F400589
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 310 | 200 | 310 | 399 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10054528|Ga0070681_100545283 |
| Length | 405 |
| Sequence | MSQRSFLFTSESVTEGHPDKIANDPLSRVACETLITTGLVVVAGEMTTETYIDIPRIVRDTVKAIGYTRAKYGFDAETCGVMVALDEQSPDIAQGVDSAYELQHDPSDDDPLDRVGAGDQGMMFGYASNETRELMPLPIMLAHRIAKRLSEVRKADVLPYLRPDGKAQVSIRYEVDADGRQRPVEIERVLISTQHREGLDPDAMIKPDLVEQVLRPVLPKDFYDEKSLDDPAFFYVNPTGKFVIGGPMGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYAARYVAKNVVAAGLADRCQIQVAYAIGVARPFSILVETFGTEHLPVSRIEALVEEHFDLRPAAILRDLDLRRPIYQKTAAYGHFGRDDHDFTWERTDKAAALRASAGLAATTTATVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 17 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 18 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 20 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 21 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 22 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 23 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 25 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 29 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 30 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 31 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 32 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 33 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 34 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 50 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 51 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 79 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 80 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 81 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 82 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 83 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 84 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 86 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 87 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 88 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 89 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 90 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 91 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 92 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 93 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 94 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 95 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 96 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 97 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 98 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 99 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 100 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 101 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 102 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 104 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 105 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 106 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 107 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 108 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 109 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 110 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 111 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 112 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 113 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 114 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 115 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 116 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 117 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 118 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 153 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 154 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 155 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 156 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 157 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 158 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 161 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 162 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 163 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 164 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 165 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 196 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 197 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 200 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0.65 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.29 |
| Nodule | 0 |
| Rhizoplane | 11.61 |
| Rhizosphere | 83.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10009703 | 3300003203 | Bacteria | 4303 |
| 2 | Ga0070683_100008970 | 3300005329 | Bacteria | 8524 |
| 3 | Ga0070683_100089976 | 3300005329 | Bacteria | 2881 |
| 4 | Ga0068868_100096171 | 3300005338 | Bacteria | 2392 |
| 5 | Ga0068868_100149392 | 3300005338 | Bacteria | 1923 |
| 6 | Ga0070691_10060641 | 3300005341 | Bacteria | 1819 |
| 7 | Ga0070661_100011588 | 3300005344 | Bacteria | 6146 |
| 8 | Ga0070661_100134443 | 3300005344 | Bacteria | 1860 |
| 9 | Ga0070659_100000013 | 3300005366 | Bacteria | 178795 |
| 10 | Ga0070714_100000137 | 3300005435 | Bacteria | 58260 |
| 11 | Ga0070713_100277836 | 3300005436 | Bacteria | 1535 |
| 12 | Ga0070710_10000005 | 3300005437 | Bacteria | 238049 |
| 13 | Ga0070700_100003875 | 3300005441 | Bacteria | 7767 |
| 14 | Ga0070681_10039979 | 3300005458 | Bacteria | 4702 |
| 15 | Ga0070681_10054528 | 3300005458 | Bacteria | 3984 |
| 16 | Ga0070685_10054767 | 3300005466 | Bacteria | 2315 |
| 17 | Ga0070679_100143887 | 3300005530 | Bacteria | 2363 |
| 18 | Ga0070684_100007099 | 3300005535 | Bacteria | 8704 |
| 19 | Ga0070693_100014738 | 3300005547 | Bacteria | 4012 |
| 20 | Ga0068857_100113480 | 3300005577 | Bacteria | 2436 |
| 21 | Ga0068856_100042436 | 3300005614 | Bacteria | 4474 |
| 22 | Ga0070702_100017424 | 3300005615 | Bacteria | 3705 |
| 23 | Ga0068852_100023712 | 3300005616 | Bacteria | 4945 |
