F400416

General Info

Members Datasets Scaffolds Average Seq Length
309 228 233 317

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0037946|Ga0501047_0037946_1629_2720
Length 363
Sequence LKRFSSHAIGLPNLLKTFNRERQLLFTFAFSARVSGSQSYQQNLNCMQNIPSVDLRDFLSGDPVRKQKFVNEIGKAYEDIGFVALKGHFLDDRLVDELYGEVRNFFNLPLETKKKYEIPGIGGQRGYVSFGKEHAKGRSAGDLKEFWHFGQYVDEDSKYADEYPANVSVEELPKFNEVGKEAYKMLEKTGVYVLRALALYLGLDEFYFDNYIKNGNSILRPIHYPPITDEPADGAVRAAAHGDINLITLLMGAQGRGLQVQNHNGEWIDAIAEPDELVINVGDMLSRHTNNRLKSTIHQVVNPPRELWGTSRFSIPFFMHPISEMKLDVLPETIDADHPKLYDDITAGEYLHERLVDLGLIKK

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
5 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
6 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
7 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
8 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
9 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
10 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
11 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
12 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
13 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
14 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
15 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
16 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
17 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
18 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
19 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
20 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
21 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
22 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
23 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
24 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
25 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
26 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
27 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
28 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
29 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
30 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
31 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
32 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
33 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
34 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
35 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
36 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
37 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
38 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
39 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
40 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
41 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
42 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
43 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
44 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
45 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
46 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
47 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
48 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
49 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
50 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
51 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
52 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
53 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
54 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
55 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
56 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
57 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
58 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
59 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
60 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
61 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
62 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
63 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
64 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
65 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
66 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
67 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
68 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
69 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
70 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
71 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
72 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
73 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
74 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
75 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
76 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
77 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
78 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
79 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
80 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
81 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
82 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
83 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
