F400589

General Info

Members Datasets Scaffolds Average Seq Length
310 200 310 399

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10054528|Ga0070681_100545283
Length 405
Sequence MSQRSFLFTSESVTEGHPDKIANDPLSRVACETLITTGLVVVAGEMTTETYIDIPRIVRDTVKAIGYTRAKYGFDAETCGVMVALDEQSPDIAQGVDSAYELQHDPSDDDPLDRVGAGDQGMMFGYASNETRELMPLPIMLAHRIAKRLSEVRKADVLPYLRPDGKAQVSIRYEVDADGRQRPVEIERVLISTQHREGLDPDAMIKPDLVEQVLRPVLPKDFYDEKSLDDPAFFYVNPTGKFVIGGPMGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYAARYVAKNVVAAGLADRCQIQVAYAIGVARPFSILVETFGTEHLPVSRIEALVEEHFDLRPAAILRDLDLRRPIYQKTAAYGHFGRDDHDFTWERTDKAAALRASAGLAATTTATVV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
79 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
193 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 11.61
Rhizosphere 83.23
Stem 0
Stem Tuber 0
Unclassified 3.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10009703 3300003203 Bacteria 4303
2 Ga0070683_100008970 3300005329 Bacteria 8524
3 Ga0070683_100089976 3300005329 Bacteria 2881
4 Ga0068868_100096171 3300005338 Bacteria 2392
5 Ga0068868_100149392 3300005338 Bacteria 1923
6 Ga0070691_10060641 3300005341 Bacteria 1819
7 Ga0070661_100011588 3300005344 Bacteria 6146
8 Ga0070661_100134443 3300005344 Bacteria 1860
9 Ga0070659_100000013 3300005366 Bacteria 178795
10 Ga0070714_100000137 3300005435 Bacteria 58260
11 Ga0070713_100277836 3300005436 Bacteria 1535
12 Ga0070710_10000005 3300005437 Bacteria 238049
13 Ga0070700_100003875 3300005441 Bacteria 7767
14 Ga0070681_10039979 3300005458 Bacteria 4702
15 Ga0070681_10054528 3300005458 Bacteria 3984
16 Ga0070685_10054767 3300005466 Bacteria 2315
17 Ga0070679_100143887 3300005530 Bacteria 2363
18 Ga0070684_100007099 3300005535 Bacteria 8704
19 Ga0070693_100014738 3300005547 Bacteria 4012
20 Ga0068857_100113480 3300005577 Bacteria 2436
21 Ga0068856_100042436 3300005614 Bacteria 4474
22 Ga0070702_100017424 3300005615 Bacteria 3705
23 Ga0068852_100023712 3300005616 Bacteria 4945
24 Ga0068859_100167224 3300005617 Bacteria 2279
25 Ga0068864_100013823 3300005618 Bacteria 6689
26 Ga0068870_10151976 3300005840 Bacteria 1364
27 Ga0081538_10002486 3300005981 Bacteria 17973
28 Ga0081538_10015722 3300005981 Bacteria 5842
29 Ga0081538_10031088 3300005981 Bacteria 3609
30 Ga0081540_1056370 3300005983 Bacteria 1908
31 Ga0081539_10002505 3300005985 Bacteria 25722
32 Ga0070717_10000004 3300006028 Bacteria 365525
33 Ga0070712_100004885 3300006175 Bacteria 8291
34 Ga0070712_100028203 3300006175 Bacteria 3754
35 Ga0075428_100223107 3300006844 Bacteria 2035
36 Ga0075430_100015786 3300006846 Bacteria 6431
37 Ga0075431_100003273 3300006847 Bacteria 15676
38 Ga0075433_10203798 3300006852 Bacteria 1758
39 Ga0075434_100013486 3300006871 Bacteria 7781
40 Ga0068865_100135876 3300006881 Bacteria 1848
41 Ga0097620_100167231 3300006931 Bacteria 2279
42 Ga0075435_100101629 3300007076 Bacteria 2383
43 Ga0111539_10004878 3300009094 Bacteria 17468
44 Ga0105245_10006226 3300009098 Bacteria 10494
45 Ga0105245_10068630 3300009098 Bacteria 3213
46 Ga0105248_10056806 3300009177 Bacteria 4391
47 Ga0105237_10001714 3300009545 Bacteria 28350
48 Ga0105237_10230915 3300009545 Bacteria 1851
49 Ga0105249_10224839 3300009553 Bacteria 1848
50 Ga0105239_10014189 3300010375 Bacteria 8842
51 Ga0105239_10051705 3300010375 Bacteria 4504
52 Ga0105246_10051006 3300011119 Bacteria 2839
53 Ga0105246_10159528 3300011119 Bacteria 1717
54 Ga0157374_10017109 3300013296 Bacteria 6383
55 Ga0157372_10033688 3300013307 Bacteria 5628
56 Ga0157372_10045425 3300013307 Bacteria 4873
57 Ga0157372_10101330 3300013307 Bacteria 3287
58 Ga0157375_10034974 3300013308 Bacteria 4791
59 Ga0157379_10005561 3300014968 Bacteria 10829
60 Ga0206354_10329131 3300020081 Bacteria 4119
61 Ga0206353_10644669 3300020082 Bacteria 6644
62 Ga0213876_10037706 3300021384 Bacteria 2550
63 Ga0213875_10013713 3300021388 Bacteria 3971
64 Ga0207692_10000009 3300025898 Bacteria 159859
65 Ga0207692_10073290 3300025898 Bacteria 1811
66 Ga0207688_10002609 3300025901 Bacteria 9755
67 Ga0207688_10045745 3300025901 Bacteria 2442
68 Ga0207707_10050033 3300025912 Bacteria 3641
69 Ga0207671_10001437 3300025914 Bacteria 27616
70 Ga0207693_10000014 3300025915 Bacteria 148984
71 Ga0207693_10000327 3300025915 Bacteria 43947
72 Ga0207693_10016198 3300025915 Bacteria 5960
73 Ga0207693_10027118 3300025915 Bacteria 4530
74 Ga0207660_10102320 3300025917 Bacteria 2141
75 Ga0207657_10012370 3300025919 Bacteria 8430
76 Ga0207649_10040832 3300025920 Bacteria 2823
77 Ga0207652_10158347 3300025921 Bacteria 2029
78 Ga0207687_10168608 3300025927 Bacteria 1687
79 Ga0207700_10221126 3300025928 Bacteria 1605
80 Ga0207664_10000006 3300025929 Bacteria 408702
81 Ga0207664_10009347 3300025929 Bacteria 6875
82 Ga0207690_10000017 3300025932 Bacteria 243513
83 Ga0207706_10022357 3300025933 Bacteria 5674
84 Ga0207709_10138985 3300025935 Bacteria 1667
85 Ga0207669_10012401 3300025937 Bacteria 4189
86 Ga0207669_10030081 3300025937 Bacteria 3013
87 Ga0207689_10070989 3300025942 Bacteria 2860
88 Ga0207661_10004279 3300025944 Bacteria 9996
89 Ga0207661_10009376 3300025944 Bacteria 7018
90 Ga0207661_10044840 3300025944 Bacteria 3497
91 Ga0207677_10043691 3300026023 Bacteria 2981