| 24 | Ga0068859_100167224 | 3300005617 | Bacteria | 2279 |
| 25 | Ga0068864_100013823 | 3300005618 | Bacteria | 6689 |
| 26 | Ga0068870_10151976 | 3300005840 | Bacteria | 1364 |
| 27 | Ga0081538_10002486 | 3300005981 | Bacteria | 17973 |
| 28 | Ga0081538_10015722 | 3300005981 | Bacteria | 5842 |
| 29 | Ga0081538_10031088 | 3300005981 | Bacteria | 3609 |
| 30 | Ga0081540_1056370 | 3300005983 | Bacteria | 1908 |
| 31 | Ga0081539_10002505 | 3300005985 | Bacteria | 25722 |
| 32 | Ga0070717_10000004 | 3300006028 | Bacteria | 365525 |
| 33 | Ga0070712_100004885 | 3300006175 | Bacteria | 8291 |
| 34 | Ga0070712_100028203 | 3300006175 | Bacteria | 3754 |
| 35 | Ga0075428_100223107 | 3300006844 | Bacteria | 2035 |
| 36 | Ga0075430_100015786 | 3300006846 | Bacteria | 6431 |
| 37 | Ga0075431_100003273 | 3300006847 | Bacteria | 15676 |
| 38 | Ga0075433_10203798 | 3300006852 | Bacteria | 1758 |
| 39 | Ga0075434_100013486 | 3300006871 | Bacteria | 7781 |
| 40 | Ga0068865_100135876 | 3300006881 | Bacteria | 1848 |
| 41 | Ga0097620_100167231 | 3300006931 | Bacteria | 2279 |
| 42 | Ga0075435_100101629 | 3300007076 | Bacteria | 2383 |
| 43 | Ga0111539_10004878 | 3300009094 | Bacteria | 17468 |
| 44 | Ga0105245_10006226 | 3300009098 | Bacteria | 10494 |
| 45 | Ga0105245_10068630 | 3300009098 | Bacteria | 3213 |
| 46 | Ga0105248_10056806 | 3300009177 | Bacteria | 4391 |
| 47 | Ga0105237_10001714 | 3300009545 | Bacteria | 28350 |
| 48 | Ga0105237_10230915 | 3300009545 | Bacteria | 1851 |
| 49 | Ga0105249_10224839 | 3300009553 | Bacteria | 1848 |
| 50 | Ga0105239_10014189 | 3300010375 | Bacteria | 8842 |
| 51 | Ga0105239_10051705 | 3300010375 | Bacteria | 4504 |
| 52 | Ga0105246_10051006 | 3300011119 | Bacteria | 2839 |
| 53 | Ga0105246_10159528 | 3300011119 | Bacteria | 1717 |
| 54 | Ga0157374_10017109 | 3300013296 | Bacteria | 6383 |
| 55 | Ga0157372_10033688 | 3300013307 | Bacteria | 5628 |
| 56 | Ga0157372_10045425 | 3300013307 | Bacteria | 4873 |
| 57 | Ga0157372_10101330 | 3300013307 | Bacteria | 3287 |
| 58 | Ga0157375_10034974 | 3300013308 | Bacteria | 4791 |
| 59 | Ga0157379_10005561 | 3300014968 | Bacteria | 10829 |
| 60 | Ga0206354_10329131 | 3300020081 | Bacteria | 4119 |
| 61 | Ga0206353_10644669 | 3300020082 | Bacteria | 6644 |
| 62 | Ga0213876_10037706 | 3300021384 | Bacteria | 2550 |
| 63 | Ga0213875_10013713 | 3300021388 | Bacteria | 3971 |
| 64 | Ga0207692_10000009 | 3300025898 | Bacteria | 159859 |
| 65 | Ga0207692_10073290 | 3300025898 | Bacteria | 1811 |
| 66 | Ga0207688_10002609 | 3300025901 | Bacteria | 9755 |
| 67 | Ga0207688_10045745 | 3300025901 | Bacteria | 2442 |
| 68 | Ga0207707_10050033 | 3300025912 | Bacteria | 3641 |
| 69 | Ga0207671_10001437 | 3300025914 | Bacteria | 27616 |
| 70 | Ga0207693_10000014 | 3300025915 | Bacteria | 148984 |
| 71 | Ga0207693_10000327 | 3300025915 | Bacteria | 43947 |
| 72 | Ga0207693_10016198 | 3300025915 | Bacteria | 5960 |
| 73 | Ga0207693_10027118 | 3300025915 | Bacteria | 4530 |
| 74 | Ga0207660_10102320 | 3300025917 | Bacteria | 2141 |
| 75 | Ga0207657_10012370 | 3300025919 | Bacteria | 8430 |
| 76 | Ga0207649_10040832 | 3300025920 | Bacteria | 2823 |
| 77 | Ga0207652_10158347 | 3300025921 | Bacteria | 2029 |
| 78 | Ga0207687_10168608 | 3300025927 | Bacteria | 1687 |
| 79 | Ga0207700_10221126 | 3300025928 | Bacteria | 1605 |
| 80 | Ga0207664_10000006 | 3300025929 | Bacteria | 408702 |
| 81 | Ga0207664_10009347 | 3300025929 | Bacteria | 6875 |
| 82 | Ga0207690_10000017 | 3300025932 | Bacteria | 243513 |
| 83 | Ga0207706_10022357 | 3300025933 | Bacteria | 5674 |
| 84 | Ga0207709_10138985 | 3300025935 | Bacteria | 1667 |
| 85 | Ga0207669_10012401 | 3300025937 | Bacteria | 4189 |
| 86 | Ga0207669_10030081 | 3300025937 | Bacteria | 3013 |
| 87 | Ga0207689_10070989 | 3300025942 | Bacteria | 2860 |
| 88 | Ga0207661_10004279 | 3300025944 | Bacteria | 9996 |
| 89 | Ga0207661_10009376 | 3300025944 | Bacteria | 7018 |
| 90 | Ga0207661_10044840 | 3300025944 | Bacteria | 3497 |
| 91 | Ga0207677_10043691 | 3300026023 | Bacteria | 2981 |
| 92 | Ga0207677_10085488 | 3300026023 | Bacteria | 2277 |
| 93 | Ga0207677_10187419 | 3300026023 | Bacteria | 1633 |
| 94 | Ga0207708_10000262 | 3300026075 | Bacteria | 41463 |
| 95 | Ga0207702_10073170 | 3300026078 | Bacteria | 2954 |
| 96 | Ga0207702_10180588 | 3300026078 | Bacteria | 1943 |
| 97 | Ga0207676_10071117 | 3300026095 | Bacteria | 2792 |
| 98 | Ga0207674_10065151 | 3300026116 | Bacteria | 3674 |
| 99 | Ga0207675_100171243 | 3300026118 | Bacteria | 2075 |
| 100 | Ga0207428_10087947 | 3300027907 | Bacteria | 2417 |
| 101 | Ga0207428_10110783 | 3300027907 | Bacteria | 2113 |
| 102 | Ga0268266_10187300 | 3300028379 | Bacteria | 1888 |
| 103 | Ga0268264_10107165 | 3300028381 | Bacteria | 2441 |
| 104 | Ga0265326_10000045 | 3300028558 | Bacteria | 79810 |
| 105 | Ga0265326_10000454 | 3300028558 | Bacteria | 16072 |
| 106 | Ga0265319_1009115 | 3300028563 | Bacteria | 4264 |
| 107 | Ga0265334_10000012 | 3300028573 | Bacteria | 174358 |
| 108 | Ga0265318_10005414 | 3300028577 | Bacteria | 5993 |
| 109 | Ga0265322_10009612 | 3300028654 | Bacteria | 2806 |
| 110 | Ga0265336_10000002 | 3300028666 | Bacteria | 830172 |
| 111 | Ga0265338_10000001 | 3300028800 | Bacteria | 1177449 |
| 112 | Ga0265338_10007079 | 3300028800 | Bacteria | 14059 |
| 113 | Ga0265340_10000001 | 3300031247 | Bacteria | 1647668 |
| 114 | Ga0265327_10004633 | 3300031251 | Bacteria | 12058 |
| 115 | Ga0265327_10014238 | 3300031251 | Bacteria | 5213 |
| 116 | Ga0265316_10017330 | 3300031344 | Bacteria | 6232 |
| 117 | Ga0307408_100122348 | 3300031548 | Bacteria | 2018 |
| 118 | Ga0307410_10026998 | 3300031852 | Bacteria | 3623 |
| 119 | Ga0307407_10131384 | 3300031903 | Bacteria | 1602 |
| 120 | Ga0307409_100078772 | 3300031995 | Bacteria | 2652 |
| 121 | Ga0307415_100032615 | 3300032126 | Bacteria | 3371 |
| 122 | Ga0373934_0000106 | 3300035086 | Bacteria | 29764 |
| 123 | Ga0373923_0042578 | 3300035111 | Bacteria | 1876 |
| 124 | Ga0373953_0000028 | 3300035117 | Bacteria | 39179 |