84 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
85 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
86 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
87 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
129 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
153 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
154 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
189 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
190 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
197 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
198 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
199 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
200 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
201 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
202 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
203 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
204 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
205 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
213 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
214 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
215 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
216 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
217 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
218 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
225 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
226 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
227 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
228 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.14
Metatranscriptomes 1.29
Isolates 25.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.65
Bulb 0
Endosphere 11
Nodule 0.97
Rhizoplane 0.65
Rhizosphere 62.78
Stem 0
Stem Tuber 0
Unclassified 23.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1005112 3300001915 Bacteria 2797
2 rootH1_10001854 3300003316 Bacteria 36865
3 rootH1_10001854 3300003323 Bacteria 9155
4 rootH1_10124213 3300003316 Bacteria 1781
5 rootH1_10124213 3300003323 Bacteria 2010
6 rootH2_10000765 3300003320 Bacteria 17073
7 rootH2_10034649 3300003320 Bacteria 5927
8 rootH2_10178517 3300003320 Bacteria 1906
9 rootL2_10091399 3300003322 Bacteria 2323
10 rootL2_10113574 3300003322 Bacteria 2381
11 rootL2_10119224 3300003322 Bacteria 1868
12 rootL2_10195689 3300003322 Bacteria 9843
13 rootL2_10210330 3300003322 Bacteria 3484
14 rootH1_10008582 3300003323 Bacteria 172664
15 rootH1_10022147 3300003323 Bacteria 28450
16 rootH1_10047352 3300003323 Bacteria 26752
17 rootH1_10135645 3300003316 Unclassified 1691
18 rootH1_10135645 3300003323 Bacteria 5855
19 rootH1_10162203 3300003323 Bacteria 3669
20 rootH1_10278701 3300003323 Bacteria 1124
21 Ga0006562J51391_1004858 3300003578 Bacteria 5677
22 Ga0055534_1010255 3300003784 Bacteria 1975
23 Ga0065165_1000060 3300005262 Bacteria 180226
24 Ga0065165_1000470 3300005262 Bacteria 62866
25 Ga0065704_10093512 3300005289 Bacteria 2593
26 Ga0065704_10131789 3300005289 Bacteria 1620
27 Ga0070682_100055462 3300005337 Bacteria 2489
28 Ga0070660_100375530 3300005339 Bacteria 1173
29 Ga0070668_100083122 3300005347 Bacteria 2513
30 Ga0070669_100148915 3300005353 Bacteria 1810
31 Ga0070684_100007478 3300005535 Bacteria 8497
32 Ga0070704_100279530 3300005549 Bacteria 1382
33 Ga0068855_100439880 3300005563 Unclassified 1424
34 Ga0068859_100187170 3300005617 Bacteria 2154
35 Ga0075363_100000143 3300006048 Bacteria 17595
36 Ga0075362_10000021 3300006177 Bacteria 62684
37 Ga0075366_10000127 3300006195 Bacteria 31623
38 Ga0075370_10000061 3300006353 Bacteria 32363
39 Ga0075428_100007248 3300006844 Bacteria 12285
40 Ga0075430_100091682 3300006846 Bacteria 2541
41 Ga0097620_100187161 3300006931 Bacteria 2154
42 Ga0099824_1000204 3300006942 Bacteria 57939
43 Ga0105251_10103397 3300009011 Bacteria 1301
44 Ga0105244_10000013 3300009036 Bacteria 258350
45 Ga0105244_10000063 3300009036 Bacteria 122746
46 Ga0111539_10002481 3300009094 Bacteria 24471
47 Ga0111539_10042509 3300009094 Bacteria 5457
48 Ga0105247_10064603 3300009101 Bacteria 2274
49 Ga0105243_10000105 3300009148 Bacteria 96341
50 Ga0157373_10000002 3300013100 Bacteria 750094
51 Ga0157373_10000017 3300013100 Bacteria 173186
52 Ga0157371_10008315 3300013102 Bacteria 8286
53 Ga0157371_10024300 3300013102 Bacteria 4427
54 Ga0157370_10000135 3300013104 Bacteria 88550
55 Ga0157370_10002824 3300013104 Bacteria 20758
56 Ga0157370_10056141 3300013104 Bacteria 3748
57 Ga0157370_10065321 3300013104 Bacteria 3443
58 Ga0157370_10076647 3300013104 Bacteria 3150
59 Ga0157370_10105072 3300013104 Bacteria 2644
60 Ga0157370_10124645 3300013104 Bacteria 2405
61 Ga0157369_10003877 3300013105 Bacteria 17745
62 Ga0157369_10124796 3300013105 Bacteria 2730
63 Ga0163162_10033040 3300013306 Bacteria 5139
64 Ga0157375_10004323 3300013308 Bacteria 12334
65 Ga0157380_10123985 3300014326 Bacteria 2193
66 Ga0182008_10000068 3300014497 Bacteria 82807
67 Ga0182006_1000001 3300015261 Bacteria 1091090
68 Ga0182006_1011606 3300015261 Bacteria 3873
69 Ga0182007_10029693 3300015262 Bacteria 1871
70 Ga0163161_10000271 3300017792 Bacteria 45502
