F400596

General Info

Members Datasets Scaffolds Average Seq Length
310 198 620 308

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100033882|Ga0070707_1000338825
Length 352
Sequence MVVLLGALVLGGLAWLISHKRGAASAARVDGAPPRLPERPFGGKPVPAGKLPGGRIVVSGLTKEYRGVKAVDNLSFVVEPGRVTGFLGPNGAGKTTTLRMLLNLVEPTSGTATIGGTRYAGLDQPIRRVGAVLEASAAHKGRTGRDHLRVICQSAGIPLARADEVLELVGLTVADGRTFGAYSLGMRQRLGLAAALLGDPQVLILDEPANGLDPEGIQWMRDLLRTLAAHGRTVLLSSHLLAEMKLLADDLIIIAAGRLAARGTVASIVSSMTHGGRILVRTPEPGKLAAVLGSDAVVTPAGDGDVYITGVDAVAVGDAAQRAGIAIYQLVTDRPDLEAAFLKLTTGKAAIR

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
97 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
103 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
148 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
149 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
150 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
151 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
152 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
153 2501939600 Micromonospora sp. L5 Isolate Unclassified
154 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
155 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
156 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
157 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
158 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
159 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
160 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
161 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
162 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
163 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
164 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
165 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
166 2855683550 Micromonospora sp. RP3T Isolate Unclassified
167 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
168 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
169 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
170 2858868258 Micromonospora sp. MH33 Isolate Unclassified
171 2858882152 Micromonospora noduli MED15 Isolate Nodule
172 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
173 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
174 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
175 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
176 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
177 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
178 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
179 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
180 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
181 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
182 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
183 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
184 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
185 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
186 2902582711 Micromonospora sp. AP08 Isolate Unclassified
187 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
188 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
189 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
190 649633069 Micromonospora sp. L5 Isolate Unclassified
191 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
192 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
193 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
194 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
195 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
196 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
197 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