| 125 | Ga0373953_0011505 | 3300035117 | Bacteria | 3108 |
| 126 | Ga0373954_0025049 | 3300035118 | Bacteria | 2724 |
| 127 | Ga0373954_0081389 | 3300035118 | Bacteria | 1547 |
| 128 | Ga0373956_0000564 | 3300035119 | Bacteria | 15211 |
| 129 | Ga0373957_0000046 | 3300035120 | Bacteria | 31769 |
| 130 | Ga0373955_0000151 | 3300035172 | Bacteria | 27642 |
| 131 | Ga0373924_0000889 | 3300035410 | Bacteria | 9429 |
| 132 | Ga0373933_0000012 | 3300035724 | Bacteria | 108156 |
| 133 | Ga0373937_0000040 | 3300036401 | Bacteria | 108935 |
| 134 | Ga0395900_0064832 | 3300037418 | Bacteria | 3753 |
| 135 | Ga0395898_0059817 | 3300037466 | Bacteria | 3705 |
| 136 | Ga0395898_0145660 | 3300037466 | Bacteria | 2267 |
| 137 | Ga0395898_0204210 | 3300037466 | Bacteria | 1886 |
| 138 | Ga0436364_0002493 | 3300037853 | Bacteria | 4315 |
| 139 | Ga0436364_0766301 | 3300037853 | Bacteria | 7786 |
| 140 | Ga0436364_0792922 | 3300037853 | Bacteria | 20571 |
| 141 | Ga0436364_1394916 | 3300037853 | Bacteria | 7949 |
| 142 | Ga0395901_0102826 | 3300038443 | Bacteria | 2998 |
| 143 | Ga0395901_0229721 | 3300038443 | Bacteria | 1937 |
| 144 | Ga0436365_0260735 | 3300039437 | Bacteria | 1309 |
| 145 | Ga0436365_1591814 | 3300039437 | Bacteria | 7603 |
| 146 | Ga0436363_0002799 | 3300039450 | Bacteria | 2631 |
| 147 | Ga0436363_0254668 | 3300039450 | Bacteria | 1794 |
| 148 | Ga0436363_0805533 | 3300039450 | Bacteria | 51825 |
| 149 | Ga0436363_1198065 | 3300039450 | Bacteria | 1472 |
| 150 | Ga0466966_0089186 | 3300044684 | Bacteria | 1916 |
| 151 | Ga0466966_0124758 | 3300044684 | Bacteria | 1580 |
| 152 | Ga0466961_0001531 | 3300044693 | Bacteria | 14313 |
| 153 | Ga0466961_0045814 | 3300044693 | Bacteria | 2798 |
| 154 | Ga0466963_0017143 | 3300044694 | Bacteria | 4511 |
| 155 | Ga0466963_0020607 | 3300044694 | Bacteria | 4146 |
| 156 | Ga0466963_0031981 | 3300044694 | Bacteria | 3403 |
| 157 | Ga0466964_0014695 | 3300044706 | Bacteria | 2978 |
| 158 | Ga0466971_0000264 | 3300044719 | Bacteria | 20112 |
| 159 | Ga0466971_0048246 | 3300044719 | Bacteria | 1914 |
| 160 | Ga0466970_0047033 | 3300044765 | Bacteria | 2299 |
| 161 | Ga0466970_0054777 | 3300044765 | Bacteria | 2130 |
| 162 | Ga0466957_0025102 | 3300044842 | Bacteria | 3530 |
| 163 | Ga0466957_0100227 | 3300044842 | Bacteria | 1825 |
| 164 | Ga0466960_0000071 | 3300044901 | Bacteria | 33077 |
| 165 | Ga0466960_0054292 | 3300044901 | Bacteria | 1945 |
| 166 | Ga0466959_0011559 | 3300045049 | Bacteria | 6344 |
| 167 | Ga0466959_0037199 | 3300045049 | Bacteria | 3596 |
| 168 | Ga0466959_0087221 | 3300045049 | Bacteria | 2245 |
| 169 | Ga0466958_0000900 | 3300045836 | Bacteria | 13345 |
| 170 | Ga0466958_0005873 | 3300045836 | Bacteria | 6642 |
| 171 | Ga0466958_0061232 | 3300045836 | Bacteria | 2292 |
| 172 | Ga0466967_0003511 | 3300045976 | Bacteria | 10247 |
| 173 | Ga0466967_0014961 | 3300045976 | Bacteria | 6067 |
| 174 | Ga0466967_0023715 | 3300045976 | Bacteria | 5032 |
| 175 | Ga0466967_0035907 | 3300045976 | Bacteria | 4224 |
| 176 | Ga0466967_0280235 | 3300045976 | Bacteria | 1599 |
| 177 | Ga0495592_0000311 | 3300046454 | Bacteria | 40958 |
| 178 | Ga0495641_0002845 | 3300046461 | Bacteria | 13394 |
| 179 | Ga0495651_0000040 | 3300046462 | Bacteria | 94890 |
| 180 | Ga0495651_0015650 | 3300046462 | Bacteria | 5872 |
| 181 | Ga0495653_0001520 | 3300046463 | Bacteria | 18130 |
| 182 | Ga0495653_0003147 | 3300046463 | Bacteria | 13231 |
| 183 | Ga0495650_0000079 | 3300046471 | Bacteria | 244549 |
| 184 | Ga0495664_0132112 | 3300046477 | Bacteria | 1512 |
| 185 | Ga0495608_0000044 | 3300046511 | Bacteria | 108171 |
| 186 | Ga0495608_0020379 | 3300046511 | Bacteria | 4557 |
| 187 | Ga0495618_0000805 | 3300046514 | Bacteria | 21850 |
| 188 | Ga0495628_0000123 | 3300046516 | Bacteria | 64063 |
| 189 | Ga0495628_0124535 | 3300046516 | Bacteria | 1975 |
| 190 | Ga0495630_0000440 | 3300046517 | Bacteria | 31661 |
| 191 | Ga0495631_0030931 | 3300046518 | Bacteria | 2426 |
| 192 | Ga0495644_0001174 | 3300046523 | Bacteria | 10747 |
| 193 | Ga0495652_0000108 | 3300046529 | Bacteria | 89636 |
| 194 | Ga0495587_0000046 | 3300046536 | Bacteria | 108171 |
| 195 | Ga0495645_0000021 | 3300046543 | Bacteria | 137604 |
| 196 | Ga0495667_0000066 | 3300046559 | Bacteria | 84361 |
| 197 | Ga0495667_0005842 | 3300046559 | Bacteria | 8337 |
| 198 | Ga0495657_0000017 | 3300046675 | Bacteria | 174558 |
| 199 | Ga0495657_0000205 | 3300046675 | Bacteria | 52988 |
| 200 | Ga0495657_0005146 | 3300046675 | Bacteria | 10360 |
| 201 | Ga0495599_0000052 | 3300046678 | Bacteria | 80904 |
| 202 | Ga0495599_0074594 | 3300046678 | Bacteria | 2118 |
| 203 | Ga0495623_0000247 | 3300046679 | Bacteria | 34941 |
| 204 | Ga0495646_0007889 | 3300046680 | Bacteria | 6761 |
| 205 | Ga0495646_0063985 | 3300046680 | Bacteria | 2182 |
| 206 | Ga0495658_0007459 | 3300046683 | Bacteria | 5415 |
| 207 | Ga0495581_0043482 | 3300047315 | Bacteria | 2599 |
| 208 | Ga0495604_0000049 | 3300047317 | Bacteria | 108620 |
| 209 | Ga0495604_0114876 | 3300047317 | Bacteria | 1957 |
| 210 | Ga0495676_0070461 | 3300047321 | Bacteria | 2693 |
| 211 | Ga0495680_0000908 | 3300047322 | Bacteria | 32882 |
| 212 | Ga0495680_0008665 | 3300047322 | Bacteria | 9229 |
| 213 | Ga0495675_0001487 | 3300047444 | Bacteria | 14183 |
| 214 | Ga0495673_0008793 | 3300047469 | Bacteria | 5640 |
| 215 | Ga0495684_0010845 | 3300047471 | Bacteria | 7047 |
| 216 | Ga0495684_0145502 | 3300047471 | Bacteria | 1775 |
| 217 | Ga0495686_0000020 | 3300047472 | Bacteria | 429191 |
| 218 | Ga0495686_0038968 | 3300047472 | Bacteria | 3038 |
| 219 | Ga0495602_0000232 | 3300048088 | Bacteria | 52110 |
| 220 | Ga0496100_0006538 | 3300048903 | Bacteria | 6362 |
| 221 | Ga0496100_0009772 | 3300048903 | Bacteria | 5401 |
| 222 | Ga0496100_0101077 | 3300048903 | Bacteria | 1987 |
| 223 | Ga0496101_0002545 | 3300048904 | Bacteria | 11184 |
| 224 | Ga0496102_0056357 | 3300048905 | Bacteria | 3585 |
| 225 | Ga0496102_0150359 | 3300048905 | Bacteria | 2188 |
