070710_10450606 3300005437 Bacteria 872
38 Ga0070710_10815023 3300005437 Bacteria 668
39 Ga0070711_101559488 3300005439 Bacteria 577
40 Ga0070705_100059478 3300005440 Viruses 2263
41 Ga0070705_100146417 3300005440 Bacteria 1561
42 Ga0070705_100462645 3300005440 Bacteria 954
43 Ga0070705_100953894 3300005440 Unclassified 693
44 Ga0070700_100256053 3300005441 Unclassified 1258
45 Ga0070708_100220763 3300005445 Bacteria 1777
46 Ga0070708_100795128 3300005445 Bacteria 889
47 Ga0070708_101151503 3300005445 Unclassified 726
48 Ga0070681_10018975 3300005458 Bacteria 6883
49 Ga0070681_10154542 3300005458 Bacteria 2220
50 Ga0070681_10564945 3300005458 Bacteria 1051
51 Ga0070706_100017462 3300005467 Bacteria 6622
52 Ga0070706_100074291 3300005467 Bacteria 3147
53 Ga0070706_100148105 3300005467 Bacteria 2191
54 Ga0070707_100037936 3300005468 Bacteria 4601
55 Ga0070707_100306417 3300005468 Bacteria 1543
56 Ga0070707_100769707 3300005468 Unclassified 926
57 Ga0070698_100040516 3300005471 Bacteria 4786
58 Ga0070698_100232772 3300005471 Bacteria 1776
59 Ga0070698_100599641 3300005471 Bacteria 1042
60 Ga0070699_100080515 3300005518 Bacteria 2838
61 Ga0070699_100095275 3300005518 Bacteria 2606
62 Ga0070679_100012341 3300005530 Bacteria 8161
63 Ga0070679_100052761 3300005530 Bacteria 4048
64 Ga0070684_100137573 3300005535 Bacteria 2207
65 Ga0070684_100143749 3300005535 Bacteria 2159
66 Ga0070697_100638622 3300005536 Bacteria 937
67 Ga0070695_100050450 3300005545 Unclassified 2666
68 Ga0070696_100412529 3300005546 Viruses 1059
69 Ga0070704_100041846 3300005549 Bacteria 3165
70 Ga0070704_100085003 3300005549 Viruses 2341
71 Ga0068857_100049299 3300005577 Bacteria 3736
72 Ga0068854_100276682 3300005578 Bacteria 1350
73 Ga0068854_100287639 3300005578 Bacteria 1325
74 Ga0070702_100086490 3300005615 Bacteria 1891
75 Ga0070702_100232329 3300005615 Bacteria 1240
76 Ga0068852_100053723 3300005616 Bacteria 3469
77 Ga0068852_100070707 3300005616 Bacteria 3062
78 Ga0068859_100035128 3300005617 Bacteria 5029
79 Ga0068859_100061241 3300005617 Bacteria 3792
80 Ga0068859_100380275 3300005617 Viruses 1507
81 Ga0068864_100097166 3300005618 Bacteria 2607
82 Ga0068851_10336489 3300005834 Bacteria 875
83 Ga0068863_100050442 3300005841 Bacteria 3944
84 Ga0068858_100000443 3300005842 Bacteria 43345
85 Ga0068860_100001858 3300005843 Bacteria 22473
86 Ga0081539_10008539 3300005985 Bacteria 8872
87 Ga0081539_10059063 3300005985 Bacteria 2113
88 Ga0081539_10298798 3300005985 Bacteria 693
89 Ga0070717_10195576 3300006028 Bacteria 1769
90 Ga0070717_10323943 3300006028 Bacteria 1373
91 Ga0070717_11030081 3300006028 Bacteria 750
92 Ga0075365_10011424 3300006038 Bacteria 5221
93 Ga0075364_10032057 3300006051 Bacteria 3376
94 Ga0070715_10218297 3300006163 Bacteria 979
95 Ga0070716_100060387 3300006173 Bacteria 2189
96 Ga0070716_100097115 3300006173 Bacteria 1797
97 Ga0070716_100137428 3300006173 Bacteria 1553