198 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.55
Metatranscriptomes 0.65
Isolates 15.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.9
Nodule 1.94
Rhizoplane 6.45
Rhizosphere 73.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100033882 3300005468 Bacteria 4870
2 Ga0070658_10019828 3300005327 Bacteria 5386
3 Ga0070683_100004290 3300005329 Bacteria 11712
4 Ga0068869_100300010 3300005334 Bacteria 1297
5 Ga0068868_100027912 3300005338 Bacteria 4309
6 Ga0070660_100077544 3300005339 Bacteria 2604
7 Ga0070661_100062152 3300005344 Bacteria 2742
8 Ga0070668_100007382 3300005347 Bacteria 8156
9 Ga0070668_100312935 3300005347 Bacteria 1320
10 Ga0070669_100143972 3300005353 Bacteria 1840
11 Ga0070675_100000684 3300005354 Bacteria 23534
12 Ga0070659_100016817 3300005366 Bacteria 5496
13 Ga0070709_10179646 3300005434 Bacteria 1485
14 Ga0070713_100055048 3300005436 Bacteria 3304
15 Ga0070700_100024304 3300005441 Bacteria 3556
16 Ga0070663_100013926 3300005455 Bacteria 5147
17 Ga0070681_10063490 3300005458 Bacteria 3665
18 Ga0070679_100060966 3300005530 Bacteria 3760
19 Ga0070684_100002267 3300005535 Bacteria 14163
20 Ga0070684_100043723 3300005535 Bacteria 3870
21 Ga0068853_100209874 3300005539 Bacteria 1775
22 Ga0070665_100328607 3300005548 Bacteria 1533
23 Ga0070664_100000898 3300005564 Bacteria 23161
24 Ga0070664_100350005 3300005564 Bacteria 1344
25 Ga0068857_100003909 3300005577 Bacteria 12541
26 Ga0068857_100060352 3300005577 Bacteria 3369
27 Ga0068857_100477518 3300005577 Bacteria 1168
28 Ga0068859_100129543 3300005617 Bacteria 2594
29 Ga0068864_100007939 3300005618 Bacteria 8745
30 Ga0068864_100017779 3300005618 Bacteria 5931
31 Ga0068864_100025089 3300005618 Bacteria 5018
32 Ga0068858_100030142 3300005842 Bacteria 5037
33 Ga0068862_100128226 3300005844 Bacteria 2242
34 Ga0081540_1004496 3300005983 Bacteria 10592
35 Ga0081540_1024707 3300005983 Bacteria 3480
36 Ga0081540_1037577 3300005983 Bacteria 2564
37 Ga0081539_10000333 3300005985 Bacteria 104623
38 Ga0081539_10001151 3300005985 Bacteria 47918
39 Ga0081539_10010823 3300005985 Bacteria 7335
40 Ga0081539_10041804 3300005985 Bacteria 2676
41 Ga0081539_10118536 3300005985 Bacteria 1319
42 Ga0070716_100040322 3300006173 Bacteria 2597
43 Ga0070716_100126775 3300006173 Bacteria 1607
44 Ga0075428_100001715 3300006844 Bacteria 23414
45 Ga0075428_100005892 3300006844 Bacteria 13620
46 Ga0075428_100035582 3300006844 Bacteria 5488
47 Ga0075428_100112239 3300006844 Bacteria 2969
48 Ga0075428_100217446 3300006844 Bacteria 2064
49 Ga0075428_100794897 3300006844 Bacteria 1006
50 Ga0075430_100004317 3300006846 Bacteria 12008
51 Ga0075430_100099912 3300006846 Bacteria 2423
52 Ga0075430_100209333 3300006846 Bacteria 1618
53 Ga0075431_100009717 3300006847 Bacteria 9662
54 Ga0075431_100021869 3300006847 Bacteria 6539
55 Ga0075431_100115316 3300006847 Bacteria 2773
56 Ga0075431_100459983 3300006847 Bacteria 1267
57 Ga0075429_100014973 3300006880 Bacteria 6727
58 Ga0075429_100108759 3300006880 Bacteria 2423
59 Ga0097620_100129551 3300006931 Bacteria 2594
60 Ga0111539_10001345 3300009094 Bacteria 32746
61 Ga0105245_10003094 3300009098 Bacteria 14891
62 Ga0114129_10002298 3300009147 Bacteria 26495
63 Ga0114129_10002671 3300009147 Bacteria 24824
64 Ga0114129_10011629 3300009147 Bacteria 12530
65 Ga0114129_10131952 3300009147 Bacteria 3430
66 Ga0114129_10228809 3300009147 Bacteria 2505
67 Ga0114129_10242679 3300009147 Bacteria 2421
68 Ga0105248_10081472 3300009177 Bacteria 3638
69 Ga0105248_10102384 3300009177 Bacteria 3227
70 Ga0105248_10180816 3300009177 Bacteria 2377