71 Ga0163161_10001173 3300017792 Bacteria 19671
72 Ga0163161_10026306 3300017792 Bacteria 4122
73 Ga0209675_1000034 3300025291 Bacteria 267827
74 Ga0209676_1000351 3300025292 Bacteria 87135
75 Ga0209050_1002713 3300025298 Bacteria 14367
76 Ga0209050_1023617 3300025298 Bacteria 2156
77 Ga0209257_1000007 3300025304 Bacteria 1564415
78 Ga0207655_1000031 3300025728 Bacteria 392265
79 Ga0207655_1000608 3300025728 Bacteria 43328
80 Ga0207681_10065758 3300025923 Bacteria 2508
81 Ga0207709_10000044 3300025935 Bacteria 241642
82 Ga0207689_10394559 3300025942 Bacteria 1153
83 Ga0207661_10006431 3300025944 Bacteria 8307
84 Ga0207667_10487423 3300025949 Unclassified 1251
85 Ga0207668_10031933 3300025972 Bacteria 3474
86 Ga0207678_10270663 3300026067 Bacteria 1457
87 Ga0209281_1000244 3300027111 Bacteria 109979
88 Ga0209968_1001729 3300027526 Bacteria 3303
89 Ga0307515_10000009 3300028794 Bacteria 653206
90 Ga0307515_10000790 3300028794 Bacteria 72891
91 Ga0307515_10116835 3300028794 Bacteria 3059
92 Ga0307515_10262028 3300028794 Bacteria 1463
93 Ga0265327_10079753 3300031251 Bacteria 1620
94 Ga0307509_10020966 3300031507 Bacteria 7404
95 Ga0307509_10040562 3300031507 Bacteria 5063
96 Ga0307408_100007147 3300031548 Bacteria 7392
97 Ga0307508_10085086 3300031616 Bacteria 2745
98 Ga0307405_10000007 3300031731 Bacteria 348101
99 Ga0307405_10014514 3300031731 Bacteria 4238
100 Ga0307405_10016854 3300031731 Unclassified 3995
101 Ga0307413_10000064 3300031824 Bacteria 26787
102 Ga0307413_10073323 3300031824 Unclassified 2164
103 Ga0307410_10000192 3300031852 Bacteria 22657
104 Ga0307406_10000231 3300031901 Bacteria 33918
105 Ga0307406_10027335 3300031901 Bacteria 3437
106 Ga0307406_10039424 3300031901 Unclassified 2931
107 Ga0307407_10000289 3300031903 Bacteria 14848
108 Ga0307407_10017782 3300031903 Unclassified 3578
109 Ga0307412_10000324 3300031911 Bacteria 30175
110 Ga0307412_10000411 3300031911 Bacteria 26119
111 Ga0307412_10113649 3300031911 Bacteria 1937
112 Ga0307409_100014982 3300031995 Bacteria 5068
113 Ga0307414_10000031 3300032004 Bacteria 186808
114 Ga0307414_10000063 3300032004 Bacteria 107710
115 Ga0307414_10000078 3300032004 Bacteria 90911
116 Ga0307414_10002195 3300032004 Bacteria 10183
117 Ga0307414_10035361 3300032004 Bacteria 3324
118 Ga0307414_10037944 3300032004 Bacteria 3230
119 Ga0307414_10216015 3300032004 Unclassified 1571
120 Ga0307411_10000001 3300032005 Bacteria 931810
121 Ga0307415_100054069 3300032126 Unclassified 2739
122 Ga0373928_0029884 3300035084 Bacteria 1200
123 Ga0316574_0003328 3300035398 Bacteria 8272
124 Ga0373927_0030057 3300035695 Bacteria 3544
125 Ga0439466_0003954 3300041411 Bacteria 5716
126 Ga0439466_0042549 3300041411 Bacteria 1512
127 Ga0439465_0000004 3300041413 Bacteria 68032
128 Ga0451807_2436527 3300041486 Bacteria 1540
129 Ga0451853_3597845 3300041512 Bacteria 1994
130 Ga0439431_0030205 3300041997 Bacteria 1342
131 Ga0439445_0000609 3300042004 Bacteria 7333
132 Ga0450893_0025755 3300042532 Bacteria 1032
133 Ga0451577_0001898 3300042876 Bacteria 26504
134 Ga0451577_0047687 3300042876 Bacteria 3830
135 Ga0453683_0003762 3300044673 Bacteria 11069
136 Ga0453684_0003961 3300044712 Bacteria 32375
137 Ga0453684_0016601 3300044712 Bacteria 11491
138 Ga0451576_0009130 3300045051 Bacteria 11529
139 Ga0451576_0093538 3300045051 Bacteria 3126
140 Ga0495627_000012 3300046453 Bacteria 345654
141 Ga0495627_001742 3300046453 Bacteria 11762
142 Ga0495627_028308 3300046453 Bacteria 1791
143 Ga0495638_0000004 3300046460 Bacteria 700795
144 Ga0495585_0000477 3300046492 Bacteria 38276
145 Ga0495607_0104206 3300046501 Bacteria 1514
146 Ga0495606_0003248 3300046507 Bacteria 17433
147 Ga0495606_0007709 3300046507 Bacteria 9538
148 Ga0495610_0000005 3300046512 Bacteria 924111
149 Ga0495632_0003441 3300046519 Bacteria 11236
150 Ga0495643_0001272 3300046522 Bacteria 24178
151 Ga0495643_0014902 3300046522 Bacteria 4612
152 Ga0495648_0028287 3300046524 Bacteria 3736
153 Ga0495663_0000014 3300046525 Bacteria 149657
154 Ga0495654_0000003 3300046530 Bacteria 863485
155 Ga0495609_0000003 3300046538 Bacteria 711547
156 Ga0495633_0000001 3300046558 Bacteria 801972
157 Ga0495633_0000326 3300046558 Bacteria 53731
158 Ga0495625_0000251 3300046660 Bacteria 84084
159 Ga0495625_0003507 3300046660 Bacteria 15548
160 Ga0495625_0012581 3300046660 Bacteria 6850
161 Ga0495686_0000243 3300047472 Bacteria 98394
162 Ga0495686_0079843 3300047472 Bacteria 2000
163 Ga0495614_0020485 3300048089 Bacteria 2859
164 Ga0496115_0039326 3300048918 Bacteria 3756
165 Ga0496116_0000032 3300048919 Bacteria 419997
166 Ga0496116_0000068 3300048919 Bacteria 259724
167 Ga0496117_0000062 3300048920 Bacteria 257535
168 Ga0496118_0000578 3300048921 Bacteria 60550
169 Ga0496119_0000024 3300048922 Bacteria 257750
170 Ga0496120_0076625 3300048923 Bacteria 1822
171 Ga0496121_0014333 3300048924 Bacteria 8424
172 Ga0496122_0001956 3300048925 Bacteria 30869
173 Ga0496122_0002509 3300048925 Bacteria 25923
174 Ga0496122_0014790 3300048925 Bacteria 7518
175 Ga0496122_0068418 3300048925 Bacteria 2549
176 Ga0496123_0005568 3300048926 Bacteria 12609