98 Ga0070716_100332124 3300006173 Bacteria 1069
99 Ga0070712_100118577 3300006175 Bacteria 1988
100 Ga0070712_100190650 3300006175 Bacteria 1604
101 Ga0070712_100266950 3300006175 Bacteria 1373
102 Ga0075433_10533526 3300006852 Bacteria 1032
103 Ga0075436_100161103 3300006914 Bacteria 1582
104 Ga0097620_100035127 3300006931 Bacteria 5029
105 Ga0097620_100061237 3300006931 Bacteria 3792
106 Ga0097620_100380248 3300006931 Viruses 1507
107 Ga0097620_101131985 3300006931 Bacteria 861
108 Ga0075435_100609519 3300007076 Bacteria 947
109 Ga0105240_10021475 3300009093 Bacteria 8585
110 Ga0105247_10000142 3300009101 Bacteria 69945
111 Ga0105247_10027397 3300009101 Bacteria 3446
112 Ga0105243_10210118 3300009148 Bacteria 1713
113 Ga0105241_10042300 3300009174 Viruses 3446
114 Ga0105241_10650849 3300009174 Unclassified 957
115 Ga0105242_10072785 3300009176 Bacteria 2855
116 Ga0105242_10077459 3300009176 Bacteria 2774
117 Ga0105242_10455567 3300009176 Bacteria 1207
118 Ga0105248_10101042 3300009177 Bacteria 3250
119 Ga0105248_10292993 3300009177 Bacteria 1832
120 Ga0105238_10124492 3300009551 Viruses 2557
121 Ga0105238_10131900 3300009551 Bacteria 2477
122 Ga0105238_10398099 3300009551 Viruses 1370
123 Ga0105238_10475903 3300009551 Bacteria 1248
124 Ga0099796_10044708 3300010159 Bacteria 1514
125 Ga0105239_10196727 3300010375 Bacteria 2258
126 Ga0105239_11536820 3300010375 Bacteria 769
127 Ga0105239_11670858 3300010375 Bacteria 737
128 Ga0105246_10894970 3300011119 Unclassified 795
129 Ga0157370_10317499 3300013104 Bacteria 1437
130 Ga0157370_10367310 3300013104 Bacteria 1326
131 Ga0157369_10465617 3300013105 Bacteria 1309
132 Ga0157369_11314177 3300013105 Bacteria 737
133 Ga0157374_10091147 3300013296 Bacteria 2906
134 Ga0157374_10130340 3300013296 Bacteria 2433
135 Ga0157374_10752882 3300013296 Bacteria 989
136 Ga0157378_10070160 3300013297 Bacteria 3145
137 Ga0157372_10202999 3300013307 Bacteria 2297
138 Ga0157372_11232039 3300013307 Bacteria 864
139 Ga0157380_10367547 3300014326 Bacteria 1352
140 Ga0157379_10010007 3300014968 Bacteria 8262
141 Ga0206355_1388964 3300020076 Bacteria 674
142 Ga0206351_10745108 3300020077 Bacteria 1815
143 Ga0206350_11545301 3300020080 Bacteria 1711
144 Ga0154015_1206444 3300020610 Bacteria 2254
145 Ga0224712_10028155 3300022467 Bacteria 2006
146 Ga0207672_1000598 3300025223 Bacteria 4312
147 Ga0207692_10134932 3300025898 Bacteria 1398
148 Ga0207692_10202146 3300025898 Bacteria 1169
149 Ga0207692_10489821 3300025898 Bacteria 779
150 Ga0207710_10000001 3300025900 Bacteria 1797433
151 Ga0207710_10129197 3300025900 Bacteria 1212
152 Ga0207699_10138225 3300025906 Bacteria 1598
153 Ga0207705_10126714 3300025909 Bacteria 1898
154 Ga0207705_10896844 3300025909 Bacteria 687
155 Ga0207684_10365219 3300025910 Bacteria 1242
156 Ga0207654_10018445 3300025911 Unclassified 3662
157 Ga0207707_10070523 3300025912 Bacteria 3045