92 Ga0207677_10085488 3300026023 Bacteria 2277
93 Ga0207677_10187419 3300026023 Bacteria 1633
94 Ga0207708_10000262 3300026075 Bacteria 41463
95 Ga0207702_10073170 3300026078 Bacteria 2954
96 Ga0207702_10180588 3300026078 Bacteria 1943
97 Ga0207676_10071117 3300026095 Bacteria 2792
98 Ga0207674_10065151 3300026116 Bacteria 3674
99 Ga0207675_100171243 3300026118 Bacteria 2075
100 Ga0207428_10087947 3300027907 Bacteria 2417
101 Ga0207428_10110783 3300027907 Bacteria 2113
102 Ga0268266_10187300 3300028379 Bacteria 1888
103 Ga0268264_10107165 3300028381 Bacteria 2441
104 Ga0265326_10000045 3300028558 Bacteria 79810
105 Ga0265326_10000454 3300028558 Bacteria 16072
106 Ga0265319_1009115 3300028563 Bacteria 4264
107 Ga0265334_10000012 3300028573 Bacteria 174358
108 Ga0265318_10005414 3300028577 Bacteria 5993
109 Ga0265322_10009612 3300028654 Bacteria 2806
110 Ga0265336_10000002 3300028666 Bacteria 830172
111 Ga0265338_10000001 3300028800 Bacteria 1177449
112 Ga0265338_10007079 3300028800 Bacteria 14059
113 Ga0265340_10000001 3300031247 Bacteria 1647668
114 Ga0265327_10004633 3300031251 Bacteria 12058
115 Ga0265327_10014238 3300031251 Bacteria 5213
116 Ga0265316_10017330 3300031344 Bacteria 6232
117 Ga0307408_100122348 3300031548 Bacteria 2018
118 Ga0307410_10026998 3300031852 Bacteria 3623
119 Ga0307407_10131384 3300031903 Bacteria 1602
120 Ga0307409_100078772 3300031995 Bacteria 2652
121 Ga0307415_100032615 3300032126 Bacteria 3371
122 Ga0373934_0000106 3300035086 Bacteria 29764
123 Ga0373923_0042578 3300035111 Bacteria 1876
124 Ga0373953_0000028 3300035117 Bacteria 39179
125 Ga0373953_0011505 3300035117 Bacteria 3108
126 Ga0373954_0025049 3300035118 Bacteria 2724
127 Ga0373954_0081389 3300035118 Bacteria 1547
128 Ga0373956_0000564 3300035119 Bacteria 15211
129 Ga0373957_0000046 3300035120 Bacteria 31769
130 Ga0373955_0000151 3300035172 Bacteria 27642
131 Ga0373924_0000889 3300035410 Bacteria 9429
132 Ga0373933_0000012 3300035724 Bacteria 108156
133 Ga0373937_0000040 3300036401 Bacteria 108935
134 Ga0395900_0064832 3300037418 Bacteria 3753
135 Ga0395898_0059817 3300037466 Bacteria 3705
136 Ga0395898_0145660 3300037466 Bacteria 2267
137 Ga0395898_0204210 3300037466 Bacteria 1886
138 Ga0436364_0002493 3300037853 Bacteria 4315
139 Ga0436364_0766301 3300037853 Bacteria 7786
140 Ga0436364_0792922 3300037853 Bacteria 20571
141 Ga0436364_1394916 3300037853 Bacteria 7949
142 Ga0395901_0102826 3300038443 Bacteria 2998
143 Ga0395901_0229721 3300038443 Bacteria 1937
144 Ga0436365_0260735 3300039437 Bacteria 1309
145 Ga0436365_1591814 3300039437 Bacteria 7603
146 Ga0436363_0002799 3300039450 Bacteria 2631
147 Ga0436363_0254668 3300039450 Bacteria 1794
148 Ga0436363_0805533 3300039450 Bacteria 51825
149 Ga0436363_1198065 3300039450 Bacteria 1472
150 Ga0466966_0089186 3300044684 Bacteria 1916
151 Ga0466966_0124758 3300044684 Bacteria 1580
152 Ga0466961_0001531 3300044693 Bacteria 14313
153 Ga0466961_0045814 3300044693 Bacteria 2798
154 Ga0466963_0017143 3300044694 Bacteria 4511
155 Ga0466963_0020607 3300044694 Bacteria 4146
156 Ga0466963_0031981 3300044694 Bacteria 3403
157 Ga0466964_0014695 3300044706 Bacteria 2978
158 Ga0466971_0000264 3300044719 Bacteria 20112
159 Ga0466971_0048246 3300044719 Bacteria 1914
160 Ga0466970_0047033 3300044765 Bacteria 2299
161 Ga0466970_0054777 3300044765 Bacteria 2130
162 Ga0466957_0025102 3300044842 Bacteria 3530
163 Ga0466957_0100227 3300044842 Bacteria 1825
164 Ga0466960_0000071 3300044901 Bacteria 33077
165 Ga0466960_0054292 3300044901 Bacteria 1945
166 Ga0466959_0011559 3300045049 Bacteria 6344
167 Ga0466959_0037199 3300045049 Bacteria 3596
168 Ga0466959_0087221 3300045049 Bacteria 2245
169 Ga0466958_0000900 3300045836 Bacteria 13345
170 Ga0466958_0005873 3300045836 Bacteria 6642
171 Ga0466958_0061232 3300045836 Bacteria 2292
172 Ga0466967_0003511 3300045976 Bacteria 10247
173 Ga0466967_0014961 3300045976 Bacteria 6067
174 Ga0466967_0023715 3300045976 Bacteria 5032
175 Ga0466967_0035907 3300045976 Bacteria 4224
176 Ga0466967_0280235 3300045976 Bacteria 1599
177 Ga0495592_0000311 3300046454 Bacteria 40958
178 Ga0495641_0002845 3300046461 Bacteria 13394
179 Ga0495651_0000040 3300046462 Bacteria 94890
180 Ga0495651_0015650 3300046462 Bacteria 5872
181 Ga0495653_0001520 3300046463 Bacteria 18130
182 Ga0495653_0003147 3300046463 Bacteria 13231
183 Ga0495650_0000079 3300046471 Bacteria 244549
184 Ga0495664_0132112 3300046477 Bacteria 1512
185 Ga0495608_0000044 3300046511 Bacteria 108171
186 Ga0495608_0020379 3300046511 Bacteria 4557
187 Ga0495618_0000805 3300046514 Bacteria 21850
188 Ga0495628_0000123 3300046516 Bacteria 64063
189 Ga0495628_0124535 3300046516 Bacteria 1975
190 Ga0495630_0000440 3300046517 Bacteria 31661
191 Ga0495631_0030931 3300046518 Bacteria 2426
192 Ga0495644_0001174 3300046523 Bacteria 10747
193 Ga0495652_0000108 3300046529 Bacteria 89636
194 Ga0495587_0000046 3300046536 Bacteria 108171
195 Ga0495645_0000021 3300046543 Bacteria 137604
196 Ga0495667_0000066 3300046559 Bacteria 84361
197 Ga0495667_0005842 3300046559 Bacteria 8337
198 Ga0495657_0000017 3300046675 Bacteria 174558
199 Ga0495657_0000205 3300046675 Bacteria 52988
200 Ga0495657_0005146 3300046675 Bacteria 10360