71 Ga0105249_10313893 3300009553 Bacteria 1577
72 Ga0105239_10336276 3300010375 Bacteria 1704
73 Ga0157369_10057114 3300013105 Bacteria 4211
74 Ga0157375_10177321 3300013308 Bacteria 2281
75 Ga0157375_10517762 3300013308 Bacteria 1356
76 Ga0163163_10005786 3300014325 Bacteria 10741
77 Ga0163163_10010701 3300014325 Bacteria 8269
78 Ga0163163_10013759 3300014325 Bacteria 7416
79 Ga0163163_10122554 3300014325 Bacteria 2634
80 Ga0157377_10007015 3300014745 Bacteria 5410
81 Ga0157379_10032535 3300014968 Bacteria 4650
82 Ga0157379_10054523 3300014968 Bacteria 3572
83 Ga0157379_10084618 3300014968 Bacteria 2842
84 Ga0206354_11672759 3300020081 Bacteria 2228
85 Ga0206353_11514218 3300020082 Bacteria 3146
86 Ga0207688_10126134 3300025901 Bacteria 1497
87 Ga0207705_10036120 3300025909 Bacteria 3536
88 Ga0207657_10206914 3300025919 Bacteria 1576
89 Ga0207649_10007201 3300025920 Bacteria 6046
90 Ga0207652_10122321 3300025921 Bacteria 2316
91 Ga0207646_10163258 3300025922 Bacteria 2011
92 Ga0207681_10318496 3300025923 Bacteria 1236
93 Ga0207659_10001855 3300025926 Bacteria 12512
94 Ga0207687_10015864 3300025927 Bacteria 4944
95 Ga0207700_10055225 3300025928 Bacteria 2985
96 Ga0207664_10107187 3300025929 Bacteria 2318
97 Ga0207690_10045804 3300025932 Bacteria 2892
98 Ga0207665_10110376 3300025939 Bacteria 1932
99 Ga0207665_10148549 3300025939 Bacteria 1677
100 Ga0207711_10021119 3300025941 Bacteria 5438
101 Ga0207711_10033668 3300025941 Bacteria 4337
102 Ga0207711_10067981 3300025941 Bacteria 3085
103 Ga0207711_10150886 3300025941 Bacteria 2097
104 Ga0207661_10009163 3300025944 Bacteria 7097
105 Ga0207661_10026555 3300025944 Bacteria 4413
106 Ga0207679_10055315 3300025945 Bacteria 2924
107 Ga0207679_10374548 3300025945 Bacteria 1247
108 Ga0207712_10245898 3300025961 Bacteria 1443
109 Ga0207668_10011185 3300025972 Bacteria 5447
110 Ga0207677_10003914 3300026023 Bacteria 7929
111 Ga0207703_10040730 3300026035 Bacteria 3719
112 Ga0207703_10253723 3300026035 Bacteria 1587
113 Ga0207703_10382144 3300026035 Bacteria 1303
114 Ga0207678_10007841 3300026067 Bacteria 9423
115 Ga0207678_10095575 3300026067 Bacteria 2539
116 Ga0207708_10243256 3300026075 Bacteria 1448
117 Ga0207641_10026948 3300026088 Bacteria 4746
118 Ga0207641_10047867 3300026088 Bacteria 3607
119 Ga0207676_10043500 3300026095 Bacteria 3459
120 Ga0207676_10086158 3300026095 Bacteria 2565
121 Ga0207674_10006006 3300026116 Bacteria 14364
122 Ga0207674_10026259 3300026116 Bacteria 6191
123 Ga0207674_10104910 3300026116 Bacteria 2804
124 Ga0207674_10490444 3300026116 Bacteria 1187
125 Ga0207675_100184223 3300026118 Bacteria 2001
126 Ga0207428_10013754 3300027907 Bacteria 7055
127 Ga0268266_10254857 3300028379 Bacteria 1624
128 Ga0268265_10068202 3300028380 Bacteria 2757
129 Ga0268265_10135853 3300028380 Bacteria 2051
130 Ga0307517_10137321 3300028786 Bacteria 1733
131 Ga0307515_10000065 3300028794 Bacteria 244497
132 Ga0307515_10013547 3300028794 Bacteria 15226
133 Ga0307515_10063707 3300028794 Bacteria 5170
134 Ga0307515_10160390 3300028794 Bacteria 2297
135 Ga0307512_10009904 3300030522 Bacteria 9141
136 Ga0307512_10048870 3300030522 Bacteria 3418
137 Ga0307513_10023550 3300031456 Bacteria 7191
138 Ga0307509_10026350 3300031507 Bacteria 6484
139 Ga0307509_10053807 3300031507 Bacteria 4289
140 Ga0307509_10211888 3300031507 Bacteria 1761
141 Ga0307508_10004457 3300031616 Bacteria 13680
142 Ga0307514_10107980 3300031649 Bacteria 1981
143 Ga0307516_10043963 3300031730 Bacteria 4423
144 Ga0307516_10082190 3300031730 Bacteria 3063
145 Ga0307516_10108130 3300031730 Bacteria 2588
146 Ga0307516_10271226 3300031730 Bacteria 1383