158 Ga0207707_10208001 3300025912 Bacteria 1705
159 Ga0207695_10304135 3300025913 Bacteria 1486
160 Ga0207693_10044388 3300025915 Bacteria 3494
161 Ga0207693_10284243 3300025915 Bacteria 1296
162 Ga0207663_10045613 3300025916 Bacteria 2697
163 Ga0207663_10800915 3300025916 Unclassified 750
164 Ga0207660_10039376 3300025917 Bacteria 3304
165 Ga0207652_10040248 3300025921 Bacteria 3968
166 Ga0207652_11178725 3300025921 Bacteria 667
167 Ga0207646_10017738 3300025922 Bacteria 6650
168 Ga0207646_10244209 3300025922 Bacteria 1622
169 Ga0207681_10004339 3300025923 Bacteria 8754
170 Ga0207694_10194066 3300025924 Bacteria 1650
171 Ga0207694_10223051 3300025924 Bacteria 1538
172 Ga0207694_10313566 3300025924 Bacteria 1293
173 Ga0207650_10029226 3300025925 Unclassified 3961
174 Ga0207659_10089908 3300025926 Bacteria 2291
175 Ga0207700_10024041 3300025928 Bacteria 4212
176 Ga0207700_10037274 3300025928 Bacteria 3519
177 Ga0207700_10281318 3300025928 Bacteria 1431
178 Ga0207700_10282678 3300025928 Bacteria 1428
179 Ga0207700_10492249 3300025928 Bacteria 1084
180 Ga0207664_10009227 3300025929 Bacteria 6911
181 Ga0207664_10438254 3300025929 Bacteria 1165
182 Ga0207664_10582818 3300025929 Bacteria 1004
183 Ga0207664_10891428 3300025929 Unclassified 799
184 Ga0207644_10002643 3300025931 Bacteria 11538
185 Ga0207644_10784919 3300025931 Unclassified 796
186 Ga0207686_10114083 3300025934 Bacteria 1828
187 Ga0207686_10596447 3300025934 Bacteria 869
188 Ga0207686_10779887 3300025934 Bacteria 765
189 Ga0207709_10350496 3300025935 Unclassified 1114
190 Ga0207670_10017283 3300025936 Bacteria 4359
191 Ga0207670_10346382 3300025936 Unclassified 1175
192 Ga0207665_10000045 3300025939 Bacteria 79809
193 Ga0207665_10004993 3300025939 Bacteria 8853
194 Ga0207665_10175068 3300025939 Bacteria 1551
195 Ga0207665_10182802 3300025939 Bacteria 1519
196 Ga0207711_10044833 3300025941 Bacteria 3777
197 Ga0207661_10293168 3300025944 Bacteria 1456
198 Ga0207667_10089435 3300025949 Bacteria 3183
199 Ga0207651_10708871 3300025960 Bacteria 887
200 Ga0207677_10147573 3300026023 Bacteria 1810
201 Ga0207703_10000818 3300026035 Bacteria 30635
202 Ga0207703_10659206 3300026035 Unclassified 993
203 Ga0207703_11178447 3300026035 Bacteria 736
204 Ga0207639_10145553 3300026041 Bacteria 1979
205 Ga0207708_10322801 3300026075 Unclassified 1260
206 Ga0207702_10019229 3300026078 Bacteria 5650
207 Ga0207641_10019185 3300026088 Bacteria 5610
208 Ga0207641_10460106 3300026088 Bacteria 1231
209 Ga0207674_10054611 3300026116 Viruses 4066
210 Ga0207698_10061432 3300026142 Bacteria 2928
211 Ga0207698_10447517 3300026142 Unclassified 1246
212 Ga0209970_1000375 3300027614 Bacteria 7529
213 Ga0268265_10029162 3300028380 Bacteria 3959
214 Ga0268264_10000226 3300028381 Bacteria 109817
215 Ga0265326_10075304 3300028558 Bacteria 954
216 Ga0316177_1214336 3300030731 Bacteria 11734
217 Ga0314311_1255289 3300030733 Bacteria 1205