201 Ga0495599_0000052 3300046678 Bacteria 80904
202 Ga0495599_0074594 3300046678 Bacteria 2118
203 Ga0495623_0000247 3300046679 Bacteria 34941
204 Ga0495646_0007889 3300046680 Bacteria 6761
205 Ga0495646_0063985 3300046680 Bacteria 2182
206 Ga0495658_0007459 3300046683 Bacteria 5415
207 Ga0495581_0043482 3300047315 Bacteria 2599
208 Ga0495604_0000049 3300047317 Bacteria 108620
209 Ga0495604_0114876 3300047317 Bacteria 1957
210 Ga0495676_0070461 3300047321 Bacteria 2693
211 Ga0495680_0000908 3300047322 Bacteria 32882
212 Ga0495680_0008665 3300047322 Bacteria 9229
213 Ga0495675_0001487 3300047444 Bacteria 14183
214 Ga0495673_0008793 3300047469 Bacteria 5640
215 Ga0495684_0010845 3300047471 Bacteria 7047
216 Ga0495684_0145502 3300047471 Bacteria 1775
217 Ga0495686_0000020 3300047472 Bacteria 429191
218 Ga0495686_0038968 3300047472 Bacteria 3038
219 Ga0495602_0000232 3300048088 Bacteria 52110
220 Ga0496100_0006538 3300048903 Bacteria 6362
221 Ga0496100_0009772 3300048903 Bacteria 5401
222 Ga0496100_0101077 3300048903 Bacteria 1987
223 Ga0496101_0002545 3300048904 Bacteria 11184
224 Ga0496102_0056357 3300048905 Bacteria 3585
225 Ga0496102_0150359 3300048905 Bacteria 2188
226 Ga0496103_0079923 3300048906 Bacteria 2055
227 Ga0496104_0017521 3300048907 Bacteria 6525
228 Ga0496104_0019600 3300048907 Bacteria 6192
229 Ga0496104_0088186 3300048907 Bacteria 2963
230 Ga0496105_0018748 3300048908 Bacteria 5570
231 Ga0496105_0069285 3300048908 Bacteria 2915
232 Ga0496106_0005657 3300048909 Bacteria 9247
233 Ga0496106_0017212 3300048909 Bacteria 5351
234 Ga0496107_0007130 3300048910 Bacteria 7701
235 Ga0496108_0013579 3300048911 Bacteria 6646
236 Ga0496108_0028652 3300048911 Bacteria 4608
237 Ga0496109_0044486 3300048912 Bacteria 4028
238 Ga0496109_0113234 3300048912 Bacteria 2523
239 Ga0496109_0135974 3300048912 Bacteria 2296
240 Ga0496110_0009020 3300048913 Bacteria 8048
241 Ga0496110_0011592 3300048913 Bacteria 7225
242 Ga0496110_0011769 3300048913 Bacteria 7180
243 Ga0496111_0060102 3300048914 Bacteria 2754
244 Ga0496111_0084372 3300048914 Bacteria 2322
245 Ga0496111_0095172 3300048914 Bacteria 2185
246 Ga0496111_0147633 3300048914 Bacteria 1744
247 Ga0496112_0001374 3300048915 Bacteria 18549
248 Ga0496112_0008043 3300048915 Bacteria 9411
249 Ga0496112_0049258 3300048915 Bacteria 4129
250 Ga0496112_0051335 3300048915 Bacteria 4045
251 Ga0496112_0274990 3300048915 Bacteria 1632
252 Ga0496113_0004197 3300048916 Bacteria 8806
253 Ga0496113_0104855 3300048916 Bacteria 2194
254 Ga0496115_0000012 3300048918 Bacteria 215509
255 Ga0496115_0000017 3300048918 Bacteria 185702
256 Ga0501031_0026440 3300049568 Bacteria 3783
257 Ga0501034_0088675 3300049571 Bacteria 3091
258 Ga0501036_0048002 3300049572 Bacteria 3615
259 Ga0501039_0012217 3300049575 Bacteria 6546
260 Ga0501039_0029593 3300049575 Bacteria 4218
261 Ga0501040_0018547 3300049576 Bacteria 4620
262 Ga0501040_0054297 3300049576 Bacteria 2747
263 Ga0501040_0061747 3300049576 Bacteria 2578
264 Ga0501040_0173484 3300049576 Bacteria 1527
265 Ga0501041_0017058 3300049577 Bacteria 4321
266 Ga0501041_0032748 3300049577 Bacteria 3142
267 Ga0501042_0036191 3300049578 Bacteria 3502
268 Ga0501042_0257552 3300049578 Bacteria 1259
269 Ga0501046_0030498 3300049580 Bacteria 4376
270 Ga0501068_0113560 3300049584 Bacteria 1686
271 Ga0501071_0004687 3300049587 Bacteria 8690
272 Ga0501071_0026317 3300049587 Bacteria 4083
273 Ga0501071_0114962 3300049587 Bacteria 1991
274 Ga0501071_0120355 3300049587 Bacteria 1946
275 Ga0501072_0002769 3300049588 Bacteria 13184
276 Ga0501072_0101796 3300049588 Bacteria 2283
277 Ga0501074_0110346 3300049590 Bacteria 1968
278 Ga0501075_0006880 3300049591 Bacteria 7855
279 Ga0501076_0004445 3300049592 Bacteria 9975
280 Ga0501076_0047158 3300049592 Bacteria 3406
281 Ga0501077_0001591 3300049593 Bacteria 13668
282 Ga0501079_0005521 3300049741 Bacteria 9429
283 Ga0501079_0036351 3300049741 Bacteria 3794
284 Ga0501079_0038248 3300049741 Bacteria 3700
285 Ga0501080_0015652 3300049742 Bacteria 6993
286 Ga0501081_0001516 3300049743 Bacteria 14276
287 Ga0501081_0034117 3300049743 Bacteria 3460
288 Ga0501045_0002832 3300049824 Bacteria 11841
289 nmdc:mga09592_59534_c1 3300050508 Bacteria 3229
290 nmdc:mga0qj67_13071_c1 3300050509 Bacteria 6270
291 nmdc:mga0qj67_3730_c1 3300050509 Bacteria 10994
292 nmdc:mga06r32_11407_c1 3300050510 Bacteria 8005
293 nmdc:mga08y16_53507_c1 3300050511 Bacteria 4221
294 nmdc:mga0n895_236526_c1 3300050512 Bacteria 1854
295 nmdc:mga0rr50_33333_c1 3300050513 Bacteria 3678
296 nmdc:mga0a205_145742_c1 3300050515 Bacteria 2268
297 Ga0495601_0023892 3300053077 Bacteria 3759
298 Ga0495612_0018445 3300053078 Bacteria 2794
299 Ga0495655_0031746 3300053083 Bacteria 1287
300 Ga0495595_0000779 3300053084 Bacteria 12072
301 Ga0500556_0000279 3300053104 Bacteria 40113
302 Ga0500616_0005189 3300053153 Bacteria 8929
303 Ga0500616_0026721 3300053153 Bacteria 3192
304 Ga0500616_0052537 3300053153 Bacteria 2142
305 Ga0501084_0014285 3300054114 Bacteria 6576
306 Ga0501084_0193380 3300054114 Bacteria 1716
307 Ga0501082_0006431 3300060353 Bacteria 10193
308 Ga0466962_0003518 3300061719 Bacteria 7465
309 Ga0466962_0032630 3300061719 Bacteria 2492
310 Ga0530510_0134894 3300061734 Bacteria 1817