147 Ga0307405_10000641 3300031731 Bacteria 13460
148 Ga0307405_10014096 3300031731 Bacteria 4288
149 Ga0307405_10048742 3300031731 Bacteria 2614
150 Ga0307405_10079228 3300031731 Bacteria 2141
151 Ga0307413_10359976 3300031824 Bacteria 1126
152 Ga0307410_10136340 3300031852 Bacteria 1810
153 Ga0307410_10152621 3300031852 Bacteria 1721
154 Ga0326468_10000401 3300031889 Bacteria 4581
155 Ga0307406_10006805 3300031901 Bacteria 6325
156 Ga0307406_10066126 3300031901 Bacteria 2352
157 Ga0307406_10149267 3300031901 Bacteria 1665
158 Ga0307406_10236188 3300031901 Bacteria 1368
159 Ga0307407_10007343 3300031903 Bacteria 4985
160 Ga0307412_10017271 3300031911 Bacteria 4317
161 Ga0307409_100008778 3300031995 Bacteria 6162
162 Ga0307409_100013871 3300031995 Bacteria 5211
163 Ga0307409_100018234 3300031995 Bacteria 4710
164 Ga0307409_100204390 3300031995 Bacteria 1770
165 Ga0307409_100233013 3300031995 Bacteria 1670
166 Ga0307416_100013086 3300032002 Bacteria 5626
167 Ga0307416_100257203 3300032002 Bacteria 1704
168 Ga0307411_10088160 3300032005 Bacteria 2157
169 Ga0307415_100000016 3300032126 Bacteria 78647
170 Ga0307415_100008203 3300032126 Bacteria 5779
171 Ga0307415_100056351 3300032126 Bacteria 2694
172 Ga0307415_100078351 3300032126 Bacteria 2350
173 Ga0307415_100086289 3300032126 Bacteria 2258
174 Ga0307507_10027096 3300033179 Bacteria 6154
175 Ga0373950_0009556 3300034818 Bacteria 1551
176 Ga0373936_0010513 3300035113 Bacteria 3492
177 Ga0373939_0028658 3300035114 Bacteria 1587
178 Ga0373941_0016743 3300035115 Bacteria 1998
179 Ga0373955_0067246 3300035172 Bacteria 1994
180 Ga0373942_0001304 3300035207 Bacteria 6517
181 Ga0373942_0041739 3300035207 Bacteria 1255
182 Ga0373962_0001632 3300035242 Bacteria 5327
183 Ga0373933_0051889 3300035724 Bacteria 2452
184 Ga0373947_0153211 3300035725 Bacteria 1486
185 Ga0373937_0010981 3300036401 Bacteria 7935
186 Ga0373937_0102838 3300036401 Bacteria 2653
187 Ga0373937_0425711 3300036401 Bacteria 1260
188 Ga0373937_0484092 3300036401 Bacteria 1175
189 Ga0373925_0209208 3300037068 Bacteria 1554
190 Ga0395905_0031413 3300037471 Bacteria 4999
191 Ga0395901_0463545 3300038443 Bacteria 1294
192 Ga0451791_0106311 3300041451 Bacteria 1787
193 Ga0466963_0171843 3300044694 Bacteria 1511
194 Ga0466959_0136239 3300045049 Bacteria 1738
195 Ga0495592_0090878 3300046454 Bacteria 2190
196 Ga0495629_0179561 3300046459 Bacteria 1467
197 Ga0495651_0050618 3300046462 Bacteria 3204
198 Ga0495653_0017614 3300046463 Bacteria 5809
199 Ga0495582_0219775 3300046473 Bacteria 1087
200 Ga0495664_0183557 3300046477 Bacteria 1268
201 Ga0495606_0001366 3300046507 Bacteria 33028
202 Ga0495606_0002014 3300046507 Bacteria 24940
203 Ga0495608_0036511 3300046511 Bacteria 3308
204 Ga0495632_0159836 3300046519 Bacteria 1038
205 Ga0495667_0006440 3300046559 Bacteria 7966
206 Ga0495668_0000537 3300046616 Bacteria 47191
207 Ga0495668_0000924 3300046616 Bacteria 32766
208 Ga0495625_0002156 3300046660 Bacteria 21891
209 Ga0495625_0024534 3300046660 Bacteria 4588
210 Ga0495635_0006018 3300046663 Bacteria 8459
211 Ga0495657_0018524 3300046675 Bacteria 5034
212 Ga0495600_0008179 3300046809 Bacteria 6421
213 Ga0495680_0006893 3300047322 Bacteria 10485
214 Ga0495684_0010390 3300047471 Bacteria 7199
215 Ga0495626_0000130 3300048091 Bacteria 95069
216 Ga0495626_0000137 3300048091 Bacteria 92873
217 Ga0496104_0009090 3300048907 Bacteria 8837
218 Ga0496104_0062338 3300048907 Bacteria 3535
219 Ga0496105_0071674 3300048908 Bacteria 2863
220 Ga0496108_0000010 3300048911 Bacteria 273269
221 Ga0496108_0026998 3300048911 Bacteria 4738