218 Ga0316182_1155537 3300030745 Bacteria 7088
219 Ga0265320_10081725 3300031240 Bacteria 1508
220 Ga0265320_10108765 3300031240 Bacteria 1271
221 Ga0307513_10014167 3300031456 Bacteria 9755
222 Ga0307408_100000034 3300031548 Bacteria 208605
223 Ga0373926_0305614 3300035083 Bacteria 621
224 Ga0373923_0312269 3300035111 Bacteria 745
225 Ga0373936_0150917 3300035113 Bacteria 1007
226 Ga0373936_0311199 3300035113 Bacteria 712
227 Ga0373945_0002570 3300035116 Bacteria 5680
228 Ga0373953_0140299 3300035117 Bacteria 1033
229 Ga0373956_0091516 3300035119 Bacteria 1404
230 Ga0373956_0103691 3300035119 Unclassified 1321
231 Ga0373957_0049865 3300035120 Bacteria 1599
232 Ga0373943_0044770 3300035170 Bacteria 2154
233 Ga0373955_0000430 3300035172 Bacteria 17725
234 Ga0373924_0000790 3300035410 Bacteria 9864
235 Ga0373924_0041101 3300035410 Bacteria 1894
236 Ga0373924_0074524 3300035410 Bacteria 1436
237 Ga0373935_0009571 3300035692 Bacteria 5801
238 Ga0373935_0134835 3300035692 Bacteria 1662
239 Ga0373935_0411535 3300035692 Unclassified 972
240 Ga0373933_0055975 3300035724 Bacteria 2367
241 Ga0373933_0274220 3300035724 Bacteria 1089
242 Ga0373947_0006211 3300035725 Bacteria 6948
243 Ga0373947_0024403 3300035725 Bacteria 3523
244 Ga0373937_0166046 3300036401 Bacteria 2070
245 Ga0373937_0221186 3300036401 Bacteria 1782
246 Ga0373937_1293819 3300036401 Unclassified 677
247 Ga0373937_1443157 3300036401 Unclassified 636
248 Ga0373925_0089845 3300037068 Bacteria 2347
249 Ga0373925_0211609 3300037068 Bacteria 1544
250 Ga0373925_1021292 3300037068 Bacteria 681
251 Ga0395900_0757106 3300037418 Bacteria 901
252 Ga0395898_0648919 3300037466 Bacteria 998
253 Ga0395901_1025923 3300038443 Bacteria 799
254 Ga0436362_1168247 3300039453 Bacteria 1461
255 Ga0451577_0126127 3300042876 Unclassified 2294
256 Ga0466961_0085978 3300044693 Bacteria 1988
257 Ga0466963_0002995 3300044694 Bacteria 9555
258 Ga0466963_0141577 3300044694 Bacteria 1666
259 Ga0453684_0290350 3300044712 Unclassified 1862
260 Ga0466970_0590951 3300044765 Bacteria 644
261 Ga0466957_0000161 3300044842 Bacteria 29452
262 Ga0451576_0495546 3300045051 Bacteria 1283
263 Ga0466958_0469470 3300045836 Bacteria 815
264 Ga0466958_0556718 3300045836 Bacteria 745
265 Ga0495653_0728728 3300046463 Bacteria 600
266 Ga0495580_0317737 3300046472 Unclassified 1058
267 Ga0495639_0062195 3300046475 Bacteria 1712
268 Ga0495594_0341561 3300046499 Bacteria 853
269 Ga0495628_0062836 3300046516 Bacteria 2910
270 Ga0495630_0137873 3300046517 Bacteria 1854
271 Ga0495630_1074942 3300046517 Bacteria 610
272 Ga0495663_0000074 3300046525 Bacteria 45307
273 Ga0495586_0069299 3300046535 Bacteria 1925
274 Ga0495598_0000137 3300046537 Bacteria 12442
275 Ga0495621_0001775 3300046539 Bacteria 5659
276 Ga0495667_0760872 3300046559 Unclassified 598
277 Ga0495657_0071897 3300046675 Unclassified 2258
278 Ga0495636_0104897 3300047318 Bacteria 1239
279 Ga0495674_0165690 3300047319 Bacteria 1847