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0047033 Ga0466970_0047033_46_1272 367
2 3300049578 Ga0501042_0036191 Ga0501042_0036191_1819_3054 370
3 3300049587 Ga0501071_0114962 Ga0501071_0114962_698_1933 370
4 3300049741 Ga0501079_0038248 Ga0501079_0038248_1580_2815 370
5 3300054114 Ga0501084_0193380 Ga0501084_0193380_110_1345 370
6 3300039450 Ga0436363_0254668 Ga0436363_0254668_447_1694 382
7 3300005981 Ga0081538_10031088 Ga0081538_100310882 384
8 3300049587 Ga0501071_0120355 Ga0501071_0120355_43_1260 386
9 3300046514 Ga0495618_0000805 Ga0495618_0000805_11496_12707 387
10 3300048918 Ga0496115_0000012 Ga0496115_0000012_168750_169967 387
11 3300048918 Ga0496115_0000017 Ga0496115_0000017_52519_53736 387
12 3300010375 Ga0105239_10051705 Ga0105239_100517052 388
13 3300046461 Ga0495641_0002845 Ga0495641_0002845_11246_12478 388
14 3300046518 Ga0495631_0030931 Ga0495631_0030931_488_1723 388
15 3300046523 Ga0495644_0001174 Ga0495644_0001174_5026_6261 388
16 3300046683 Ga0495658_0007459 Ga0495658_0007459_3152_4384 388
17 3300047469 Ga0495673_0008793 Ga0495673_0008793_3926_5161 388
18 3300047472 Ga0495686_0000020 Ga0495686_0000020_153865_155097 388
19 3300047472 Ga0495686_0038968 Ga0495686_0038968_281_1513 388
20 3300048905 Ga0496102_0150359 Ga0496102_0150359_916_2151 388
21 3300048912 Ga0496109_0113234 Ga0496109_0113234_78_1313 388
22 3300048913 Ga0496110_0009020 Ga0496110_0009020_2942_4210 388
23 3300048916 Ga0496113_0104855 Ga0496113_0104855_255_1490 388
24 3300053104 Ga0500556_0000279 Ga0500556_0000279_10978_12183 388
25 3300053153 Ga0500616_0026721 Ga0500616_0026721_1405_2610 388
26 3300005338 Ga0068868_100096171 Ga0068868_1000961712 389
27 3300005344 Ga0070661_100011588 Ga0070661_1000115883 389
28 3300005458 Ga0070681_10039979 Ga0070681_100399793 389
29 3300005547 Ga0070693_100014738 Ga0070693_1000147384 389
30 3300005614 Ga0068856_100042436 Ga0068856_1000424362 389
31 3300011119 Ga0105246_10051006 Ga0105246_100510062 389
32 3300013307 Ga0157372_10045425 Ga0157372_100454255 389
33 3300025912 Ga0207707_10050033 Ga0207707_100500333 389
34 3300025917 Ga0207660_10102320 Ga0207660_101023202 389
35 3300025920 Ga0207649_10040832 Ga0207649_100408322 389
36 3300025921 Ga0207652_10158347 Ga0207652_101583472 389
37 3300025944 Ga0207661_10004279 Ga0207661_100042795 389
38 3300026023 Ga0207677_10085488 Ga0207677_100854881 389
39 3300026078 Ga0207702_10073170 Ga0207702_100731702 389
40 3300028381 Ga0268264_10107165 Ga0268264_101071652 389
41 3300028558 Ga0265326_10000454 Ga0265326_1000045414 389
42 3300028563 Ga0265319_1009115 Ga0265319_10091152 389
43 3300028666 Ga0265336_10000002 Ga0265336_1000000277 389
44 3300028800 Ga0265338_10000001 Ga0265338_10000001737 389
45 3300031247 Ga0265340_10000001 Ga0265340_10000001736 389
46 3300031251 Ga0265327_10004633 Ga0265327_100046338 389
47 3300031344 Ga0265316_10017330 Ga0265316_100173306 389
48 3300046463 Ga0495653_0001520 Ga0495653_0001520_8464_9681 389
49 3300046517 Ga0495630_0000440 Ga0495630_0000440_16475_17692 389
50 3300046543 Ga0495645_0000021 Ga0495645_0000021_15724_16941 389
51 3300046675 Ga0495657_0000017 Ga0495657_0000017_151635_152852 389
52 3300047471 Ga0495684_0145502 Ga0495684_0145502_293_1510 389
53 3300048903 Ga0496100_0009772 Ga0496100_0009772_2146_3363 389
54 3300048911 Ga0496108_0028652 Ga0496108_0028652_1925_3193 389
55 3300048912 Ga0496109_0135974 Ga0496109_0135974_361_1629 389
56 3300048914 Ga0496111_0060102 Ga0496111_0060102_1178_2446 389
57 3300005436 Ga0070713_100277836 Ga0070713_1002778362 390
58 3300005840 Ga0068870_10151976 Ga0068870_101519761 390
59 3300006175 Ga0070712_100028203 Ga0070712_1000282032 390
60 3300009545 Ga0105237_10001714 Ga0105237_1000171417 390
61 3300013307 Ga0157372_10101330 Ga0157372_101013302 390
62 3300021384 Ga0213876_10037706 Ga0213876_100377062 390
63 3300025914 Ga0207671_10001437 Ga0207671_100014379 390
64 3300025915 Ga0207693_10016198 Ga0207693_100161983 390
65 3300025928 Ga0207700_10221126 Ga0207700_102211262 390
66 3300031251 Ga0265327_10014238 Ga0265327_100142383 390
67 3300035086 Ga0373934_0000106 Ga0373934_0000106_14283_15497 390
68 3300035111 Ga0373923_0042578 Ga0373923_0042578_183_1397 390
69 3300035117 Ga0373953_0000028 Ga0373953_0000028_25592_26806 390
70 3300035118 Ga0373954_0025049 Ga0373954_0025049_1451_2665 390
71 3300035119 Ga0373956_0000564 Ga0373956_0000564_4045_5259 390
72 3300035120 Ga0373957_0000046 Ga0373957_0000046_9896_11110 390
73 3300035172 Ga0373955_0000151 Ga0373955_0000151_24207_25421 390
74 3300035410 Ga0373924_0000889 Ga0373924_0000889_1052_2266 390
75 3300035724 Ga0373933_0000012 Ga0373933_0000012_32508_33722 390
76 3300036401 Ga0373937_0000040 Ga0373937_0000040_74450_75664 390
77 3300037418 Ga0395900_0064832 Ga0395900_0064832_2432_3673 390
78 3300044684 Ga0466966_0124758 Ga0466966_0124758_179_1447 390
79 3300046454 Ga0495592_0000311 Ga0495592_0000311_32663_33877 390