222 Ga0496108_0097484 3300048911 Bacteria 2505
223 Ga0496109_0011152 3300048912 Bacteria 7709
224 Ga0496109_0126882 3300048912 Bacteria 2379
225 Ga0496109_0267532 3300048912 Bacteria 1610
226 Ga0496110_0087692 3300048913 Bacteria 2779
227 Ga0496111_0006645 3300048914 Bacteria 7524
228 Ga0496111_0010379 3300048914 Bacteria 6247
229 Ga0496111_0073245 3300048914 Bacteria 2494
230 Ga0496112_0007342 3300048915 Bacteria 9778
231 Ga0496112_0013296 3300048915 Bacteria 7599
232 Ga0496112_0014275 3300048915 Bacteria 7360
233 Ga0496112_0352393 3300048915 Bacteria 1414
234 Ga0496113_0003355 3300048916 Bacteria 9564
235 Ga0496113_0132824 3300048916 Bacteria 1954
236 Ga0501038_0261767 3300049574 Bacteria 1367
237 Ga0501047_0047135 3300049581 Bacteria 4164
238 Ga0501044_0079227 3300049823 Bacteria 3329
239 nmdc:mga05p37_18948_c1 3300050507 Bacteria 8322
240 nmdc:mga05p37_259821_c1 3300050507 Bacteria 2079
241 nmdc:mga05p37_59810_c1 3300050507 Bacteria 4692
242 nmdc:mga05p37_65586_c1 3300050507 Bacteria 4467
243 nmdc:mga09592_534_c1 3300050508 Bacteria 7213
244 nmdc:mga0qj67_15_c4 3300050509 Bacteria 7213
245 nmdc:mga0qj67_223480_c1 3300050509 Bacteria 1528
246 nmdc:mga0qj67_3461_c1 3300050509 Bacteria 11377
247 nmdc:mga06r32_18261_c1 3300050510 Bacteria 6419
248 nmdc:mga06r32_184378_c1 3300050510 Bacteria 2073
249 nmdc:mga06r32_3177_c1 3300050510 Bacteria 6860
250 nmdc:mga06r32_447_c1 3300050510 Bacteria 28100
251 nmdc:mga06r32_82115_c1 3300050510 Bacteria 3139
252 nmdc:mga08y16_55681_c1 3300050511 Bacteria 4132
253 Ga0500644_0010649 3300053088 Bacteria 2493
254 Ga0500646_0003646 3300053090 Bacteria 3944
255 Ga0500583_0038133 3300053092 Bacteria 2162
256 Ga0500583_0072444 3300053092 Bacteria 1650
257 Ga0500583_0080608 3300053092 Bacteria 1572
258 Ga0500651_0017913 3300053093 Bacteria 4379
259 Ga0500641_0052669 3300053096 Bacteria 1678
260 Ga0500588_0003706 3300053146 Bacteria 3248
261 Ga0500588_0003735 3300053146 Bacteria 3239
262 2501940319 2501939600 Bacteria 6907073
263 2515496290 2515154088 Bacteria 5526283
264 2515718540 2515154129 Bacteria 5584369
265 2515756550 2515154137 Bacteria 5711575
266 2516089224 2515154203 Bacteria 5458536
267 2623591533 2622736626 Bacteria 7181580
268 2676481182 2675903059 Bacteria 8644972
269 2753267473 2751185782 Bacteria 11227053
270 2753270349 2751185782 Bacteria 11227053
271 2772645726 2772190715 Bacteria 6959372
272 2831938419 2831935698 Bacteria 5963223
273 2832007211 2832004796 Bacteria 6538017
274 2855670600 2855670206 Bacteria 7120389
275 2855683481 2855676851 Bacteria 7063653
276 2855687271 2855683550 Bacteria 7134265
277 2856858582 2856858025 Bacteria 7255264
278 2857288946 2857288857 Bacteria 7189066
279 2858854228 2858848962 Bacteria 6963058
280 2858875410 2858868258 Bacteria 7683772
281 2858887207 2858882152 Bacteria 7230291
282 2858892131 2858888857 Bacteria 7060307
283 2858897825 2858895516 Bacteria 7378898
284 2858903214 2858902515 Bacteria 7086037
285 2866065922 2866065130 Bacteria 6518152
286 2867305493 2867302475 Bacteria 7087181
287 2867316748 2867312974 Bacteria 7058875
288 2867321941 2867319477 Bacteria 7069771
289 2867512254 2867507094 Bacteria 6506033
290 2869050816 2869048445 Bacteria 6875584
291 2869065688 2869061728 Bacteria 7112407
292 2869070584 2869068681 Bacteria 7205615
293 2880495555 2880489317 Bacteria 7096270
294 2880496798 2880495981 Bacteria 7340502
295 2887478938 2887478801 Bacteria 8972725
296 2887482433 2887478801 Bacteria 8972725
297 2902583883 2902582711 Bacteria 6187705
298 2929225422 2929219909 Bacteria 6984360
299 2929231601 2929226422 Bacteria 7248583
300 2996223999 2996221748 Bacteria 6799777