280 Ga0495680_0187569 3300047322 Bacteria 1489
281 Ga0495684_0206261 3300047471 Bacteria 1447
282 Ga0495593_0333247 3300047673 Unclassified 758
283 Ga0495614_0081032 3300048089 Bacteria 1406
284 Ga0496102_0124345 3300048905 Bacteria 2410
285 Ga0496103_0158610 3300048906 Bacteria 1451
286 Ga0496104_0054009 3300048907 Bacteria 3797
287 Ga0496105_0462667 3300048908 Bacteria 1000
288 Ga0496110_0076818 3300048913 Unclassified 2970
289 Ga0496110_0194957 3300048913 Bacteria 1839
290 Ga0496111_0002956 3300048914 Bacteria 10401
291 Ga0496111_0243471 3300048914 Unclassified 1335
292 Ga0496112_0000254 3300048915 Bacteria 34068
293 Ga0496112_0313865 3300048915 Bacteria 1513
294 Ga0496113_0002528 3300048916 Bacteria 10662
295 Ga0496113_0170555 3300048916 Bacteria 1723
296 Ga0501034_0779893 3300049571 Bacteria 850
297 nmdc:mga00v17_6004_c1 3300050491 Bacteria 6426
298 nmdc:mga0yw44_48381_c1 3300050492 Bacteria 2564
299 nmdc:mga05p37_213749_c1 3300050507 Bacteria 2330
300 nmdc:mga0n895_283907_c1 3300050512 Bacteria 1678
301 nmdc:mga08x19_149428_c1 3300050514 Bacteria 1581
302 Ga0495612_0250379 3300053078 Bacteria 788
303 Ga0500651_0002277 3300053093 Bacteria 10071
304 Ga0500658_0000558 3300053134 Bacteria 15667
305 Ga0587077_001137 3300059493 Bacteria 2737
306 Ga0587083_0002202 3300059505 Bacteria 2383
307 Ga0587094_017289 3300059513 Bacteria 1013
308 Ga0587067_003973 3300059640 Bacteria 1890
309 Ga0587075_001970 3300059644 Bacteria 2099
310 Ga0587111_0006989 3300060346 Bacteria 1815
311 Ga0105238_10054798
312 JGI24034J14986_101632
313 JGI24748J21848_1000038
314 JGI24034J26672_10000041
315 JGI25406J46586_10017123
316 rootH2_10045752
317 Ga0058860_11848372
318 Ga0058862_12485591
319 Ga0065715_10446836
320 Ga0070658_10187415
321 Ga0070683_100038919
322 Ga0070683_100083000
323 Ga0070670_100005938
324 Ga0068869_100062193
325 Ga0070682_100000096
326 Ga0070682_100316056
327 Ga0070689_100029297
328 Ga0070689_100040981
329 Ga0070689_100359337
330 Ga0070687_100032632
331 Ga0070669_100015293
332 Ga0070675_100074405
333 Ga0070675_100145194
334 Ga0070671_100023908
335 Ga0070671_100863886
336 Ga0070673_100202681
337 Ga0070709_10018088
338 Ga0070714_100027525
339 Ga0070714_100039174
340 Ga0070714_100053321
341 Ga0070714_100348473
342 Ga0070714_100610892
343 Ga0070713_100036604
344 Ga0070713_100051515
345 Ga0070713_100085350
346 Ga0070710_10177065
347 Ga0070710_10450606
348 Ga0070710_10815023
349 Ga0070711_101559488
350 Ga0070705_100059478
351 Ga0070705_100146417
352 Ga0070705_100462645
353 Ga0070705_100953894
354 Ga0070700_100256053
355 Ga0070708_100220763
356 Ga0070708_100795128
357 Ga0070708_101151503
358 Ga0070681_10018975
359 Ga0070681_10154542
360 Ga0070681_10564945
361 Ga0070706_100017462
362 Ga0070706_100074291
363 Ga0070706_100148105
364 Ga0070707_100037936
365 Ga0070707_100306417
366 Ga0070707_100769707
367 Ga0070698_100040516
368 Ga0070698_100232772