80 3300046462 Ga0495651_0000040 Ga0495651_0000040_19227_20441 390
81 3300046463 Ga0495653_0003147 Ga0495653_0003147_10674_11888 390
82 3300046511 Ga0495608_0000044 Ga0495608_0000044_32508_33722 390
83 3300046516 Ga0495628_0000123 Ga0495628_0000123_29578_30792 390
84 3300046529 Ga0495652_0000108 Ga0495652_0000108_60220_61434 390
85 3300046536 Ga0495587_0000046 Ga0495587_0000046_32508_33722 390
86 3300046559 Ga0495667_0000066 Ga0495667_0000066_49876_51090 390
87 3300046675 Ga0495657_0000205 Ga0495657_0000205_39841_41055 390
88 3300046678 Ga0495599_0000052 Ga0495599_0000052_27847_29061 390
89 3300046679 Ga0495623_0000247 Ga0495623_0000247_2395_3609 390
90 3300046680 Ga0495646_0007889 Ga0495646_0007889_4096_5310 390
91 3300047317 Ga0495604_0000049 Ga0495604_0000049_32481_33695 390
92 3300047322 Ga0495680_0000908 Ga0495680_0000908_10932_12146 390
93 3300047444 Ga0495675_0001487 Ga0495675_0001487_5989_7203 390
94 3300048088 Ga0495602_0000232 Ga0495602_0000232_11071_12285 390
95 3300049572 Ga0501036_0048002 Ga0501036_0048002_1214_2482 390
96 3300049575 Ga0501039_0029593 Ga0501039_0029593_2271_3539 390
97 3300049576 Ga0501040_0018547 Ga0501040_0018547_1082_2350 390
98 3300049580 Ga0501046_0030498 Ga0501046_0030498_2251_3519 390
99 3300049587 Ga0501071_0004687 Ga0501071_0004687_3674_4942 390
100 3300049588 Ga0501072_0002769 Ga0501072_0002769_4891_6159 390
101 3300049588 Ga0501072_0101796 Ga0501072_0101796_233_1450 390
102 3300049590 Ga0501074_0110346 Ga0501074_0110346_307_1575 390
103 3300049591 Ga0501075_0006880 Ga0501075_0006880_4603_5871 390
104 3300049592 Ga0501076_0004445 Ga0501076_0004445_4550_5818 390
105 3300049593 Ga0501077_0001591 Ga0501077_0001591_6905_8173 390
106 3300049741 Ga0501079_0005521 Ga0501079_0005521_1542_2810 390
107 3300049743 Ga0501081_0001516 Ga0501081_0001516_4120_5388 390
108 3300049824 Ga0501045_0002832 Ga0501045_0002832_4027_5295 390
109 3300053077 Ga0495601_0023892 Ga0495601_0023892_1495_2712 390
110 3300053078 Ga0495612_0018445 Ga0495612_0018445_1064_2281 390
111 3300053084 Ga0495595_0000779 Ga0495595_0000779_1835_3049 390
112 3300054114 Ga0501084_0014285 Ga0501084_0014285_4416_5684 390
113 3300060353 Ga0501082_0006431 Ga0501082_0006431_7108_8376 390
114 3300006881 Ga0068865_100135876 Ga0068865_1001358762 391
115 3300028654 Ga0265322_10009612 Ga0265322_100096124 391
116 3300048915 Ga0496112_0008043 Ga0496112_0008043_4315_5559 391
117 3300044694 Ga0466963_0020607 Ga0466963_0020607_454_1671 392
118 3300044842 Ga0466957_0100227 Ga0466957_0100227_443_1660 392
119 3300061719 Ga0466962_0032630 Ga0466962_0032630_203_1420 392
120 3300005983 Ga0081540_1056370 Ga0081540_10563701 393
121 3300009098 Ga0105245_10068630 Ga0105245_100686302 393
122 3300025935 Ga0207709_10138985 Ga0207709_101389851 393
123 3300028558 Ga0265326_10000045 Ga0265326_1000004516 393
124 3300028573 Ga0265334_10000012 Ga0265334_1000001293 393
125 3300028800 Ga0265338_10007079 Ga0265338_1000707912 393
126 3300039450 Ga0436363_1198065 Ga0436363_1198065_137_1357 393
127 3300005435 Ga0070714_100000137 Ga0070714_10000013744 394
128 3300005458 Ga0070681_10054528 Ga0070681_100545283 394
129 3300005530 Ga0070679_100143887 Ga0070679_1001438872 394
130 3300006028 Ga0070717_10000004 Ga0070717_10000004294 394
131 3300006846 Ga0075430_100015786 Ga0075430_1000157864 394
132 3300020081 Ga0206354_10329131 Ga0206354_103291314 394
133 3300020082 Ga0206353_10644669 Ga0206353_106446693 394
134 3300025929 Ga0207664_10000006 Ga0207664_10000006100 394
135 3300044693 Ga0466961_0001531 Ga0466961_0001531_6545_7801 394
136 3300044694 Ga0466963_0031981 Ga0466963_0031981_2007_3263 394
137 3300044719 Ga0466971_0000264 Ga0466971_0000264_5434_6690 394
138 3300044765 Ga0466970_0054777 Ga0466970_0054777_704_1960 394
139 3300044842 Ga0466957_0025102 Ga0466957_0025102_269_1525 394
140 3300044901 Ga0466960_0000071 Ga0466960_0000071_31298_32524 394
141 3300045836 Ga0466958_0000900 Ga0466958_0000900_7296_8552 394
142 3300045976 Ga0466967_0023715 Ga0466967_0023715_509_1765 394
143 3300045976 Ga0466967_0035907 Ga0466967_0035907_2714_3937 394
144 3300045976 Ga0466967_0280235 Ga0466967_0280235_152_1375 394
145 3300046471 Ga0495650_0000079 Ga0495650_0000079_60465_61691 394
146 3300049571 Ga0501034_0088675 Ga0501034_0088675_1429_2655 394
147 3300050509 nmdc:mga0qj67_13071_c1 nmdc:mga0qj67_13071_c1_1581_2804 394
148 3300053153 Ga0500616_0005189 Ga0500616_0005189_1113_2339 394
149 3300053153 Ga0500616_0052537 Ga0500616_0052537_48_1274 394
150 3300061719 Ga0466962_0003518 Ga0466962_0003518_852_2108 394
151 3300026118 Ga0207675_100171243 Ga0207675_1001712432 395
152 3300044719 Ga0466971_0048246 Ga0466971_0048246_61_1287 395
153 3300047321 Ga0495676_0070461 Ga0495676_0070461_708_1940 395
154 3300049576 Ga0501040_0173484 Ga0501040_0173484_91_1317 395
155 3300050511 nmdc:mga08y16_53507_c1 nmdc:mga08y16_53507_c1_2761_3987 395