| 226 | Ga0496103_0079923 | 3300048906 | Bacteria | 2055 |
| 227 | Ga0496104_0017521 | 3300048907 | Bacteria | 6525 |
| 228 | Ga0496104_0019600 | 3300048907 | Bacteria | 6192 |
| 229 | Ga0496104_0088186 | 3300048907 | Bacteria | 2963 |
| 230 | Ga0496105_0018748 | 3300048908 | Bacteria | 5570 |
| 231 | Ga0496105_0069285 | 3300048908 | Bacteria | 2915 |
| 232 | Ga0496106_0005657 | 3300048909 | Bacteria | 9247 |
| 233 | Ga0496106_0017212 | 3300048909 | Bacteria | 5351 |
| 234 | Ga0496107_0007130 | 3300048910 | Bacteria | 7701 |
| 235 | Ga0496108_0013579 | 3300048911 | Bacteria | 6646 |
| 236 | Ga0496108_0028652 | 3300048911 | Bacteria | 4608 |
| 237 | Ga0496109_0044486 | 3300048912 | Bacteria | 4028 |
| 238 | Ga0496109_0113234 | 3300048912 | Bacteria | 2523 |
| 239 | Ga0496109_0135974 | 3300048912 | Bacteria | 2296 |
| 240 | Ga0496110_0009020 | 3300048913 | Bacteria | 8048 |
| 241 | Ga0496110_0011592 | 3300048913 | Bacteria | 7225 |
| 242 | Ga0496110_0011769 | 3300048913 | Bacteria | 7180 |
| 243 | Ga0496111_0060102 | 3300048914 | Bacteria | 2754 |
| 244 | Ga0496111_0084372 | 3300048914 | Bacteria | 2322 |
| 245 | Ga0496111_0095172 | 3300048914 | Bacteria | 2185 |
| 246 | Ga0496111_0147633 | 3300048914 | Bacteria | 1744 |
| 247 | Ga0496112_0001374 | 3300048915 | Bacteria | 18549 |
| 248 | Ga0496112_0008043 | 3300048915 | Bacteria | 9411 |
| 249 | Ga0496112_0049258 | 3300048915 | Bacteria | 4129 |
| 250 | Ga0496112_0051335 | 3300048915 | Bacteria | 4045 |
| 251 | Ga0496112_0274990 | 3300048915 | Bacteria | 1632 |
| 252 | Ga0496113_0004197 | 3300048916 | Bacteria | 8806 |
| 253 | Ga0496113_0104855 | 3300048916 | Bacteria | 2194 |
| 254 | Ga0496115_0000012 | 3300048918 | Bacteria | 215509 |
| 255 | Ga0496115_0000017 | 3300048918 | Bacteria | 185702 |
| 256 | Ga0501031_0026440 | 3300049568 | Bacteria | 3783 |
| 257 | Ga0501034_0088675 | 3300049571 | Bacteria | 3091 |
| 258 | Ga0501036_0048002 | 3300049572 | Bacteria | 3615 |
| 259 | Ga0501039_0012217 | 3300049575 | Bacteria | 6546 |
| 260 | Ga0501039_0029593 | 3300049575 | Bacteria | 4218 |
| 261 | Ga0501040_0018547 | 3300049576 | Bacteria | 4620 |
| 262 | Ga0501040_0054297 | 3300049576 | Bacteria | 2747 |
| 263 | Ga0501040_0061747 | 3300049576 | Bacteria | 2578 |
| 264 | Ga0501040_0173484 | 3300049576 | Bacteria | 1527 |
| 265 | Ga0501041_0017058 | 3300049577 | Bacteria | 4321 |
| 266 | Ga0501041_0032748 | 3300049577 | Bacteria | 3142 |
| 267 | Ga0501042_0036191 | 3300049578 | Bacteria | 3502 |
| 268 | Ga0501042_0257552 | 3300049578 | Bacteria | 1259 |
| 269 | Ga0501046_0030498 | 3300049580 | Bacteria | 4376 |
| 270 | Ga0501068_0113560 | 3300049584 | Bacteria | 1686 |
| 271 | Ga0501071_0004687 | 3300049587 | Bacteria | 8690 |
| 272 | Ga0501071_0026317 | 3300049587 | Bacteria | 4083 |
| 273 | Ga0501071_0114962 | 3300049587 | Bacteria | 1991 |
| 274 | Ga0501071_0120355 | 3300049587 | Bacteria | 1946 |
| 275 | Ga0501072_0002769 | 3300049588 | Bacteria | 13184 |
| 276 | Ga0501072_0101796 | 3300049588 | Bacteria | 2283 |
| 277 | Ga0501074_0110346 | 3300049590 | Bacteria | 1968 |
| 278 | Ga0501075_0006880 | 3300049591 | Bacteria | 7855 |
| 279 | Ga0501076_0004445 | 3300049592 | Bacteria | 9975 |
| 280 | Ga0501076_0047158 | 3300049592 | Bacteria | 3406 |
| 281 | Ga0501077_0001591 | 3300049593 | Bacteria | 13668 |
| 282 | Ga0501079_0005521 | 3300049741 | Bacteria | 9429 |
| 283 | Ga0501079_0036351 | 3300049741 | Bacteria | 3794 |
| 284 | Ga0501079_0038248 | 3300049741 | Bacteria | 3700 |
| 285 | Ga0501080_0015652 | 3300049742 | Bacteria | 6993 |
| 286 | Ga0501081_0001516 | 3300049743 | Bacteria | 14276 |
| 287 | Ga0501081_0034117 | 3300049743 | Bacteria | 3460 |
| 288 | Ga0501045_0002832 | 3300049824 | Bacteria | 11841 |
| 289 | nmdc:mga09592_59534_c1 | 3300050508 | Bacteria | 3229 |
| 290 | nmdc:mga0qj67_13071_c1 | 3300050509 | Bacteria | 6270 |
| 291 | nmdc:mga0qj67_3730_c1 | 3300050509 | Bacteria | 10994 |
| 292 | nmdc:mga06r32_11407_c1 | 3300050510 | Bacteria | 8005 |
| 293 | nmdc:mga08y16_53507_c1 | 3300050511 | Bacteria | 4221 |
| 294 | nmdc:mga0n895_236526_c1 | 3300050512 | Bacteria | 1854 |
| 295 | nmdc:mga0rr50_33333_c1 | 3300050513 | Bacteria | 3678 |
| 296 | nmdc:mga0a205_145742_c1 | 3300050515 | Bacteria | 2268 |
| 297 | Ga0495601_0023892 | 3300053077 | Bacteria | 3759 |
| 298 | Ga0495612_0018445 | 3300053078 | Bacteria | 2794 |
| 299 | Ga0495655_0031746 | 3300053083 | Bacteria | 1287 |
| 300 | Ga0495595_0000779 | 3300053084 | Bacteria | 12072 |
| 301 | Ga0500556_0000279 | 3300053104 | Bacteria | 40113 |
| 302 | Ga0500616_0005189 | 3300053153 | Bacteria | 8929 |
| 303 | Ga0500616_0026721 | 3300053153 | Bacteria | 3192 |
| 304 | Ga0500616_0052537 | 3300053153 | Bacteria | 2142 |
| 305 | Ga0501084_0014285 | 3300054114 | Bacteria | 6576 |
| 306 | Ga0501084_0193380 | 3300054114 | Bacteria | 1716 |
| 307 | Ga0501082_0006431 | 3300060353 | Bacteria | 10193 |
| 308 | Ga0466962_0003518 | 3300061719 | Bacteria | 7465 |
| 309 | Ga0466962_0032630 | 3300061719 | Bacteria | 2492 |
| 310 | Ga0530510_0134894 | 3300061734 | Bacteria | 1817 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0047033 | Ga0466970_0047033_46_1272 | 367 |
| 2 | 3300049578 | Ga0501042_0036191 | Ga0501042_0036191_1819_3054 | 370 |
| 3 | 3300049587 | Ga0501071_0114962 | Ga0501071_0114962_698_1933 | 370 |
| 4 | 3300049741 | Ga0501079_0038248 | Ga0501079_0038248_1580_2815 | 370 |
| 5 | 3300054114 | Ga0501084_0193380 | Ga0501084_0193380_110_1345 | 370 |
| 6 | 3300039450 | Ga0436363_0254668 | Ga0436363_0254668_447_1694 | 382 |
| 7 | 3300005981 | Ga0081538_10031088 | Ga0081538_100310882 | 384 |
| 8 | 3300049587 | Ga0501071_0120355 | Ga0501071_0120355_43_1260 | 386 |
| 9 | 3300046514 | Ga0495618_0000805 | Ga0495618_0000805_11496_12707 | 387 |
| 10 | 3300048918 | Ga0496115_0000012 | Ga0496115_0000012_168750_169967 | 387 |
| 11 | 3300048918 | Ga0496115_0000017 | Ga0496115_0000017_52519_53736 | 387 |
| 12 | 3300010375 | Ga0105239_10051705 | Ga0105239_100517052 | 388 |
| 13 | 3300046461 | Ga0495641_0002845 | Ga0495641_0002845_11246_12478 | 388 |