369 Ga0070698_100599641
370 Ga0070699_100080515
371 Ga0070699_100095275
372 Ga0070679_100012341
373 Ga0070679_100052761
374 Ga0070684_100137573
375 Ga0070684_100143749
376 Ga0070697_100638622
377 Ga0070695_100050450
378 Ga0070696_100412529
379 Ga0070704_100041846
380 Ga0070704_100085003
381 Ga0068857_100049299
382 Ga0068854_100276682
383 Ga0068854_100287639
384 Ga0070702_100086490
385 Ga0070702_100232329
386 Ga0068852_100053723
387 Ga0068852_100070707
388 Ga0068859_100035128
389 Ga0068859_100061241
390 Ga0068859_100380275
391 Ga0068864_100097166
392 Ga0068851_10336489
393 Ga0068863_100050442
394 Ga0068858_100000443
395 Ga0068860_100001858
396 Ga0081539_10008539
397 Ga0081539_10059063
398 Ga0081539_10298798
399 Ga0070717_10195576
400 Ga0070717_10323943
401 Ga0070717_11030081
402 Ga0075365_10011424
403 Ga0075364_10032057
404 Ga0070715_10218297
405 Ga0070716_100060387
406 Ga0070716_100097115
407 Ga0070716_100137428
408 Ga0070716_100332124
409 Ga0070712_100118577
410 Ga0070712_100190650
411 Ga0070712_100266950
412 Ga0075433_10533526
413 Ga0075436_100161103
414 Ga0097620_100035127
415 Ga0097620_100061237
416 Ga0097620_100380248
417 Ga0097620_101131985
418 Ga0075435_100609519
419 Ga0105240_10021475
420 Ga0105247_10000142
421 Ga0105247_10027397
422 Ga0105243_10210118
423 Ga0105241_10042300
424 Ga0105241_10650849
425 Ga0105242_10072785
426 Ga0105242_10077459
427 Ga0105242_10455567
428 Ga0105248_10101042
429 Ga0105248_10292993
430 Ga0105238_10124492
431 Ga0105238_10131900
432 Ga0105238_10398099
433 Ga0105238_10475903
434 Ga0099796_10044708
435 Ga0105239_10196727
436 Ga0105239_11536820
437 Ga0105239_11670858
438 Ga0105246_10894970
439 Ga0157370_10317499
440 Ga0157370_10367310
441 Ga0157369_10465617
442 Ga0157369_11314177
443 Ga0157374_10091147
444 Ga0157374_10130340
445 Ga0157374_10752882
446 Ga0157378_10070160
447 Ga0157372_10202999
448 Ga0157372_11232039
449 Ga0157380_10367547
450 Ga0157379_10010007
451 Ga0206355_1388964
452 Ga0206351_10745108
453 Ga0206350_11545301
454 Ga0154015_1206444
455 Ga0224712_10028155
456 Ga0207672_1000598
457 Ga0207692_10134932
458 Ga0207692_10202146
459 Ga0207692_10489821
460 Ga0207710_10000001
461 Ga0207710_10129197
462 Ga0207699_10138225
463 Ga0207705_10126714
464 Ga0207705_10896844
465 Ga0207684_10365219
466 Ga0207654_10018445
467 Ga0207707_10070523
468 Ga0207707_10208001
469 Ga0207695_10304135
470 Ga0207693_10044388
471 Ga0207693_10284243
472 Ga0207663_10045613
473 Ga0207663_10800915
474 Ga0207660_10039376
475 Ga0207652_10040248
476 Ga0207652_11178725
477 Ga0207646_10017738
478 Ga0207646_10244209
479 Ga0207681_10004339
480 Ga0207694_10194066
481 Ga0207694_10223051
482 Ga0207694_10313566
483 Ga0207650_10029226
484 Ga0207659_10089908
485 Ga0207700_10024041
486 Ga0207700_10037274
487 Ga0207700_10281318
488 Ga0207700_10282678
489 Ga0207700_10492249
490 Ga0207664_10009227
491 Ga0207664_10438254
492 Ga0207664_10582818
493 Ga0207664_10891428