156 3300005329 Ga0070683_100008970 Ga0070683_1000089705 396
157 3300005338 Ga0068868_100149392 Ga0068868_1001493922 396
158 3300005341 Ga0070691_10060641 Ga0070691_100606412 396
159 3300005344 Ga0070661_100134443 Ga0070661_1001344432 396
160 3300005366 Ga0070659_100000013 Ga0070659_100000013117 396
161 3300005437 Ga0070710_10000005 Ga0070710_10000005188 396
162 3300005441 Ga0070700_100003875 Ga0070700_1000038757 396
163 3300005466 Ga0070685_10054767 Ga0070685_100547672 396
164 3300005535 Ga0070684_100007099 Ga0070684_1000070993 396
165 3300005615 Ga0070702_100017424 Ga0070702_1000174244 396
166 3300005616 Ga0068852_100023712 Ga0068852_1000237122 396
167 3300005617 Ga0068859_100167224 Ga0068859_1001672242 396
168 3300005618 Ga0068864_100013823 Ga0068864_1000138235 396
169 3300005981 Ga0081538_10015722 Ga0081538_100157223 396
170 3300006175 Ga0070712_100004885 Ga0070712_1000048856 396
171 3300006852 Ga0075433_10203798 Ga0075433_102037981 396
172 3300006871 Ga0075434_100013486 Ga0075434_1000134866 396
173 3300006931 Ga0097620_100167231 Ga0097620_1001672312 396
174 3300007076 Ga0075435_100101629 Ga0075435_1001016292 396
175 3300009094 Ga0111539_10004878 Ga0111539_100048788 396
176 3300009098 Ga0105245_10006226 Ga0105245_100062265 396
177 3300009177 Ga0105248_10056806 Ga0105248_100568062 396
178 3300009545 Ga0105237_10230915 Ga0105237_102309152 396
179 3300009553 Ga0105249_10224839 Ga0105249_102248392 396
180 3300010375 Ga0105239_10014189 Ga0105239_100141894 396
181 3300011119 Ga0105246_10159528 Ga0105246_101595282 396
182 3300013296 Ga0157374_10017109 Ga0157374_100171093 396
183 3300013307 Ga0157372_10033688 Ga0157372_100336884 396
184 3300013308 Ga0157375_10034974 Ga0157375_100349744 396
185 3300014968 Ga0157379_10005561 Ga0157379_1000556110 396
186 3300025898 Ga0207692_10000009 Ga0207692_1000000998 396
187 3300025901 Ga0207688_10002609 Ga0207688_100026097 396
188 3300025901 Ga0207688_10045745 Ga0207688_100457453 396
189 3300025915 Ga0207693_10027118 Ga0207693_100271184 396
190 3300025927 Ga0207687_10168608 Ga0207687_101686082 396
191 3300025932 Ga0207690_10000017 Ga0207690_10000017191 396
192 3300025933 Ga0207706_10022357 Ga0207706_100223572 396
193 3300025937 Ga0207669_10012401 Ga0207669_100124012 396
194 3300025937 Ga0207669_10030081 Ga0207669_100300812 396
195 3300025942 Ga0207689_10070989 Ga0207689_100709892 396
196 3300025944 Ga0207661_10009376 Ga0207661_100093762 396
197 3300026023 Ga0207677_10043691 Ga0207677_100436912 396
198 3300026023 Ga0207677_10187419 Ga0207677_101874191 396
199 3300026075 Ga0207708_10000262 Ga0207708_1000026243 396
200 3300026078 Ga0207702_10180588 Ga0207702_101805882 396
201 3300026095 Ga0207676_10071117 Ga0207676_100711174 396
202 3300026116 Ga0207674_10065151 Ga0207674_100651512 396
203 3300027907 Ga0207428_10110783 Ga0207428_101107832 396
204 3300028379 Ga0268266_10187300 Ga0268266_101873002 396
205 3300031548 Ga0307408_100122348 Ga0307408_1001223482 396
206 3300031852 Ga0307410_10026998 Ga0307410_100269982 396
207 3300031903 Ga0307407_10131384 Ga0307407_101313841 396
208 3300031995 Ga0307409_100078772 Ga0307409_1000787721 396
209 3300037466 Ga0395898_0145660 Ga0395898_0145660_889_2118 396
210 3300039437 Ga0436365_1591814 Ga0436365_1591814_85_1314 396
211 3300039450 Ga0436363_0002799 Ga0436363_0002799_88_1317 396
212 3300039450 Ga0436363_0805533 Ga0436363_0805533_17077_18306 396
213 3300044684 Ga0466966_0089186 Ga0466966_0089186_419_1648 396
214 3300044694 Ga0466963_0017143 Ga0466963_0017143_267_1496 396
215 3300045836 Ga0466958_0005873 Ga0466958_0005873_2313_3542 396
216 3300045976 Ga0466967_0003511 Ga0466967_0003511_3218_4447 396
217 3300045976 Ga0466967_0014961 Ga0466967_0014961_4274_5503 396
218 3300046680 Ga0495646_0063985 Ga0495646_0063985_512_1744 396
219 3300048903 Ga0496100_0101077 Ga0496100_0101077_162_1391 396
220 3300048906 Ga0496103_0079923 Ga0496103_0079923_484_1713 396
221 3300048907 Ga0496104_0088186 Ga0496104_0088186_161_1390 396
222 3300048908 Ga0496105_0018748 Ga0496105_0018748_4001_5230 396
223 3300048909 Ga0496106_0005657 Ga0496106_0005657_2296_3525 396
224 3300048911 Ga0496108_0013579 Ga0496108_0013579_1551_2780 396
225 3300048912 Ga0496109_0044486 Ga0496109_0044486_1227_2456 396
226 3300048913 Ga0496110_0011769 Ga0496110_0011769_471_1700 396
227 3300048914 Ga0496111_0084372 Ga0496111_0084372_397_1626 396
228 3300048914 Ga0496111_0095172 Ga0496111_0095172_290_1519 396
229 3300048914 Ga0496111_0147633 Ga0496111_0147633_309_1538 396
230 3300048915 Ga0496112_0049258 Ga0496112_0049258_1451_2680 396
231 3300048916 Ga0496113_0004197 Ga0496113_0004197_5281_6510 396
232 3300049568 Ga0501031_0026440 Ga0501031_0026440_213_1442 396
233 3300049575 Ga0501039_0012217 Ga0501039_0012217_2099_3328 396
234 3300049576 Ga0501040_0061747 Ga0501040_0061747_422_1651 396
235 3300049577 Ga0501041_0017058 Ga0501041_0017058_1014_2243 396