177 Ga0496123_0015567 3300048926 Bacteria 6231
178 Ga0496124_0011057 3300048927 Bacteria 9059
179 Ga0496124_0011159 3300048927 Bacteria 9012
180 Ga0496125_0000059 3300048928 Bacteria 264149
181 Ga0496125_0000173 3300048928 Bacteria 144726
182 Ga0496125_0011894 3300048928 Bacteria 8670
183 Ga0496125_0016980 3300048928 Bacteria 6959
184 Ga0496126_0008062 3300048929 Bacteria 11415
185 Ga0496126_0014949 3300048929 Bacteria 7826
186 Ga0495682_0016219 3300049460 Bacteria 2820
187 Ga0501290_011902 3300049513 Bacteria 1124
188 Ga0501300_001207 3300049523 Bacteria 3924
189 Ga0501314_001832 3300049530 Bacteria 1582
190 Ga0501323_007760 3300049539 Bacteria 1232
191 Ga0501326_01122 3300049542 Bacteria 1201
192 Ga0501034_0067835 3300049571 Bacteria 3579
193 Ga0501047_0037946 3300049581 Bacteria 4660
194 Ga0501069_0167466 3300049585 Unclassified 1267
195 Ga0501202_000675 3300049652 Bacteria 5074
196 Ga0501202_008976 3300049652 Bacteria 1831
197 Ga0501210_002729 3300049657 Unclassified 1116
198 Ga0501217_002679 3300049661 Bacteria 3530
199 Ga0501236_000159 3300049670 Bacteria 7031
200 Ga0501249_000037 3300049679 Bacteria 63492
201 Ga0501257_001479 3300049686 Bacteria 4892
202 Ga0501257_015127 3300049686 Bacteria 1780
203 Ga0501241_000008 3300049758 Bacteria 137909
204 Ga0501266_000048 3300049763 Bacteria 20803
205 Ga0501269_000070 3300049766 Bacteria 31855
206 Ga0501269_006679 3300049766 Bacteria 1393
207 Ga0501280_002287 3300049776 Bacteria 3243
208 Ga0501035_0019774 3300049822 Bacteria 6186
209 nmdc:mga03683_69_c1 3300050489 Bacteria 38507
210 nmdc:mga0k408_133366_c1 3300050493 Bacteria 1160
211 nmdc:mga0k408_45_c1 3300050493 Bacteria 63055
212 nmdc:mga07m45_39_c1 3300050496 Bacteria 63381
213 nmdc:mga06r32_151924_c1 3300050510 Bacteria 2294
214 nmdc:mga08y16_19219_c1 3300050511 Bacteria 7199
215 nmdc:mga08y16_69796_c1 3300050511 Bacteria 3663
216 Ga0500646_0014142 3300053090 Bacteria 2070
217 Ga0500641_0000019 3300053096 Bacteria 123198
218 Ga0500641_0000195 3300053096 Bacteria 22840
219 Ga0500641_0000787 3300053096 Bacteria 11466
220 Ga0500557_012789 3300053105 Bacteria 2188
221 Ga0500594_0004155 3300053118 Bacteria 3191
222 Ga0500614_013339 3300053123 Bacteria 1805
223 Ga0500618_004158 3300053125 Bacteria 4725
224 Ga0500655_008032 3300053133 Unclassified 1900
225 Ga0500658_0000003 3300053134 Bacteria 512506
226 Ga0500559_0005977 3300053136 Bacteria 5530
227 Ga0500604_0000308 3300053151 Bacteria 13566
228 Ga0500616_0000015 3300053153 Bacteria 633259
229 Ga0500616_0099106 3300053153 Bacteria 1428
230 Ga0500622_0000015 3300053156 Bacteria 346227
231 Ga0500622_0000022 3300053156 Bacteria 267246
232 Ga0500622_0001289 3300053156 Bacteria 20422
233 Ga0500622_0056817 3300053156 Bacteria 2003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025298 Ga0209050_1002713 Ga0209050_100271312 265
2 3300050511 nmdc:mga08y16_69796_c1 nmdc:mga08y16_69796_c1_2801_3616 268
3 3300005353 Ga0070669_100148915 Ga0070669_1001489152 274
4 3300006048 Ga0075363_100000143 Ga0075363_10000014312 307
5 3300006177 Ga0075362_10000021 Ga0075362_1000002136 307
6 3300006195 Ga0075366_10000127 Ga0075366_1000012719 307
7 3300006353 Ga0075370_10000061 Ga0075370_1000006132 307
8 3300031616 Ga0307508_10085086 Ga0307508_100850862 307
9 3300035084 Ga0373928_0029884 Ga0373928_0029884_105_1040 307
10 3300050489 nmdc:mga03683_69_c1 nmdc:mga03683_69_c1_6777_7712 307
11 3300050493 nmdc:mga0k408_133366_c1 nmdc:mga0k408_133366_c1_165_1100 307
12 3300050493 nmdc:mga0k408_45_c1 nmdc:mga0k408_45_c1_31465_32400 307
13 3300050496 nmdc:mga07m45_39_c1 nmdc:mga07m45_39_c1_33933_34868 307
14 3300005262 Ga0065165_1000060 Ga0065165_1000060124 308
15 3300013102 Ga0157371_10024300 Ga0157371_100243002 308
16 3300025292 Ga0209676_1000351 Ga0209676_100035158 308
17 3300031731 Ga0307405_10014514 Ga0307405_100145144 308
18 3300031911 Ga0307412_10113649 Ga0307412_101136491 308
19 3300042532 Ga0450893_0025755 Ga0450893_0025755_54_983 308
20 iso_pu_bacteria 2522125168 2522548239 308
21 iso_pu_bacteria 2881247448 2881248111 311
22 iso_pu_bacteria 2511231000 2511234152 312
23 iso_pu_bacteria 2513020052 2513235075 312
24 iso_pu_bacteria 2519899754 2520879442 312
25 iso_pu_bacteria 2582581278 2585142125 312
26 iso_pu_bacteria 2582581281 2585159368 312
27 iso_pu_bacteria 2582581282 2585161441 312
28 iso_pu_bacteria 2582581873 2585426840 312
29 iso_pu_bacteria 2585428045 2587679162 312
30 iso_pu_bacteria 2585428060 2587747614 312
31 iso_pu_bacteria 2585428061 2587751960 312
32 iso_pu_bacteria 2585428095 2587866279 312
33 iso_pu_bacteria 2585428115 2587944917 312
34 iso_pu_bacteria 2585428182 2588211845 312
35 iso_pu_bacteria 2585428183 2588216490 312
36 iso_pu_bacteria 2585428184 2588217663 312
37 iso_pu_bacteria 2585428185 2588225387 312
38 iso_pu_bacteria 2585428187 2588232408 312
39 iso_pu_bacteria 2588253712 2588448282 312
40 iso_pu_bacteria 2588254255 2590603837 312
41 iso_pu_bacteria 2588254257 2590609554 312
42 iso_pu_bacteria 2643221600 2644013025 312
43 iso_pu_bacteria 2643221667 2644372336 312
44 iso_pu_bacteria 2643221716 2644642661 312
45 iso_pu_bacteria 2643221725 2644684804 312