| 14 | 3300046518 | Ga0495631_0030931 | Ga0495631_0030931_488_1723 | 388 |
| 15 | 3300046523 | Ga0495644_0001174 | Ga0495644_0001174_5026_6261 | 388 |
| 16 | 3300046683 | Ga0495658_0007459 | Ga0495658_0007459_3152_4384 | 388 |
| 17 | 3300047469 | Ga0495673_0008793 | Ga0495673_0008793_3926_5161 | 388 |
| 18 | 3300047472 | Ga0495686_0000020 | Ga0495686_0000020_153865_155097 | 388 |
| 19 | 3300047472 | Ga0495686_0038968 | Ga0495686_0038968_281_1513 | 388 |
| 20 | 3300048905 | Ga0496102_0150359 | Ga0496102_0150359_916_2151 | 388 |
| 21 | 3300048912 | Ga0496109_0113234 | Ga0496109_0113234_78_1313 | 388 |
| 22 | 3300048913 | Ga0496110_0009020 | Ga0496110_0009020_2942_4210 | 388 |
| 23 | 3300048916 | Ga0496113_0104855 | Ga0496113_0104855_255_1490 | 388 |
| 24 | 3300053104 | Ga0500556_0000279 | Ga0500556_0000279_10978_12183 | 388 |
| 25 | 3300053153 | Ga0500616_0026721 | Ga0500616_0026721_1405_2610 | 388 |
| 26 | 3300005338 | Ga0068868_100096171 | Ga0068868_1000961712 | 389 |
| 27 | 3300005344 | Ga0070661_100011588 | Ga0070661_1000115883 | 389 |
| 28 | 3300005458 | Ga0070681_10039979 | Ga0070681_100399793 | 389 |
| 29 | 3300005547 | Ga0070693_100014738 | Ga0070693_1000147384 | 389 |
| 30 | 3300005614 | Ga0068856_100042436 | Ga0068856_1000424362 | 389 |
| 31 | 3300011119 | Ga0105246_10051006 | Ga0105246_100510062 | 389 |
| 32 | 3300013307 | Ga0157372_10045425 | Ga0157372_100454255 | 389 |
| 33 | 3300025912 | Ga0207707_10050033 | Ga0207707_100500333 | 389 |
| 34 | 3300025917 | Ga0207660_10102320 | Ga0207660_101023202 | 389 |
| 35 | 3300025920 | Ga0207649_10040832 | Ga0207649_100408322 | 389 |
| 36 | 3300025921 | Ga0207652_10158347 | Ga0207652_101583472 | 389 |
| 37 | 3300025944 | Ga0207661_10004279 | Ga0207661_100042795 | 389 |
| 38 | 3300026023 | Ga0207677_10085488 | Ga0207677_100854881 | 389 |
| 39 | 3300026078 | Ga0207702_10073170 | Ga0207702_100731702 | 389 |
| 40 | 3300028381 | Ga0268264_10107165 | Ga0268264_101071652 | 389 |
| 41 | 3300028558 | Ga0265326_10000454 | Ga0265326_1000045414 | 389 |
| 42 | 3300028563 | Ga0265319_1009115 | Ga0265319_10091152 | 389 |
| 43 | 3300028666 | Ga0265336_10000002 | Ga0265336_1000000277 | 389 |
| 44 | 3300028800 | Ga0265338_10000001 | Ga0265338_10000001737 | 389 |
| 45 | 3300031247 | Ga0265340_10000001 | Ga0265340_10000001736 | 389 |
| 46 | 3300031251 | Ga0265327_10004633 | Ga0265327_100046338 | 389 |
| 47 | 3300031344 | Ga0265316_10017330 | Ga0265316_100173306 | 389 |
| 48 | 3300046463 | Ga0495653_0001520 | Ga0495653_0001520_8464_9681 | 389 |
| 49 | 3300046517 | Ga0495630_0000440 | Ga0495630_0000440_16475_17692 | 389 |
| 50 | 3300046543 | Ga0495645_0000021 | Ga0495645_0000021_15724_16941 | 389 |
| 51 | 3300046675 | Ga0495657_0000017 | Ga0495657_0000017_151635_152852 | 389 |
| 52 | 3300047471 | Ga0495684_0145502 | Ga0495684_0145502_293_1510 | 389 |
| 53 | 3300048903 | Ga0496100_0009772 | Ga0496100_0009772_2146_3363 | 389 |
| 54 | 3300048911 | Ga0496108_0028652 | Ga0496108_0028652_1925_3193 | 389 |
| 55 | 3300048912 | Ga0496109_0135974 | Ga0496109_0135974_361_1629 | 389 |
| 56 | 3300048914 | Ga0496111_0060102 | Ga0496111_0060102_1178_2446 | 389 |
| 57 | 3300005436 | Ga0070713_100277836 | Ga0070713_1002778362 | 390 |
| 58 | 3300005840 | Ga0068870_10151976 | Ga0068870_101519761 | 390 |
| 59 | 3300006175 | Ga0070712_100028203 | Ga0070712_1000282032 | 390 |
| 60 | 3300009545 | Ga0105237_10001714 | Ga0105237_1000171417 | 390 |
| 61 | 3300013307 | Ga0157372_10101330 | Ga0157372_101013302 | 390 |
| 62 | 3300021384 | Ga0213876_10037706 | Ga0213876_100377062 | 390 |
| 63 | 3300025914 | Ga0207671_10001437 | Ga0207671_100014379 | 390 |
| 64 | 3300025915 | Ga0207693_10016198 | Ga0207693_100161983 | 390 |
| 65 | 3300025928 | Ga0207700_10221126 | Ga0207700_102211262 | 390 |
| 66 | 3300031251 | Ga0265327_10014238 | Ga0265327_100142383 | 390 |
| 67 | 3300035086 | Ga0373934_0000106 | Ga0373934_0000106_14283_15497 | 390 |
| 68 | 3300035111 | Ga0373923_0042578 | Ga0373923_0042578_183_1397 | 390 |
| 69 | 3300035117 | Ga0373953_0000028 | Ga0373953_0000028_25592_26806 | 390 |
| 70 | 3300035118 | Ga0373954_0025049 | Ga0373954_0025049_1451_2665 | 390 |
| 71 | 3300035119 | Ga0373956_0000564 | Ga0373956_0000564_4045_5259 | 390 |
| 72 | 3300035120 | Ga0373957_0000046 | Ga0373957_0000046_9896_11110 | 390 |
| 73 | 3300035172 | Ga0373955_0000151 | Ga0373955_0000151_24207_25421 | 390 |
| 74 | 3300035410 | Ga0373924_0000889 | Ga0373924_0000889_1052_2266 | 390 |
| 75 | 3300035724 | Ga0373933_0000012 | Ga0373933_0000012_32508_33722 | 390 |
| 76 | 3300036401 | Ga0373937_0000040 | Ga0373937_0000040_74450_75664 | 390 |
| 77 | 3300037418 | Ga0395900_0064832 | Ga0395900_0064832_2432_3673 | 390 |
| 78 | 3300044684 | Ga0466966_0124758 | Ga0466966_0124758_179_1447 | 390 |
| 79 | 3300046454 | Ga0495592_0000311 | Ga0495592_0000311_32663_33877 | 390 |
| 80 | 3300046462 | Ga0495651_0000040 | Ga0495651_0000040_19227_20441 | 390 |
| 81 | 3300046463 | Ga0495653_0003147 | Ga0495653_0003147_10674_11888 | 390 |
| 82 | 3300046511 | Ga0495608_0000044 | Ga0495608_0000044_32508_33722 | 390 |
| 83 | 3300046516 | Ga0495628_0000123 | Ga0495628_0000123_29578_30792 | 390 |
| 84 | 3300046529 | Ga0495652_0000108 | Ga0495652_0000108_60220_61434 | 390 |
| 85 | 3300046536 | Ga0495587_0000046 | Ga0495587_0000046_32508_33722 | 390 |
| 86 | 3300046559 | Ga0495667_0000066 | Ga0495667_0000066_49876_51090 | 390 |
| 87 | 3300046675 | Ga0495657_0000205 | Ga0495657_0000205_39841_41055 | 390 |
| 88 | 3300046678 | Ga0495599_0000052 | Ga0495599_0000052_27847_29061 | 390 |
| 89 | 3300046679 | Ga0495623_0000247 | Ga0495623_0000247_2395_3609 | 390 |
| 90 | 3300046680 | Ga0495646_0007889 | Ga0495646_0007889_4096_5310 | 390 |
| 91 | 3300047317 | Ga0495604_0000049 | Ga0495604_0000049_32481_33695 | 390 |
| 92 | 3300047322 | Ga0495680_0000908 | Ga0495680_0000908_10932_12146 | 390 |
| 93 | 3300047444 | Ga0495675_0001487 | Ga0495675_0001487_5989_7203 | 390 |
| 94 | 3300048088 | Ga0495602_0000232 | Ga0495602_0000232_11071_12285 | 390 |