236 3300049584 Ga0501068_0113560 Ga0501068_0113560_252_1481 396
237 3300049587 Ga0501071_0026317 Ga0501071_0026317_2101_3330 396
238 3300050508 nmdc:mga09592_59534_c1 nmdc:mga09592_59534_c1_378_1646 396
239 3300050512 nmdc:mga0n895_236526_c1 nmdc:mga0n895_236526_c1_354_1583 396
240 3300050513 nmdc:mga0rr50_33333_c1 nmdc:mga0rr50_33333_c1_2129_3358 396
241 3300050515 nmdc:mga0a205_145742_c1 nmdc:mga0a205_145742_c1_639_1868 396
242 3300061734 Ga0530510_0134894 Ga0530510_0134894_400_1629 396
243 3300005329 Ga0070683_100089976 Ga0070683_1000899762 397
244 3300005577 Ga0068857_100113480 Ga0068857_1001134802 397
245 3300021388 Ga0213875_10013713 Ga0213875_100137131 397
246 3300025898 Ga0207692_10073290 Ga0207692_100732902 397
247 3300025915 Ga0207693_10000014 Ga0207693_100000149 397
248 3300025915 Ga0207693_10000327 Ga0207693_1000032723 397
249 3300025919 Ga0207657_10012370 Ga0207657_100123706 397
250 3300025929 Ga0207664_10009347 Ga0207664_100093472 397
251 3300025944 Ga0207661_10044840 Ga0207661_100448402 397
252 3300028577 Ga0265318_10005414 Ga0265318_100054146 397
253 3300035117 Ga0373953_0011505 Ga0373953_0011505_855_2090 397
254 3300035118 Ga0373954_0081389 Ga0373954_0081389_86_1321 397
255 3300037466 Ga0395898_0204210 Ga0395898_0204210_22_1254 397
256 3300037853 Ga0436364_0002493 Ga0436364_0002493_1943_3175 397
257 3300037853 Ga0436364_0792922 Ga0436364_0792922_6966_8198 397
258 3300037853 Ga0436364_1394916 Ga0436364_1394916_5946_7178 397
259 3300038443 Ga0395901_0102826 Ga0395901_0102826_803_2035 397
260 3300044693 Ga0466961_0045814 Ga0466961_0045814_1525_2757 397
261 3300044706 Ga0466964_0014695 Ga0466964_0014695_1712_2953 397
262 3300045049 Ga0466959_0011559 Ga0466959_0011559_330_1562 397
263 3300045049 Ga0466959_0037199 Ga0466959_0037199_434_1666 397
264 3300045836 Ga0466958_0061232 Ga0466958_0061232_1025_2257 397
265 3300046462 Ga0495651_0015650 Ga0495651_0015650_3544_4779 397
266 3300046477 Ga0495664_0132112 Ga0495664_0132112_242_1477 397
267 3300046511 Ga0495608_0020379 Ga0495608_0020379_2581_3816 397
268 3300046516 Ga0495628_0124535 Ga0495628_0124535_185_1420 397
269 3300046559 Ga0495667_0005842 Ga0495667_0005842_4258_5493 397
270 3300046675 Ga0495657_0005146 Ga0495657_0005146_3922_5157 397
271 3300046678 Ga0495599_0074594 Ga0495599_0074594_62_1297 397
272 3300047315 Ga0495581_0043482 Ga0495581_0043482_268_1500 397
273 3300047317 Ga0495604_0114876 Ga0495604_0114876_572_1807 397
274 3300047322 Ga0495680_0008665 Ga0495680_0008665_4691_5926 397
275 3300047471 Ga0495684_0010845 Ga0495684_0010845_583_1818 397
276 3300048903 Ga0496100_0006538 Ga0496100_0006538_3552_4784 397
277 3300048904 Ga0496101_0002545 Ga0496101_0002545_6620_7852 397
278 3300048905 Ga0496102_0056357 Ga0496102_0056357_1585_2817 397
279 3300048907 Ga0496104_0017521 Ga0496104_0017521_5037_6269 397
280 3300048907 Ga0496104_0019600 Ga0496104_0019600_2679_3911 397
281 3300048908 Ga0496105_0069285 Ga0496105_0069285_725_1957 397
282 3300048909 Ga0496106_0017212 Ga0496106_0017212_3154_4386 397
283 3300048910 Ga0496107_0007130 Ga0496107_0007130_3311_4543 397
284 3300048913 Ga0496110_0011592 Ga0496110_0011592_2517_3749 397
285 3300048915 Ga0496112_0001374 Ga0496112_0001374_13870_15102 397
286 3300048915 Ga0496112_0051335 Ga0496112_0051335_1603_2838 397
287 3300049577 Ga0501041_0032748 Ga0501041_0032748_20_1258 397
288 3300049742 Ga0501080_0015652 Ga0501080_0015652_4080_5312 397
289 3300053083 Ga0495655_0031746 Ga0495655_0031746_12_1244 397
290 3300003203 JGI25406J46586_10009703 JGI25406J46586_100097034 398
291 3300005981 Ga0081538_10002486 Ga0081538_1000248616 398
292 3300005985 Ga0081539_10002505 Ga0081539_1000250516 398
293 3300006844 Ga0075428_100223107 Ga0075428_1002231072 398
294 3300006847 Ga0075431_100003273 Ga0075431_10000327315 398
295 3300027907 Ga0207428_10087947 Ga0207428_100879472 398
296 3300032126 Ga0307415_100032615 Ga0307415_1000326152 398
297 3300037466 Ga0395898_0059817 Ga0395898_0059817_343_1581 398
298 3300037853 Ga0436364_0766301 Ga0436364_0766301_2757_3992 398
299 3300038443 Ga0395901_0229721 Ga0395901_0229721_16_1254 398
300 3300039437 Ga0436365_0260735 Ga0436365_0260735_41_1288 398
301 3300044901 Ga0466960_0054292 Ga0466960_0054292_695_1930 398
302 3300045049 Ga0466959_0087221 Ga0466959_0087221_187_1422 398
303 3300048915 Ga0496112_0274990 Ga0496112_0274990_304_1539 398
304 3300049576 Ga0501040_0054297 Ga0501040_0054297_1086_2327 398
305 3300049578 Ga0501042_0257552 Ga0501042_0257552_12_1247 398
306 3300049592 Ga0501076_0047158 Ga0501076_0047158_1100_2341 398
307 3300049741 Ga0501079_0036351 Ga0501079_0036351_1581_2816 398
308 3300049743 Ga0501081_0034117 Ga0501081_0034117_713_1954 398
309 3300050509 nmdc:mga0qj67_3730_c1 nmdc:mga0qj67_3730_c1_9292_10539 398
310 3300050510 nmdc:mga06r32_11407_c1 nmdc:mga06r32_11407_c1_6361_7608 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02773