46 iso_pu_bacteria 2728369107 2729201430 312
47 iso_pu_bacteria 2738541273 2738700766 312
48 iso_pu_bacteria 2738541279 2738732527 312
49 iso_pu_bacteria 2738541285 2738765092 312
50 iso_pu_bacteria 2738543007 2739214107 312
51 iso_pu_bacteria 2738543014 2739254515 312
52 iso_pu_bacteria 2739367857 2740001364 312
53 iso_pu_bacteria 2739367858 2740006180 312
54 iso_pu_bacteria 2751185877 2753674561 312
55 iso_pu_bacteria 2765235839 2765575010 312
56 iso_pu_bacteria 2772190705 2772603607 312
57 iso_pu_bacteria 2775506739 2775674856 312
58 iso_pu_bacteria 2802428842 2802653740 312
59 iso_pu_bacteria 2816332188 2816876296 312
60 iso_pu_bacteria 2816332280 2817416307 312
61 iso_pu_bacteria 2833640130 2833643684 312
62 iso_pu_bacteria 2842083920 2842084430 312
63 iso_pu_bacteria 2857613821 2857614990 312
64 iso_pu_bacteria 2857618242 2857618695 312
65 iso_pu_bacteria 2871720351 2871721984 312
66 iso_pu_bacteria 2881359912 2881363157 312
67 iso_pu_bacteria 2889290771 2889294428 312
68 iso_pu_bacteria 2903895155 2903896854 312
69 iso_pu_bacteria 2904419702 2904422842 312
70 iso_pu_bacteria 2904555929 2904557106 312
71 iso_pu_bacteria 2905999023 2906002244 312
72 iso_pu_bacteria 2919097161 2919098476 312
73 iso_pu_bacteria 2919191525 2919195266 312
74 iso_pu_bacteria 2919399522 2919401883 312
75 iso_pu_bacteria 2919509842 2919511997 312
76 iso_pu_bacteria 2919683626 2919687195 312
77 iso_pu_bacteria 2929150217 2929153601 312
78 iso_pu_bacteria 2945924605 2945925089 312
79 iso_pu_bacteria 2946019816 2946023478 312
80 iso_pu_bacteria 2958458903 2958461150 312
81 iso_pu_bacteria 2958512119 2958513110 312
82 iso_pu_bacteria 2965320100 2965320975 312
83 iso_pu_bacteria 2977243572 2977243853 312
84 iso_pu_bacteria 2977268062 2977270258 312
85 iso_pu_bacteria 2984572630 2984574169 312
86 iso_pu_bacteria 2984606641 2984607618 312
87 iso_pu_bacteria 2993372514 2993375398 312
88 iso_pu_bacteria 2993480792 2993482259 312
89 iso_pu_bacteria 8036736890 8036738281 312
90 iso_pu_bacteria 8054307821 8054310033 312
91 iso_pu_bacteria 8055419101 8055421970 312
92 iso_pu_bacteria 8055592153 8055593376 312
93 iso_pu_bacteria 8056440228 8056443850 312
94 3300003320 rootH2_10000765 rootH2_1000076515 315
95 3300003322 rootL2_10091399 rootL2_100913992 315
96 3300003322 rootL2_10113574 rootL2_101135741 315
97 3300003322 rootL2_10119224 rootL2_101192241 315
98 3300003322 rootL2_10195689 rootL2_101956895 315
99 3300003323 rootH1_10022147 rootH1_100221477 315
100 3300003323 rootH1_10135645 rootH1_101356452 315
101 3300005262 Ga0065165_1000470 Ga0065165_100047017 315
102 3300005549 Ga0070704_100279530 Ga0070704_1002795301 315
103 3300005563 Ga0068855_100439880 Ga0068855_1004398801 315
104 3300005617 Ga0068859_100187170 Ga0068859_1001871702 315
105 3300006844 Ga0075428_100007248 Ga0075428_1000072488 315
106 3300006846 Ga0075430_100091682 Ga0075430_1000916822 315
107 3300006931 Ga0097620_100187161 Ga0097620_1001871612 315
108 3300009094 Ga0111539_10002481 Ga0111539_1000248116 315
109 3300009094 Ga0111539_10042509 Ga0111539_100425093 315
110 3300014326 Ga0157380_10123985 Ga0157380_101239852 315
111 3300025298 Ga0209050_1023617 Ga0209050_10236172 315
112 3300025304 Ga0209257_1000007 Ga0209257_1000007537 315
113 3300025949 Ga0207667_10487423 Ga0207667_104874232 315
114 3300028794 Ga0307515_10000009 Ga0307515_10000009216 315
115 3300028794 Ga0307515_10000790 Ga0307515_100007907 315
116 3300028794 Ga0307515_10262028 Ga0307515_102620281 315
117 3300031251 Ga0265327_10079753 Ga0265327_100797532 315
118 3300031507 Ga0307509_10020966 Ga0307509_100209664 315
119 3300031507 Ga0307509_10040562 Ga0307509_100405622 315
120 3300031548 Ga0307408_100007147 Ga0307408_1000071473 315
121 3300031731 Ga0307405_10016854 Ga0307405_100168543 315
122 3300031824 Ga0307413_10073323 Ga0307413_100733232 315
123 3300031901 Ga0307406_10039424 Ga0307406_100394242 315
124 3300031903 Ga0307407_10017782 Ga0307407_100177823 315
125 3300031995 Ga0307409_100014982 Ga0307409_1000149824 315
126 3300032004 Ga0307414_10000078 Ga0307414_1000007849 315
127 3300032004 Ga0307414_10035361 Ga0307414_100353612 315
128 3300032004 Ga0307414_10216015 Ga0307414_102160152 315
129 3300032126 Ga0307415_100054069 Ga0307415_1000540692 315
130 3300035695 Ga0373927_0030057 Ga0373927_0030057_730_1701 315
131 3300041997 Ga0439431_0030205 Ga0439431_0030205_346_1317 315
132 3300042876 Ga0451577_0001898 Ga0451577_0001898_441_1421 315
133 3300042876 Ga0451577_0047687 Ga0451577_0047687_1188_2159 315
134 3300044673 Ga0453683_0003762 Ga0453683_0003762_9262_10233 315
135 3300044712 Ga0453684_0003961 Ga0453684_0003961_29875_30855 315
136 3300044712 Ga0453684_0016601 Ga0453684_0016601_7347_8318 315
137 3300045051 Ga0451576_0009130 Ga0451576_0009130_2234_3205 315
138 3300045051 Ga0451576_0093538 Ga0451576_0093538_769_1740 315
139 3300046460 Ga0495638_0000004 Ga0495638_0000004_629948_630919 315
140 3300046492 Ga0495585_0000477 Ga0495585_0000477_35266_36228 315
141 3300046524 Ga0495648_0028287 Ga0495648_0028287_2063_3025 315
142 3300046660 Ga0495625_0003507 Ga0495625_0003507_2063_3025 315
143 3300048089 Ga0495614_0020485 Ga0495614_0020485_1018_1980 315