| 95 | 3300049572 | Ga0501036_0048002 | Ga0501036_0048002_1214_2482 | 390 |
| 96 | 3300049575 | Ga0501039_0029593 | Ga0501039_0029593_2271_3539 | 390 |
| 97 | 3300049576 | Ga0501040_0018547 | Ga0501040_0018547_1082_2350 | 390 |
| 98 | 3300049580 | Ga0501046_0030498 | Ga0501046_0030498_2251_3519 | 390 |
| 99 | 3300049587 | Ga0501071_0004687 | Ga0501071_0004687_3674_4942 | 390 |
| 100 | 3300049588 | Ga0501072_0002769 | Ga0501072_0002769_4891_6159 | 390 |
| 101 | 3300049588 | Ga0501072_0101796 | Ga0501072_0101796_233_1450 | 390 |
| 102 | 3300049590 | Ga0501074_0110346 | Ga0501074_0110346_307_1575 | 390 |
| 103 | 3300049591 | Ga0501075_0006880 | Ga0501075_0006880_4603_5871 | 390 |
| 104 | 3300049592 | Ga0501076_0004445 | Ga0501076_0004445_4550_5818 | 390 |
| 105 | 3300049593 | Ga0501077_0001591 | Ga0501077_0001591_6905_8173 | 390 |
| 106 | 3300049741 | Ga0501079_0005521 | Ga0501079_0005521_1542_2810 | 390 |
| 107 | 3300049743 | Ga0501081_0001516 | Ga0501081_0001516_4120_5388 | 390 |
| 108 | 3300049824 | Ga0501045_0002832 | Ga0501045_0002832_4027_5295 | 390 |
| 109 | 3300053077 | Ga0495601_0023892 | Ga0495601_0023892_1495_2712 | 390 |
| 110 | 3300053078 | Ga0495612_0018445 | Ga0495612_0018445_1064_2281 | 390 |
| 111 | 3300053084 | Ga0495595_0000779 | Ga0495595_0000779_1835_3049 | 390 |
| 112 | 3300054114 | Ga0501084_0014285 | Ga0501084_0014285_4416_5684 | 390 |
| 113 | 3300060353 | Ga0501082_0006431 | Ga0501082_0006431_7108_8376 | 390 |
| 114 | 3300006881 | Ga0068865_100135876 | Ga0068865_1001358762 | 391 |
| 115 | 3300028654 | Ga0265322_10009612 | Ga0265322_100096124 | 391 |
| 116 | 3300048915 | Ga0496112_0008043 | Ga0496112_0008043_4315_5559 | 391 |
| 117 | 3300044694 | Ga0466963_0020607 | Ga0466963_0020607_454_1671 | 392 |
| 118 | 3300044842 | Ga0466957_0100227 | Ga0466957_0100227_443_1660 | 392 |
| 119 | 3300061719 | Ga0466962_0032630 | Ga0466962_0032630_203_1420 | 392 |
| 120 | 3300005983 | Ga0081540_1056370 | Ga0081540_10563701 | 393 |
| 121 | 3300009098 | Ga0105245_10068630 | Ga0105245_100686302 | 393 |
| 122 | 3300025935 | Ga0207709_10138985 | Ga0207709_101389851 | 393 |
| 123 | 3300028558 | Ga0265326_10000045 | Ga0265326_1000004516 | 393 |
| 124 | 3300028573 | Ga0265334_10000012 | Ga0265334_1000001293 | 393 |
| 125 | 3300028800 | Ga0265338_10007079 | Ga0265338_1000707912 | 393 |
| 126 | 3300039450 | Ga0436363_1198065 | Ga0436363_1198065_137_1357 | 393 |
| 127 | 3300005435 | Ga0070714_100000137 | Ga0070714_10000013744 | 394 |
| 128 | 3300005458 | Ga0070681_10054528 | Ga0070681_100545283 | 394 |
| 129 | 3300005530 | Ga0070679_100143887 | Ga0070679_1001438872 | 394 |
| 130 | 3300006028 | Ga0070717_10000004 | Ga0070717_10000004294 | 394 |
| 131 | 3300006846 | Ga0075430_100015786 | Ga0075430_1000157864 | 394 |
| 132 | 3300020081 | Ga0206354_10329131 | Ga0206354_103291314 | 394 |
| 133 | 3300020082 | Ga0206353_10644669 | Ga0206353_106446693 | 394 |
| 134 | 3300025929 | Ga0207664_10000006 | Ga0207664_10000006100 | 394 |
| 135 | 3300044693 | Ga0466961_0001531 | Ga0466961_0001531_6545_7801 | 394 |
| 136 | 3300044694 | Ga0466963_0031981 | Ga0466963_0031981_2007_3263 | 394 |
| 137 | 3300044719 | Ga0466971_0000264 | Ga0466971_0000264_5434_6690 | 394 |
| 138 | 3300044765 | Ga0466970_0054777 | Ga0466970_0054777_704_1960 | 394 |
| 139 | 3300044842 | Ga0466957_0025102 | Ga0466957_0025102_269_1525 | 394 |
| 140 | 3300044901 | Ga0466960_0000071 | Ga0466960_0000071_31298_32524 | 394 |
| 141 | 3300045836 | Ga0466958_0000900 | Ga0466958_0000900_7296_8552 | 394 |
| 142 | 3300045976 | Ga0466967_0023715 | Ga0466967_0023715_509_1765 | 394 |
| 143 | 3300045976 | Ga0466967_0035907 | Ga0466967_0035907_2714_3937 | 394 |
| 144 | 3300045976 | Ga0466967_0280235 | Ga0466967_0280235_152_1375 | 394 |
| 145 | 3300046471 | Ga0495650_0000079 | Ga0495650_0000079_60465_61691 | 394 |
| 146 | 3300049571 | Ga0501034_0088675 | Ga0501034_0088675_1429_2655 | 394 |
| 147 | 3300050509 | nmdc:mga0qj67_13071_c1 | nmdc:mga0qj67_13071_c1_1581_2804 | 394 |
| 148 | 3300053153 | Ga0500616_0005189 | Ga0500616_0005189_1113_2339 | 394 |
| 149 | 3300053153 | Ga0500616_0052537 | Ga0500616_0052537_48_1274 | 394 |
| 150 | 3300061719 | Ga0466962_0003518 | Ga0466962_0003518_852_2108 | 394 |
| 151 | 3300026118 | Ga0207675_100171243 | Ga0207675_1001712432 | 395 |
| 152 | 3300044719 | Ga0466971_0048246 | Ga0466971_0048246_61_1287 | 395 |
| 153 | 3300047321 | Ga0495676_0070461 | Ga0495676_0070461_708_1940 | 395 |
| 154 | 3300049576 | Ga0501040_0173484 | Ga0501040_0173484_91_1317 | 395 |
| 155 | 3300050511 | nmdc:mga08y16_53507_c1 | nmdc:mga08y16_53507_c1_2761_3987 | 395 |
| 156 | 3300005329 | Ga0070683_100008970 | Ga0070683_1000089705 | 396 |
| 157 | 3300005338 | Ga0068868_100149392 | Ga0068868_1001493922 | 396 |
| 158 | 3300005341 | Ga0070691_10060641 | Ga0070691_100606412 | 396 |
| 159 | 3300005344 | Ga0070661_100134443 | Ga0070661_1001344432 | 396 |
| 160 | 3300005366 | Ga0070659_100000013 | Ga0070659_100000013117 | 396 |
| 161 | 3300005437 | Ga0070710_10000005 | Ga0070710_10000005188 | 396 |
| 162 | 3300005441 | Ga0070700_100003875 | Ga0070700_1000038757 | 396 |
| 163 | 3300005466 | Ga0070685_10054767 | Ga0070685_100547672 | 396 |
| 164 | 3300005535 | Ga0070684_100007099 | Ga0070684_1000070993 | 396 |
| 165 | 3300005615 | Ga0070702_100017424 | Ga0070702_1000174244 | 396 |
| 166 | 3300005616 | Ga0068852_100023712 | Ga0068852_1000237122 | 396 |
| 167 | 3300005617 | Ga0068859_100167224 | Ga0068859_1001672242 | 396 |
| 168 | 3300005618 | Ga0068864_100013823 | Ga0068864_1000138235 | 396 |
| 169 | 3300005981 | Ga0081538_10015722 | Ga0081538_100157223 | 396 |
| 170 | 3300006175 | Ga0070712_100004885 | Ga0070712_1000048856 | 396 |
| 171 | 3300006852 | Ga0075433_10203798 | Ga0075433_102037981 | 396 |
| 172 | 3300006871 | Ga0075434_100013486 | Ga0075434_1000134866 | 396 |
| 173 | 3300006931 | Ga0097620_100167231 | Ga0097620_1001672312 | 396 |
| 174 | 3300007076 | Ga0075435_100101629 | Ga0075435_1001016292 | 396 |
| 175 | 3300009094 | Ga0111539_10004878 | Ga0111539_100048788 | 396 |