S-AdoMet_synt_C

S-adenosylmethionine synthetase, C-terminal domain

244

383

0.99

PF00438

S-AdoMet_synt_N

S-adenosylmethionine synthetase, N-terminal domain

5

90

0.98

PF02772

S-AdoMet_synt_M

S-adenosylmethionine synthetase, central domain

114

242

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d2o-assembly1.cif.gz_A structure of acidothermus cellulolyticus cas9 ternary complex (post-cleavage 2) 0.8079 167 190
6wbr-assembly1.cif.gz_A crystal structure of acecas9 bound with guide rna and dna with 5'-nnncc-3' pam 0.7771 167 190
6wc0-assembly1.cif.gz_A crystal structure of acecas9 bound with guide rna and dna with 5'-nnntc-3' pam 0.7468 167 195
3iml-assembly1.cif.gz_B crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei 0.6566 8 388
3iml-assembly1.cif.gz_B crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei 0.655 8 388
ID Description Score Start End Superfamily
af_Q58EF9_292_361_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9781 277 343 3.30.300.10
af_Q58EF9_292_361_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9242 277 343 3.30.300.10
af_Q2G1W4_285_396_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.893 277 386 3.30.300.10
af_Q2G1W4_138_246_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.8846 130 237 3.30.300.10
af_B4FIE9_281_392_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.8789 277 376 3.30.300.10
ID Description Score Start End GO Terms
AF-W5XLI6-F1-model_v4 S-adenosylmethionine synthase 0.9406 26 92 GO:0004478
GO:0005524
GO:0006556
GO:0046872
AF-X0V8T3-F1-model_v4 S-adenosylmethionine synthetase C-terminal domain-containing protein 0.9076 280 388 GO:0004478
GO:0005524
GO:0006556
GO:0006730
GO:0046872
AF-A0A521U7F7-F1-model_v4 Methionine adenosyltransferase (EC 2.5.1.6) 0.9044 283 388 GO:0004478
GO:0005524
GO:0006556
GO:0006730
GO:0046872
AF-H3KHF5-F1-model_v4 S-adenosylmethionine synthetase domain protein 0.9035 280 388 GO:0004478
GO:0005524
GO:0006556
GO:0006730
GO:0046872
AF-A0A3D4YSU2-F1-model_v4 deleted 0.9029 284 388

Feature Viewer

pLDDT pTM Quality
74.43 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map