301 649813236 649633069 Bacteria 6962533
302 8001783524 8001781756 Bacteria 9586736
303 8001785594 8001781756 Bacteria 9586736
304 8003833983 8003830390 Bacteria 6541657
305 8003863256 8003856774 Bacteria 7675274
306 8003877815 8003870546 Bacteria 7396674
307 8054708285 8054704163 Bacteria 7247792
308 8054734382 8054727385 Bacteria 7558670
309 8054740147 8054734606 Bacteria 6947278
310 8055417630 8055412473 Bacteria 6257500
311 Ga0070707_100033882
312 Ga0070658_10019828
313 Ga0070683_100004290
314 Ga0068869_100300010
315 Ga0068868_100027912
316 Ga0070660_100077544
317 Ga0070661_100062152
318 Ga0070668_100007382
319 Ga0070668_100312935
320 Ga0070669_100143972
321 Ga0070675_100000684
322 Ga0070659_100016817
323 Ga0070709_10179646
324 Ga0070713_100055048
325 Ga0070700_100024304
326 Ga0070663_100013926
327 Ga0070681_10063490
328 Ga0070679_100060966
329 Ga0070684_100002267
330 Ga0070684_100043723
331 Ga0068853_100209874
332 Ga0070665_100328607
333 Ga0070664_100000898
334 Ga0070664_100350005
335 Ga0068857_100003909
336 Ga0068857_100060352
337 Ga0068857_100477518
338 Ga0068859_100129543
339 Ga0068864_100007939
340 Ga0068864_100017779
341 Ga0068864_100025089
342 Ga0068858_100030142
343 Ga0068862_100128226
344 Ga0081540_1004496
345 Ga0081540_1024707
346 Ga0081540_1037577
347 Ga0081539_10000333
348 Ga0081539_10001151
349 Ga0081539_10010823
350 Ga0081539_10041804
351 Ga0081539_10118536
352 Ga0070716_100040322
353 Ga0070716_100126775
354 Ga0075428_100001715
355 Ga0075428_100005892
356 Ga0075428_100035582
357 Ga0075428_100112239
358 Ga0075428_100217446
359 Ga0075428_100794897
360 Ga0075430_100004317
361 Ga0075430_100099912
362 Ga0075430_100209333
363 Ga0075431_100009717
364 Ga0075431_100021869
365 Ga0075431_100115316
366 Ga0075431_100459983
367 Ga0075429_100014973
368 Ga0075429_100108759
369 Ga0097620_100129551
370 Ga0111539_10001345
371 Ga0105245_10003094
372 Ga0114129_10002298
373 Ga0114129_10002671
374 Ga0114129_10011629
375 Ga0114129_10131952
376 Ga0114129_10228809
377 Ga0114129_10242679
378 Ga0105248_10081472
379 Ga0105248_10102384
380 Ga0105248_10180816
381 Ga0105249_10313893
382 Ga0105239_10336276
383 Ga0157369_10057114
384 Ga0157375_10177321
385 Ga0157375_10517762
386 Ga0163163_10005786
387 Ga0163163_10010701
388 Ga0163163_10013759
389 Ga0163163_10122554
390 Ga0157377_10007015
391 Ga0157379_10032535
392 Ga0157379_10054523
393 Ga0157379_10084618
394 Ga0206354_11672759
395 Ga0206353_11514218
396 Ga0207688_10126134
397 Ga0207705_10036120
398 Ga0207657_10206914
399 Ga0207649_10007201
400 Ga0207652_10122321
401 Ga0207646_10163258
402 Ga0207681_10318496
403 Ga0207659_10001855
404 Ga0207687_10015864
405 Ga0207700_10055225
406 Ga0207664_10107187
407 Ga0207690_10045804
408 Ga0207665_10110376
409 Ga0207665_10148549
410 Ga0207711_10021119
411 Ga0207711_10033668
412 Ga0207711_10067981
413 Ga0207711_10150886
414 Ga0207661_10009163
415 Ga0207661_10026555
416 Ga0207679_10055315
417 Ga0207679_10374548
418 Ga0207712_10245898
419 Ga0207668_10011185
420 Ga0207677_10003914
421 Ga0207703_10040730
422 Ga0207703_10253723
423 Ga0207703_10382144
424 Ga0207678_10007841
425 Ga0207678_10095575
426 Ga0207708_10243256
427 Ga0207641_10026948
428 Ga0207641_10047867
429 Ga0207676_10043500
430 Ga0207676_10086158
431 Ga0207674_10006006
432 Ga0207674_10026259
433 Ga0207674_10104910
434 Ga0207674_10490444
435 Ga0207675_100184223
436 Ga0207428_10013754
437 Ga0268266_10254857
438 Ga0268265_10068202
439 Ga0268265_10135853
440 Ga0307517_10137321
441 Ga0307515_10000065
442 Ga0307515_10013547
443 Ga0307515_10063707
444 Ga0307515_10160390
445 Ga0307512_10009904
446 Ga0307512_10048870