494 Ga0207644_10002643
495 Ga0207644_10784919
496 Ga0207686_10114083
497 Ga0207686_10596447
498 Ga0207686_10779887
499 Ga0207709_10350496
500 Ga0207670_10017283
501 Ga0207670_10346382
502 Ga0207665_10000045
503 Ga0207665_10004993
504 Ga0207665_10175068
505 Ga0207665_10182802
506 Ga0207711_10044833
507 Ga0207661_10293168
508 Ga0207667_10089435
509 Ga0207651_10708871
510 Ga0207677_10147573
511 Ga0207703_10000818
512 Ga0207703_10659206
513 Ga0207703_11178447
514 Ga0207639_10145553
515 Ga0207708_10322801
516 Ga0207702_10019229
517 Ga0207641_10019185
518 Ga0207641_10460106
519 Ga0207674_10054611
520 Ga0207698_10061432
521 Ga0207698_10447517
522 Ga0209970_1000375
523 Ga0268265_10029162
524 Ga0268264_10000226
525 Ga0265326_10075304
526 Ga0316177_1214336
527 Ga0314311_1255289
528 Ga0316182_1155537
529 Ga0265320_10081725
530 Ga0265320_10108765
531 Ga0307513_10014167
532 Ga0307408_100000034
533 Ga0373926_0305614
534 Ga0373923_0312269
535 Ga0373936_0150917
536 Ga0373936_0311199
537 Ga0373945_0002570
538 Ga0373953_0140299
539 Ga0373956_0091516
540 Ga0373956_0103691
541 Ga0373957_0049865
542 Ga0373943_0044770
543 Ga0373955_0000430
544 Ga0373924_0000790
545 Ga0373924_0041101
546 Ga0373924_0074524
547 Ga0373935_0009571
548 Ga0373935_0134835
549 Ga0373935_0411535
550 Ga0373933_0055975
551 Ga0373933_0274220
552 Ga0373947_0006211
553 Ga0373947_0024403
554 Ga0373937_0166046
555 Ga0373937_0221186
556 Ga0373937_1293819
557 Ga0373937_1443157
558 Ga0373925_0089845
559 Ga0373925_0211609
560 Ga0373925_1021292
561 Ga0395900_0757106
562 Ga0395898_0648919
563 Ga0395901_1025923
564 Ga0436362_1168247
565 Ga0451577_0126127
566 Ga0466961_0085978
567 Ga0466963_0002995
568 Ga0466963_0141577
569 Ga0453684_0290350
570 Ga0466970_0590951
571 Ga0466957_0000161
572 Ga0451576_0495546
573 Ga0466958_0469470
574 Ga0466958_0556718
575 Ga0495653_0728728
576 Ga0495580_0317737
577 Ga0495639_0062195
578 Ga0495594_0341561
579 Ga0495628_0062836
580 Ga0495630_0137873
581 Ga0495630_1074942
582 Ga0495663_0000074
583 Ga0495586_0069299
584 Ga0495598_0000137
585 Ga0495621_0001775
586 Ga0495667_0760872
587 Ga0495657_0071897
588 Ga0495636_0104897
589 Ga0495674_0165690
590 Ga0495680_0187569
591 Ga0495684_0206261
592 Ga0495593_0333247
593 Ga0495614_0081032
594 Ga0496102_0124345
595 Ga0496103_0158610
596 Ga0496104_0054009
597 Ga0496105_0462667
598 Ga0496110_0076818
599 Ga0496110_0194957
600 Ga0496111_0002956
601 Ga0496111_0243471
602 Ga0496112_0000254
603 Ga0496112_0313865
604 Ga0496113_0002528
605 Ga0496113_0170555
606 Ga0501034_0779893
607 nmdc:mga00v17_6004_c1
608 nmdc:mga0yw44_48381_c1
609 nmdc:mga05p37_213749_c1
610 nmdc:mga0n895_283907_c1
611 nmdc:mga08x19_149428_c1
612 Ga0495612_0250379
613 Ga0500651_0002277
614 Ga0500658_0000558
615 Ga0587077_001137
616 Ga0587083_0002202
617 Ga0587094_017289
618 Ga0587067_003973
619 Ga0587075_001970
620 Ga0587111_0006989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.97

Map