144 3300049460 Ga0495682_0016219 Ga0495682_0016219_1206_2168 315
145 3300049513 Ga0501290_011902 Ga0501290_011902_115_1086 315
146 3300049523 Ga0501300_001207 Ga0501300_001207_2625_3596 315
147 3300049571 Ga0501034_0067835 Ga0501034_0067835_877_1905 315
148 3300049585 Ga0501069_0167466 Ga0501069_0167466_91_1062 315
149 3300049652 Ga0501202_000675 Ga0501202_000675_944_1915 315
150 3300049652 Ga0501202_008976 Ga0501202_008976_174_1145 315
151 3300049657 Ga0501210_002729 Ga0501210_002729_110_1081 315
152 3300049661 Ga0501217_002679 Ga0501217_002679_1382_2353 315
153 3300049670 Ga0501236_000159 Ga0501236_000159_4237_5208 315
154 3300049686 Ga0501257_001479 Ga0501257_001479_3033_4004 315
155 3300049686 Ga0501257_015127 Ga0501257_015127_50_1021 315
156 3300050510 nmdc:mga06r32_151924_c1 nmdc:mga06r32_151924_c1_22_993 315
157 3300050511 nmdc:mga08y16_19219_c1 nmdc:mga08y16_19219_c1_2407_3378 315
158 3300053105 Ga0500557_012789 Ga0500557_012789_425_1396 315
159 3300053123 Ga0500614_013339 Ga0500614_013339_208_1170 315
160 3300053133 Ga0500655_008032 Ga0500655_008032_275_1246 315
161 3300053151 Ga0500604_0000308 Ga0500604_0000308_1046_2017 315
162 3300053153 Ga0500616_0000015 Ga0500616_0000015_199118_200089 315
163 3300053153 Ga0500616_0099106 Ga0500616_0099106_115_1086 315
164 3300053156 Ga0500622_0000015 Ga0500622_0000015_81196_82167 315
165 3300053156 Ga0500622_0000022 Ga0500622_0000022_180821_181792 315
166 iso_pu_bacteria 2884634485 2884637697 315
167 iso_pu_bacteria 2919692658 2919693905 315
168 3300001915 JGI24741J21665_1005112 JGI24741J21665_10051122 316
169 3300003316 rootH1_10001854 rootH1_100018545 316
170 3300003316 rootH1_10124213 rootH1_101242131 316
171 3300003320 rootH2_10034649 rootH2_100346494 316
172 3300003320 rootH2_10178517 rootH2_101785172 316
173 3300003322 rootL2_10210330 rootL2_102103302 316
174 3300003323 rootH1_10008582 rootH1_1000858282 316
175 3300003323 rootH1_10047352 rootH1_1004735225 316
176 3300003323 rootH1_10162203 rootH1_101622034 316
177 3300003323 rootH1_10278701 rootH1_102787011 316
178 3300003578 Ga0006562J51391_1004858 Ga0006562J51391_10048581 316
179 3300003784 Ga0055534_1010255 Ga0055534_10102553 316
180 3300005289 Ga0065704_10093512 Ga0065704_100935122 316
181 3300005289 Ga0065704_10131789 Ga0065704_101317892 316
182 3300005337 Ga0070682_100055462 Ga0070682_1000554623 316
183 3300005339 Ga0070660_100375530 Ga0070660_1003755302 316
184 3300005347 Ga0070668_100083122 Ga0070668_1000831222 316
185 3300005535 Ga0070684_100007478 Ga0070684_1000074789 316
186 3300006942 Ga0099824_1000204 Ga0099824_100020431 316
187 3300009011 Ga0105251_10103397 Ga0105251_101033972 316
188 3300009036 Ga0105244_10000013 Ga0105244_10000013231 316
189 3300009036 Ga0105244_10000063 Ga0105244_1000006381 316
190 3300009101 Ga0105247_10064603 Ga0105247_100646032 316
191 3300009148 Ga0105243_10000105 Ga0105243_1000010569 316
192 3300013100 Ga0157373_10000002 Ga0157373_10000002558 316
193 3300013100 Ga0157373_10000017 Ga0157373_100000171 316
194 3300013102 Ga0157371_10008315 Ga0157371_100083158 316
195 3300013104 Ga0157370_10000135 Ga0157370_1000013572 316
196 3300013104 Ga0157370_10002824 Ga0157370_100028241 316
197 3300013104 Ga0157370_10056141 Ga0157370_100561412 316
198 3300013104 Ga0157370_10065321 Ga0157370_100653211 316
199 3300013104 Ga0157370_10076647 Ga0157370_100766471 316
200 3300013104 Ga0157370_10105072 Ga0157370_101050724 316
201 3300013104 Ga0157370_10124645 Ga0157370_101246453 316
202 3300013105 Ga0157369_10003877 Ga0157369_100038773 316
203 3300013105 Ga0157369_10124796 Ga0157369_101247961 316
204 3300013306 Ga0163162_10033040 Ga0163162_100330403 316
205 3300013308 Ga0157375_10004323 Ga0157375_100043234 316
206 3300014497 Ga0182008_10000068 Ga0182008_1000006850 316
207 3300015261 Ga0182006_1000001 Ga0182006_1000001230 316
208 3300015261 Ga0182006_1011606 Ga0182006_10116064 316
209 3300015262 Ga0182007_10029693 Ga0182007_100296932 316
210 3300017792 Ga0163161_10000271 Ga0163161_1000027122 316
211 3300017792 Ga0163161_10001173 Ga0163161_100011731 316
212 3300017792 Ga0163161_10026306 Ga0163161_100263063 316
213 3300025291 Ga0209675_1000034 Ga0209675_10000344 316
214 3300025728 Ga0207655_1000031 Ga0207655_1000031231 316
215 3300025728 Ga0207655_1000608 Ga0207655_10006089 316
216 3300025923 Ga0207681_10065758 Ga0207681_100657582 316
217 3300025935 Ga0207709_10000044 Ga0207709_1000004471 316
218 3300025942 Ga0207689_10394559 Ga0207689_103945592 316
219 3300025944 Ga0207661_10006431 Ga0207661_100064312 316
220 3300025972 Ga0207668_10031933 Ga0207668_100319333 316
221 3300026067 Ga0207678_10270663 Ga0207678_102706632 316
222 3300027111 Ga0209281_1000244 Ga0209281_100024484 316
223 3300027526 Ga0209968_1001729 Ga0209968_10017295 316
224 3300028794 Ga0307515_10116835 Ga0307515_101168352 316
225 3300031731 Ga0307405_10000007 Ga0307405_10000007141 316
226 3300031824 Ga0307413_10000064 Ga0307413_100000644 316
227 3300031852 Ga0307410_10000192 Ga0307410_100001929 316
228 3300031901 Ga0307406_10000231 Ga0307406_100002319 316
229 3300031901 Ga0307406_10027335 Ga0307406_100273355 316