447 Ga0307513_10023550
448 Ga0307509_10026350
449 Ga0307509_10053807
450 Ga0307509_10211888
451 Ga0307508_10004457
452 Ga0307514_10107980
453 Ga0307516_10043963
454 Ga0307516_10082190
455 Ga0307516_10108130
456 Ga0307516_10271226
457 Ga0307405_10000641
458 Ga0307405_10014096
459 Ga0307405_10048742
460 Ga0307405_10079228
461 Ga0307413_10359976
462 Ga0307410_10136340
463 Ga0307410_10152621
464 Ga0326468_10000401
465 Ga0307406_10006805
466 Ga0307406_10066126
467 Ga0307406_10149267
468 Ga0307406_10236188
469 Ga0307407_10007343
470 Ga0307412_10017271
471 Ga0307409_100008778
472 Ga0307409_100013871
473 Ga0307409_100018234
474 Ga0307409_100204390
475 Ga0307409_100233013
476 Ga0307416_100013086
477 Ga0307416_100257203
478 Ga0307411_10088160
479 Ga0307415_100000016
480 Ga0307415_100008203
481 Ga0307415_100056351
482 Ga0307415_100078351
483 Ga0307415_100086289
484 Ga0307507_10027096
485 Ga0373950_0009556
486 Ga0373936_0010513
487 Ga0373939_0028658
488 Ga0373941_0016743
489 Ga0373955_0067246
490 Ga0373942_0001304
491 Ga0373942_0041739
492 Ga0373962_0001632
493 Ga0373933_0051889
494 Ga0373947_0153211
495 Ga0373937_0010981
496 Ga0373937_0102838
497 Ga0373937_0425711
498 Ga0373937_0484092
499 Ga0373925_0209208
500 Ga0395905_0031413
501 Ga0395901_0463545
502 Ga0451791_0106311
503 Ga0466963_0171843
504 Ga0466959_0136239
505 Ga0495592_0090878
506 Ga0495629_0179561
507 Ga0495651_0050618
508 Ga0495653_0017614
509 Ga0495582_0219775
510 Ga0495664_0183557
511 Ga0495606_0001366
512 Ga0495606_0002014
513 Ga0495608_0036511
514 Ga0495632_0159836
515 Ga0495667_0006440
516 Ga0495668_0000537
517 Ga0495668_0000924
518 Ga0495625_0002156
519 Ga0495625_0024534
520 Ga0495635_0006018
521 Ga0495657_0018524
522 Ga0495600_0008179
523 Ga0495680_0006893
524 Ga0495684_0010390
525 Ga0495626_0000130
526 Ga0495626_0000137
527 Ga0496104_0009090
528 Ga0496104_0062338
529 Ga0496105_0071674
530 Ga0496108_0000010
531 Ga0496108_0026998
532 Ga0496108_0097484
533 Ga0496109_0011152
534 Ga0496109_0126882
535 Ga0496109_0267532
536 Ga0496110_0087692
537 Ga0496111_0006645
538 Ga0496111_0010379
539 Ga0496111_0073245
540 Ga0496112_0007342
541 Ga0496112_0013296
542 Ga0496112_0014275
543 Ga0496112_0352393
544 Ga0496113_0003355
545 Ga0496113_0132824
546 Ga0501038_0261767
547 Ga0501047_0047135
548 Ga0501044_0079227
549 nmdc:mga05p37_18948_c1
550 nmdc:mga05p37_259821_c1
551 nmdc:mga05p37_59810_c1
552 nmdc:mga05p37_65586_c1
553 nmdc:mga09592_534_c1
554 nmdc:mga0qj67_15_c4
555 nmdc:mga0qj67_223480_c1
556 nmdc:mga0qj67_3461_c1
557 nmdc:mga06r32_18261_c1
558 nmdc:mga06r32_184378_c1
559 nmdc:mga06r32_3177_c1
560 nmdc:mga06r32_447_c1
561 nmdc:mga06r32_82115_c1
562 nmdc:mga08y16_55681_c1
563 Ga0500644_0010649
564 Ga0500646_0003646
565 Ga0500583_0038133
566 Ga0500583_0072444
567 Ga0500583_0080608
568 Ga0500651_0017913
569 Ga0500641_0052669
570 Ga0500588_0003706
571 Ga0500588_0003735
572 2501940319
573 2515496290
574 2515718540
575 2515756550
576 2516089224
577 2623591533
578 2676481182
579 2753267473
580 2753270349
581 2772645726
582 2831938419
583 2832007211
584 2855670600
585 2855683481
586 2855687271
587 2856858582
588 2857288946
589 2858854228
590 2858875410
591 2858887207
592 2858892131
593 2858897825
594 2858903214
595 2866065922
596 2867305493
597 2867316748
598 2867321941
599 2867512254
600 2869050816
601 2869065688
602 2869070584
603 2880495555
604 2880496798
605 2887478938
606 2887482433
607 2902583883
608 2929225422
609 2929231601
610 2996223999
611 649813236
612 8001783524
613 8001785594
614 8003833983
615 8003863256
616 8003877815
617 8054708285
618 8054734382
619 8054740147
620 8055417630