| 176 | 3300009098 | Ga0105245_10006226 | Ga0105245_100062265 | 396 |
| 177 | 3300009177 | Ga0105248_10056806 | Ga0105248_100568062 | 396 |
| 178 | 3300009545 | Ga0105237_10230915 | Ga0105237_102309152 | 396 |
| 179 | 3300009553 | Ga0105249_10224839 | Ga0105249_102248392 | 396 |
| 180 | 3300010375 | Ga0105239_10014189 | Ga0105239_100141894 | 396 |
| 181 | 3300011119 | Ga0105246_10159528 | Ga0105246_101595282 | 396 |
| 182 | 3300013296 | Ga0157374_10017109 | Ga0157374_100171093 | 396 |
| 183 | 3300013307 | Ga0157372_10033688 | Ga0157372_100336884 | 396 |
| 184 | 3300013308 | Ga0157375_10034974 | Ga0157375_100349744 | 396 |
| 185 | 3300014968 | Ga0157379_10005561 | Ga0157379_1000556110 | 396 |
| 186 | 3300025898 | Ga0207692_10000009 | Ga0207692_1000000998 | 396 |
| 187 | 3300025901 | Ga0207688_10002609 | Ga0207688_100026097 | 396 |
| 188 | 3300025901 | Ga0207688_10045745 | Ga0207688_100457453 | 396 |
| 189 | 3300025915 | Ga0207693_10027118 | Ga0207693_100271184 | 396 |
| 190 | 3300025927 | Ga0207687_10168608 | Ga0207687_101686082 | 396 |
| 191 | 3300025932 | Ga0207690_10000017 | Ga0207690_10000017191 | 396 |
| 192 | 3300025933 | Ga0207706_10022357 | Ga0207706_100223572 | 396 |
| 193 | 3300025937 | Ga0207669_10012401 | Ga0207669_100124012 | 396 |
| 194 | 3300025937 | Ga0207669_10030081 | Ga0207669_100300812 | 396 |
| 195 | 3300025942 | Ga0207689_10070989 | Ga0207689_100709892 | 396 |
| 196 | 3300025944 | Ga0207661_10009376 | Ga0207661_100093762 | 396 |
| 197 | 3300026023 | Ga0207677_10043691 | Ga0207677_100436912 | 396 |
| 198 | 3300026023 | Ga0207677_10187419 | Ga0207677_101874191 | 396 |
| 199 | 3300026075 | Ga0207708_10000262 | Ga0207708_1000026243 | 396 |
| 200 | 3300026078 | Ga0207702_10180588 | Ga0207702_101805882 | 396 |
| 201 | 3300026095 | Ga0207676_10071117 | Ga0207676_100711174 | 396 |
| 202 | 3300026116 | Ga0207674_10065151 | Ga0207674_100651512 | 396 |
| 203 | 3300027907 | Ga0207428_10110783 | Ga0207428_101107832 | 396 |
| 204 | 3300028379 | Ga0268266_10187300 | Ga0268266_101873002 | 396 |
| 205 | 3300031548 | Ga0307408_100122348 | Ga0307408_1001223482 | 396 |
| 206 | 3300031852 | Ga0307410_10026998 | Ga0307410_100269982 | 396 |
| 207 | 3300031903 | Ga0307407_10131384 | Ga0307407_101313841 | 396 |
| 208 | 3300031995 | Ga0307409_100078772 | Ga0307409_1000787721 | 396 |
| 209 | 3300037466 | Ga0395898_0145660 | Ga0395898_0145660_889_2118 | 396 |
| 210 | 3300039437 | Ga0436365_1591814 | Ga0436365_1591814_85_1314 | 396 |
| 211 | 3300039450 | Ga0436363_0002799 | Ga0436363_0002799_88_1317 | 396 |
| 212 | 3300039450 | Ga0436363_0805533 | Ga0436363_0805533_17077_18306 | 396 |
| 213 | 3300044684 | Ga0466966_0089186 | Ga0466966_0089186_419_1648 | 396 |
| 214 | 3300044694 | Ga0466963_0017143 | Ga0466963_0017143_267_1496 | 396 |
| 215 | 3300045836 | Ga0466958_0005873 | Ga0466958_0005873_2313_3542 | 396 |
| 216 | 3300045976 | Ga0466967_0003511 | Ga0466967_0003511_3218_4447 | 396 |
| 217 | 3300045976 | Ga0466967_0014961 | Ga0466967_0014961_4274_5503 | 396 |
| 218 | 3300046680 | Ga0495646_0063985 | Ga0495646_0063985_512_1744 | 396 |
| 219 | 3300048903 | Ga0496100_0101077 | Ga0496100_0101077_162_1391 | 396 |
| 220 | 3300048906 | Ga0496103_0079923 | Ga0496103_0079923_484_1713 | 396 |
| 221 | 3300048907 | Ga0496104_0088186 | Ga0496104_0088186_161_1390 | 396 |
| 222 | 3300048908 | Ga0496105_0018748 | Ga0496105_0018748_4001_5230 | 396 |
| 223 | 3300048909 | Ga0496106_0005657 | Ga0496106_0005657_2296_3525 | 396 |
| 224 | 3300048911 | Ga0496108_0013579 | Ga0496108_0013579_1551_2780 | 396 |
| 225 | 3300048912 | Ga0496109_0044486 | Ga0496109_0044486_1227_2456 | 396 |
| 226 | 3300048913 | Ga0496110_0011769 | Ga0496110_0011769_471_1700 | 396 |
| 227 | 3300048914 | Ga0496111_0084372 | Ga0496111_0084372_397_1626 | 396 |
| 228 | 3300048914 | Ga0496111_0095172 | Ga0496111_0095172_290_1519 | 396 |
| 229 | 3300048914 | Ga0496111_0147633 | Ga0496111_0147633_309_1538 | 396 |
| 230 | 3300048915 | Ga0496112_0049258 | Ga0496112_0049258_1451_2680 | 396 |
| 231 | 3300048916 | Ga0496113_0004197 | Ga0496113_0004197_5281_6510 | 396 |
| 232 | 3300049568 | Ga0501031_0026440 | Ga0501031_0026440_213_1442 | 396 |
| 233 | 3300049575 | Ga0501039_0012217 | Ga0501039_0012217_2099_3328 | 396 |
| 234 | 3300049576 | Ga0501040_0061747 | Ga0501040_0061747_422_1651 | 396 |
| 235 | 3300049577 | Ga0501041_0017058 | Ga0501041_0017058_1014_2243 | 396 |
| 236 | 3300049584 | Ga0501068_0113560 | Ga0501068_0113560_252_1481 | 396 |
| 237 | 3300049587 | Ga0501071_0026317 | Ga0501071_0026317_2101_3330 | 396 |
| 238 | 3300050508 | nmdc:mga09592_59534_c1 | nmdc:mga09592_59534_c1_378_1646 | 396 |
| 239 | 3300050512 | nmdc:mga0n895_236526_c1 | nmdc:mga0n895_236526_c1_354_1583 | 396 |
| 240 | 3300050513 | nmdc:mga0rr50_33333_c1 | nmdc:mga0rr50_33333_c1_2129_3358 | 396 |
| 241 | 3300050515 | nmdc:mga0a205_145742_c1 | nmdc:mga0a205_145742_c1_639_1868 | 396 |
| 242 | 3300061734 | Ga0530510_0134894 | Ga0530510_0134894_400_1629 | 396 |
| 243 | 3300005329 | Ga0070683_100089976 | Ga0070683_1000899762 | 397 |
| 244 | 3300005577 | Ga0068857_100113480 | Ga0068857_1001134802 | 397 |
| 245 | 3300021388 | Ga0213875_10013713 | Ga0213875_100137131 | 397 |
| 246 | 3300025898 | Ga0207692_10073290 | Ga0207692_100732902 | 397 |
| 247 | 3300025915 | Ga0207693_10000014 | Ga0207693_100000149 | 397 |
| 248 | 3300025915 | Ga0207693_10000327 | Ga0207693_1000032723 | 397 |
| 249 | 3300025919 | Ga0207657_10012370 | Ga0207657_100123706 | 397 |
| 250 | 3300025929 | Ga0207664_10009347 | Ga0207664_100093472 | 397 |
| 251 | 3300025944 | Ga0207661_10044840 | Ga0207661_100448402 | 397 |
| 252 | 3300028577 | Ga0265318_10005414 | Ga0265318_100054146 | 397 |
| 253 | 3300035117 | Ga0373953_0011505 | Ga0373953_0011505_855_2090 | 397 |
| 254 | 3300035118 | Ga0373954_0081389 | Ga0373954_0081389_86_1321 | 397 |
| 255 | 3300037466 | Ga0395898_0204210 | Ga0395898_0204210_22_1254 | 397 |
| 256 | 3300037853 | Ga0436364_0002493 | Ga0436364_0002493_1943_3175 | 397 |
| 257 | 3300037853 | Ga0436364_0792922 | Ga0436364_0792922_6966_8198 | 397 |