230 3300031903 Ga0307407_10000289 Ga0307407_1000028913 316
231 3300031911 Ga0307412_10000324 Ga0307412_100003248 316
232 3300031911 Ga0307412_10000411 Ga0307412_100004112 316
233 3300032004 Ga0307414_10000031 Ga0307414_1000003130 316
234 3300032004 Ga0307414_10000063 Ga0307414_1000006369 316
235 3300032004 Ga0307414_10002195 Ga0307414_100021954 316
236 3300032004 Ga0307414_10037944 Ga0307414_100379442 316
237 3300032005 Ga0307411_10000001 Ga0307411_10000001409 316
238 3300035398 Ga0316574_0003328 Ga0316574_0003328_1788_2738 316
239 3300041411 Ga0439466_0003954 Ga0439466_0003954_275_1225 316
240 3300041411 Ga0439466_0042549 Ga0439466_0042549_121_1071 316
241 3300041413 Ga0439465_0000004 Ga0439465_0000004_34844_35794 316
242 3300041486 Ga0451807_2436527 Ga0451807_2436527_374_1324 316
243 3300041512 Ga0451853_3597845 Ga0451853_3597845_755_1729 316
244 3300042004 Ga0439445_0000609 Ga0439445_0000609_4857_5807 316
245 3300046453 Ga0495627_000012 Ga0495627_000012_6428_7378 316
246 3300046453 Ga0495627_001742 Ga0495627_001742_10080_11030 316
247 3300046453 Ga0495627_028308 Ga0495627_028308_23_973 316
248 3300046501 Ga0495607_0104206 Ga0495607_0104206_330_1280 316
249 3300046507 Ga0495606_0003248 Ga0495606_0003248_2488_3438 316
250 3300046507 Ga0495606_0007709 Ga0495606_0007709_4940_5890 316
251 3300046512 Ga0495610_0000005 Ga0495610_0000005_850184_851134 316
252 3300046519 Ga0495632_0003441 Ga0495632_0003441_3987_4937 316
253 3300046522 Ga0495643_0001272 Ga0495643_0001272_406_1356 316
254 3300046522 Ga0495643_0014902 Ga0495643_0014902_504_1454 316
255 3300046525 Ga0495663_0000014 Ga0495663_0000014_3501_4451 316
256 3300046530 Ga0495654_0000003 Ga0495654_0000003_161638_162588 316
257 3300046538 Ga0495609_0000003 Ga0495609_0000003_169050_170000 316
258 3300046558 Ga0495633_0000001 Ga0495633_0000001_242048_242998 316
259 3300046558 Ga0495633_0000326 Ga0495633_0000326_4100_5050 316
260 3300046660 Ga0495625_0000251 Ga0495625_0000251_23120_24070 316
261 3300046660 Ga0495625_0012581 Ga0495625_0012581_3820_4770 316
262 3300047472 Ga0495686_0000243 Ga0495686_0000243_8955_9905 316
263 3300047472 Ga0495686_0079843 Ga0495686_0079843_737_1687 316
264 3300048918 Ga0496115_0039326 Ga0496115_0039326_1112_2068 316
265 3300048919 Ga0496116_0000032 Ga0496116_0000032_101646_102596 316
266 3300048919 Ga0496116_0000068 Ga0496116_0000068_1623_2573 316
267 3300048920 Ga0496117_0000062 Ga0496117_0000062_1933_2883 316
268 3300048921 Ga0496118_0000578 Ga0496118_0000578_57950_58900 316
269 3300048922 Ga0496119_0000024 Ga0496119_0000024_1944_2894 316
270 3300048923 Ga0496120_0076625 Ga0496120_0076625_162_1112 316
271 3300048924 Ga0496121_0014333 Ga0496121_0014333_4623_5573 316
272 3300048925 Ga0496122_0001956 Ga0496122_0001956_7857_8807 316
273 3300048925 Ga0496122_0002509 Ga0496122_0002509_1961_2911 316
274 3300048925 Ga0496122_0014790 Ga0496122_0014790_315_1265 316
275 3300048925 Ga0496122_0068418 Ga0496122_0068418_1458_2408 316
276 3300048926 Ga0496123_0005568 Ga0496123_0005568_1955_2905 316
277 3300048926 Ga0496123_0015567 Ga0496123_0015567_1701_2651 316
278 3300048927 Ga0496124_0011057 Ga0496124_0011057_1605_2555 316
279 3300048927 Ga0496124_0011159 Ga0496124_0011159_4554_5504 316
280 3300048928 Ga0496125_0000059 Ga0496125_0000059_98700_99650 316
281 3300048928 Ga0496125_0000173 Ga0496125_0000173_13437_14393 316
282 3300048928 Ga0496125_0011894 Ga0496125_0011894_6319_7269 316
283 3300048928 Ga0496125_0016980 Ga0496125_0016980_4205_5155 316
284 3300048929 Ga0496126_0008062 Ga0496126_0008062_1815_2765 316
285 3300048929 Ga0496126_0014949 Ga0496126_0014949_5341_6291 316
286 3300049530 Ga0501314_001832 Ga0501314_001832_598_1548 316
287 3300049539 Ga0501323_007760 Ga0501323_007760_34_984 316
288 3300049542 Ga0501326_01122 Ga0501326_01122_220_1170 316
289 3300049581 Ga0501047_0037946 Ga0501047_0037946_1629_2720 316
290 3300049679 Ga0501249_000037 Ga0501249_000037_24500_25450 316
291 3300049758 Ga0501241_000008 Ga0501241_000008_130648_131598 316
292 3300049763 Ga0501266_000048 Ga0501266_000048_5788_6738 316
293 3300049766 Ga0501269_000070 Ga0501269_000070_2993_3943 316
294 3300049766 Ga0501269_006679 Ga0501269_006679_375_1325 316
295 3300049776 Ga0501280_002287 Ga0501280_002287_530_1480 316
296 3300049822 Ga0501035_0019774 Ga0501035_0019774_870_1961 316
297 3300053090 Ga0500646_0014142 Ga0500646_0014142_780_1730 316
298 3300053096 Ga0500641_0000019 Ga0500641_0000019_23784_24734 316
299 3300053096 Ga0500641_0000195 Ga0500641_0000195_8256_9212 316
300 3300053096 Ga0500641_0000787 Ga0500641_0000787_3979_4929 316
301 3300053118 Ga0500594_0004155 Ga0500594_0004155_878_1828 316
302 3300053125 Ga0500618_004158 Ga0500618_004158_73_1050 316
303 3300053134 Ga0500658_0000003 Ga0500658_0000003_216743_217693 316
304 3300053136 Ga0500559_0005977 Ga0500559_0005977_4000_4950 316
305 3300053156 Ga0500622_0001289 Ga0500622_0001289_7974_8948 316
306 3300053156 Ga0500622_0056817 Ga0500622_0056817_254_1204 316
307 iso_pu_bacteria 2739367866 2740032202 316
308 iso_pu_bacteria 2839989709 2839990450 316
309 iso_pu_bacteria 2910245624 2910250558 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14226

DIOX_N

non-haem dioxygenase in morphine synthesis N-terminal

50

171

0.91

PF03171

2OG-FeII_Oxy

2OG-Fe(II) oxygenase superfamily

214

321

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oox-assembly2.cif.gz_B crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution 0.9263 1 310
3oox-assembly1.cif.gz_A crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution 0.9217 1 310
3oox-assembly2.cif.gz_B crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution 0.9205 1 310
3oox-assembly1.cif.gz_A crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution 0.913 1 310
5c3p-assembly4.cif.gz_D crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg 0.9079 4 308
ID Description Score Start End Superfamily
3ooxB00 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.925 1 310 2.60.120.330
af_A4I478_1_315_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.925 4 310 2.60.120.330
3ooxB00 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9191 1 310 2.60.120.330
af_I1KAR7_20_352_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9101 4 310 2.60.120.330
af_A0A0R0GS27_18_187_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9057 2 85 2.60.120.330
ID Description Score Start End GO Terms
AF-A0A5C7UQ92-F1-model_v4 Isopenicillin N synthase family oxygenase 0.9817 3 315 GO:0009693
GO:0016491
GO:0046872
AF-A0A6A5L0Q3-F1-model_v4 deleted 0.9797 55 316
AF-A0A519N364-F1-model_v4 Isopenicillin N synthase family oxygenase 0.9775 80 316 GO:0016491
GO:0046872
AF-A0A1I1YWP1-F1-model_v4 Isopenicillin N synthase 0.9771 3 315 GO:0016491
GO:0046872
AF-A0A519N364-F1-model_v4 Isopenicillin N synthase family oxygenase 0.9735 80 316 GO:0016491
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.58 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map