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

71

210

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

140

245

0.91

PF13401

AAA_22

AAA domain

80

243

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9256 19 233
5lj7-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) 0.9193 20 228
5lil-assembly1.cif.gz_A structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) 0.9174 20 228
1l2t-assembly1.cif.gz_B dimeric structure of mj0796, a bacterial abc transporter cassette 0.916 20 228
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9081 18 238
ID Description Score Start End Superfamily
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9524 17 237 3.40.50.300
af_Q2FXB7_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9461 18 228 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9408 18 235 3.40.50.300
af_Q2FVB4_1_230_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9346 20 228 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9284 16 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3N0DQ34-F1-model_v4 ATP-binding cassette domain-containing protein 0.9788 18 233 GO:0005524
GO:0016887
AF-A0A857LT42-F1-model_v4 ATP-binding cassette domain-containing protein 0.9663 21 233 GO:0005524
GO:0016887
AF-A0A6N4V0M8-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9638 20 233 GO:0005524
GO:0016887
AF-A0A4S2R1P0-F1-model_v4 ABC transporter ATP-binding protein 0.9609 20 311 GO:0005524
GO:0016887
AF-A0A3L7J281-F1-model_v4 ATP-binding cassette domain-containing protein 0.9497 20 313 GO:0005524
GO:0016887

Map