| 258 | 3300037853 | Ga0436364_1394916 | Ga0436364_1394916_5946_7178 | 397 |
| 259 | 3300038443 | Ga0395901_0102826 | Ga0395901_0102826_803_2035 | 397 |
| 260 | 3300044693 | Ga0466961_0045814 | Ga0466961_0045814_1525_2757 | 397 |
| 261 | 3300044706 | Ga0466964_0014695 | Ga0466964_0014695_1712_2953 | 397 |
| 262 | 3300045049 | Ga0466959_0011559 | Ga0466959_0011559_330_1562 | 397 |
| 263 | 3300045049 | Ga0466959_0037199 | Ga0466959_0037199_434_1666 | 397 |
| 264 | 3300045836 | Ga0466958_0061232 | Ga0466958_0061232_1025_2257 | 397 |
| 265 | 3300046462 | Ga0495651_0015650 | Ga0495651_0015650_3544_4779 | 397 |
| 266 | 3300046477 | Ga0495664_0132112 | Ga0495664_0132112_242_1477 | 397 |
| 267 | 3300046511 | Ga0495608_0020379 | Ga0495608_0020379_2581_3816 | 397 |
| 268 | 3300046516 | Ga0495628_0124535 | Ga0495628_0124535_185_1420 | 397 |
| 269 | 3300046559 | Ga0495667_0005842 | Ga0495667_0005842_4258_5493 | 397 |
| 270 | 3300046675 | Ga0495657_0005146 | Ga0495657_0005146_3922_5157 | 397 |
| 271 | 3300046678 | Ga0495599_0074594 | Ga0495599_0074594_62_1297 | 397 |
| 272 | 3300047315 | Ga0495581_0043482 | Ga0495581_0043482_268_1500 | 397 |
| 273 | 3300047317 | Ga0495604_0114876 | Ga0495604_0114876_572_1807 | 397 |
| 274 | 3300047322 | Ga0495680_0008665 | Ga0495680_0008665_4691_5926 | 397 |
| 275 | 3300047471 | Ga0495684_0010845 | Ga0495684_0010845_583_1818 | 397 |
| 276 | 3300048903 | Ga0496100_0006538 | Ga0496100_0006538_3552_4784 | 397 |
| 277 | 3300048904 | Ga0496101_0002545 | Ga0496101_0002545_6620_7852 | 397 |
| 278 | 3300048905 | Ga0496102_0056357 | Ga0496102_0056357_1585_2817 | 397 |
| 279 | 3300048907 | Ga0496104_0017521 | Ga0496104_0017521_5037_6269 | 397 |
| 280 | 3300048907 | Ga0496104_0019600 | Ga0496104_0019600_2679_3911 | 397 |
| 281 | 3300048908 | Ga0496105_0069285 | Ga0496105_0069285_725_1957 | 397 |
| 282 | 3300048909 | Ga0496106_0017212 | Ga0496106_0017212_3154_4386 | 397 |
| 283 | 3300048910 | Ga0496107_0007130 | Ga0496107_0007130_3311_4543 | 397 |
| 284 | 3300048913 | Ga0496110_0011592 | Ga0496110_0011592_2517_3749 | 397 |
| 285 | 3300048915 | Ga0496112_0001374 | Ga0496112_0001374_13870_15102 | 397 |
| 286 | 3300048915 | Ga0496112_0051335 | Ga0496112_0051335_1603_2838 | 397 |
| 287 | 3300049577 | Ga0501041_0032748 | Ga0501041_0032748_20_1258 | 397 |
| 288 | 3300049742 | Ga0501080_0015652 | Ga0501080_0015652_4080_5312 | 397 |
| 289 | 3300053083 | Ga0495655_0031746 | Ga0495655_0031746_12_1244 | 397 |
| 290 | 3300003203 | JGI25406J46586_10009703 | JGI25406J46586_100097034 | 398 |
| 291 | 3300005981 | Ga0081538_10002486 | Ga0081538_1000248616 | 398 |
| 292 | 3300005985 | Ga0081539_10002505 | Ga0081539_1000250516 | 398 |
| 293 | 3300006844 | Ga0075428_100223107 | Ga0075428_1002231072 | 398 |
| 294 | 3300006847 | Ga0075431_100003273 | Ga0075431_10000327315 | 398 |
| 295 | 3300027907 | Ga0207428_10087947 | Ga0207428_100879472 | 398 |
| 296 | 3300032126 | Ga0307415_100032615 | Ga0307415_1000326152 | 398 |
| 297 | 3300037466 | Ga0395898_0059817 | Ga0395898_0059817_343_1581 | 398 |
| 298 | 3300037853 | Ga0436364_0766301 | Ga0436364_0766301_2757_3992 | 398 |
| 299 | 3300038443 | Ga0395901_0229721 | Ga0395901_0229721_16_1254 | 398 |
| 300 | 3300039437 | Ga0436365_0260735 | Ga0436365_0260735_41_1288 | 398 |
| 301 | 3300044901 | Ga0466960_0054292 | Ga0466960_0054292_695_1930 | 398 |
| 302 | 3300045049 | Ga0466959_0087221 | Ga0466959_0087221_187_1422 | 398 |
| 303 | 3300048915 | Ga0496112_0274990 | Ga0496112_0274990_304_1539 | 398 |
| 304 | 3300049576 | Ga0501040_0054297 | Ga0501040_0054297_1086_2327 | 398 |
| 305 | 3300049578 | Ga0501042_0257552 | Ga0501042_0257552_12_1247 | 398 |
| 306 | 3300049592 | Ga0501076_0047158 | Ga0501076_0047158_1100_2341 | 398 |
| 307 | 3300049741 | Ga0501079_0036351 | Ga0501079_0036351_1581_2816 | 398 |
| 308 | 3300049743 | Ga0501081_0034117 | Ga0501081_0034117_713_1954 | 398 |
| 309 | 3300050509 | nmdc:mga0qj67_3730_c1 | nmdc:mga0qj67_3730_c1_9292_10539 | 398 |
| 310 | 3300050510 | nmdc:mga06r32_11407_c1 | nmdc:mga06r32_11407_c1_6361_7608 | 398 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8d2o-assembly1.cif.gz_A | structure of acidothermus cellulolyticus cas9 ternary complex (post-cleavage 2) | 0.8079 | 167 | 190 |
| 6wbr-assembly1.cif.gz_A | crystal structure of acecas9 bound with guide rna and dna with 5'-nnncc-3' pam | 0.7771 | 167 | 190 |
| 6wc0-assembly1.cif.gz_A | crystal structure of acecas9 bound with guide rna and dna with 5'-nnntc-3' pam | 0.7468 | 167 | 195 |
| 3iml-assembly1.cif.gz_B | crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei | 0.6566 | 8 | 388 |
| 3iml-assembly1.cif.gz_B | crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei | 0.655 | 8 | 388 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58EF9_292_361_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9781 | 277 | 343 | 3.30.300.10 |
| af_Q58EF9_292_361_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9242 | 277 | 343 | 3.30.300.10 |
| af_Q2G1W4_285_396_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.893 | 277 | 386 | 3.30.300.10 |
| af_Q2G1W4_138_246_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.8846 | 130 | 237 | 3.30.300.10 |
| af_B4FIE9_281_392_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.8789 | 277 | 376 | 3.30.300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W5XLI6-F1-model_v4 | S-adenosylmethionine synthase | 0.9406 | 26 | 92 |
GO:0004478
GO:0005524 GO:0006556 GO:0046872 |
| AF-X0V8T3-F1-model_v4 | S-adenosylmethionine synthetase C-terminal domain-containing protein | 0.9076 | 280 | 388 |
GO:0004478
GO:0005524 GO:0006556 GO:0006730 GO:0046872 |
| AF-A0A521U7F7-F1-model_v4 | Methionine adenosyltransferase (EC 2.5.1.6) | 0.9044 | 283 | 388 |
GO:0004478
GO:0005524 GO:0006556 GO:0006730 GO:0046872 |
| AF-H3KHF5-F1-model_v4 | S-adenosylmethionine synthetase domain protein | 0.9035 | 280 | 388 |
GO:0004478
GO:0005524 GO:0006556 GO:0006730 GO:0046872 |
| AF-A0A3D4YSU2-F1-model_v4 | deleted | 0.9029 | 284 | 388 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar