F400403

General Info

Members Datasets Scaffolds Average Seq Length
309 172 618 166

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0015904|Ga0501031_0015904_1839_2414
Length 191
Sequence VPEQDGVDLILEQWRRERPDLDTTPMGVIGRISRLSWELERRLEPVFARQGLEEGLFDVLATLRRAGPPRRLRPTDLAASLMLTSSGATKRLDRLEQGGLIARQPEPTDRRGILIELTPAGRRLVDATLVEHVANEHNLLSALTPTERRQLASLLRKLLLGLPPVEDHAEPVPSPSSPTGESGLRSVRRSQ

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
110 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
111 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
112 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 8.09
Rhizosphere 90.94
Stem 0
Stem Tuber 0
Unclassified 8.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0015904 3300049568 Bacteria 4886
2 Ga0070658_10856344 3300005327 Bacteria 790
3 Ga0070683_100103625 3300005329 Bacteria 2681
4 Ga0070683_100304003 3300005329 Bacteria 1518
5 Ga0070683_100615967 3300005329 Bacteria 1039
6 Ga0070682_101468392 3300005337 Bacteria 585
7 Ga0070660_100394476 3300005339 Bacteria 1144
8 Ga0070689_101157159 3300005340 Bacteria 693
9 Ga0070692_10341075 3300005345 Bacteria 928
10 Ga0070692_10586468 3300005345 Bacteria 735
11 Ga0070692_10816535 3300005345 Bacteria 638
12 Ga0070668_101159106 3300005347 Bacteria 699
13 Ga0070659_100172871 3300005366 Bacteria 1770
14 Ga0070659_100913717 3300005366 Bacteria 768
15 Ga0070667_100510875 3300005367 Bacteria 1102
16 Ga0070714_100115718 3300005435 Bacteria 2380
17 Ga0070705_100017551 3300005440 Unclassified 3736
18 Ga0070700_100041180 3300005441 Bacteria 2831
19 Ga0070708_100525309 3300005445 Unclassified 1116
20 Ga0070708_101491003 3300005445 Unclassified 630
21 Ga0070663_100383643 3300005455 Bacteria 1145
22 Ga0070678_100113339 3300005456 Bacteria 2125
23 Ga0070662_100275418 3300005457 Unclassified 1360
24 Ga0070681_10940329 3300005458 Bacteria 783
25 Ga0068867_100287468 3300005459 Bacteria 1350
26 Ga0070685_10258036 3300005466 Bacteria 1158
27 Ga0070706_100135703 3300005467 Unclassified 2297
28 Ga0070707_100098601 3300005468 Unclassified 2830
29 Ga0070707_100119258 3300005468 Bacteria 2561
30 Ga0070707_100554758 3300005468 Bacteria 1111
31 Ga0070698_100092368 3300005471 Bacteria 3007
32 Ga0070698_100775975 3300005471 Unclassified 902
33 Ga0070699_100867230 3300005518 Bacteria 827
34 Ga0070679_100160015 3300005530 Bacteria 2226
35 Ga0070679_100805124 3300005530 Bacteria 883
36 Ga0070684_100318671 3300005535 Bacteria 1428
37 Ga0070697_100000579 3300005536 Bacteria 27659
38 Ga0070697_100007826 3300005536 Bacteria 8319
39 Ga0070697_100043354 3300005536 Bacteria 3642
40 Ga0070697_100443995 3300005536 Bacteria 1129
41 Ga0070697_100459280 3300005536 Unclassified 1110
42 Ga0070672_100384030 3300005543 Bacteria 1201
43 Ga0070695_100000557 3300005545 Bacteria 19738
44 Ga0070695_100329380 3300005545 Bacteria 1138
45 Ga0070696_100035304 3300005546 Bacteria 3442
46 Ga0070696_100068666 3300005546 Unclassified 2489
47 Ga0070696_101010257 3300005546 Bacteria 695
48 Ga0070665_100346850 3300005548 Bacteria 1490
49 Ga0070665_100708066 3300005548 Bacteria 1020
50 Ga0070704_100653662 3300005549 Unclassified 928
51 Ga0070704_100904021 3300005549 Bacteria 794
52 Ga0070664_100029021 3300005564 Bacteria 4609
53 Ga0070664_101035706 3300005564 Bacteria 772
54 Ga0068854_100174258 3300005578 Bacteria 1676
55 Ga0068854_100691513 3300005578 Bacteria 879
56 Ga0068856_100060697 3300005614 Bacteria 3735
57 Ga0068852_101844580 3300005616 Bacteria 627
58 Ga0068866_10885150 3300005718 Unclassified 627
59 Ga0068861_100585324 3300005719 Bacteria 1022
60 Ga0068860_101150874 3300005843 Bacteria 796
61 Ga0081455_10051438 3300005937 Bacteria 3534
62 Ga0081455_10213585 3300005937 Bacteria 1436
63 Ga0081540_1001097 3300005983 Bacteria 23965
64 Ga0081539_10002960 3300005985 Bacteria 22311
65 Ga0070717_10000009 3300006028 Bacteria 297183
66 Ga0070717_10393442 3300006028 Unclassified 1244
67 Ga0075365_10630207 3300006038 Bacteria 758
68 Ga0075432_10126666 3300006058 Bacteria 964
69 Ga0075428_100040520 3300006844 Bacteria 5123
70 Ga0075428_101702250 3300006844 Bacteria 658
71 Ga0075431_100115405 3300006847 Bacteria 2772
72 Ga0075434_101020335 3300006871 Bacteria 841
73 Ga0075436_100059093 3300006914 Bacteria 2648
74 Ga0075435_100273265 3300007076 Bacteria 1442
75 Ga0111539_10153365 3300009094 Bacteria 2696
76 Ga0111539_11119306 3300009094 Bacteria 915
77 Ga0105245_10198199 3300009098 Bacteria 1927
78 Ga0114129_10246081 3300009147 Bacteria 2402
79 Ga0114129_10518749 3300009147 Bacteria 1554
80 Ga0114129_12195134 3300009147 Bacteria 664
81 Ga0105243_10276094 3300009148 Bacteria 1511
82 Ga0105243_10654869 3300009148 Bacteria 1018
83 Ga0105241_10542204 3300009174 Bacteria 1043
84 Ga0105242_11371415 3300009176 Bacteria 733
85 Ga0105248_11401705 3300009177 Bacteria 791
86 Ga0105238_10708977 3300009551 Bacteria 1018
87 Ga0105249_11437743 3300009553 Bacteria 761
88 Ga0105239_10199104 3300010375 Bacteria 2244
89 Ga0105239_10601589 3300010375 Bacteria 1254
90 Ga0105239_11447217 3300010375 Bacteria 794
91 Ga0105246_10956076 3300011119 Bacteria 772
92 Ga0157371_10238316 3300013102 Bacteria 1308
93 Ga0163162_11375919 3300013306 Bacteria 803
94 Ga0157380_10741182 3300014326 Bacteria 993
95 Ga0157380_11073265 3300014326 Bacteria 843
96 Ga0182008_10597999 3300014497 Bacteria 619
97 Ga0157377_10334224 3300014745 Bacteria 1011
98 Ga0157377_10350207 3300014745 Bacteria 991
99 Ga0157377_11039242 3300014745 Unclassified 623
100 Ga0157376_10388352 3300014969 Bacteria 1346
101 Ga0213874_10228773 3300021377 Bacteria 678
102 Ga0207642_10581877 3300025899 Bacteria 695
103 Ga0207643_10072864 3300025908 Bacteria 1979
104 Ga0207684_10016241 3300025910 Bacteria 6395
105 Ga0207684_10096366 3300025910 Bacteria 2525
106 Ga0207707_10509445 3300025912 Bacteria 1026
107 Ga0207657_10255481 3300025919 Bacteria 1396
108 Ga0207649_10110288 3300025920 Bacteria 1837
109 Ga0207646_10078446 3300025922 Unclassified 2952
110 Ga0207646_10356576 3300025922 Bacteria 1321
111 Ga0207646_10455555 3300025922 Bacteria 1154
112 Ga0207646_10733717 3300025922 Bacteria 882
113 Ga0207659_11035195 3300025926 Bacteria 706
114 Ga0207687_11032198 3300025927 Bacteria 705
115 Ga0207664_10198966 3300025929 Bacteria 1729
116 Ga0207664_10721056 3300025929 Bacteria 897
117 Ga0207690_10376296 3300025932 Bacteria 1128
118 Ga0207690_10844565 3300025932 Bacteria 758
119 Ga0207706_10057238 3300025933 Bacteria 3435
120 Ga0207706_10687219 3300025933 Bacteria 875
121 Ga0207709_10058061 3300025935 Bacteria 2403
122 Ga0207709_10438490 3300025935 Bacteria 1007
123 Ga0207669_10382051 3300025937 Bacteria 1098
124 Ga0207691_10424138 3300025940 Bacteria 1133
125 Ga0207661_10379094 3300025944 Bacteria 1280
126 Ga0207661_10494016 3300025944 Bacteria 1118
127 Ga0207679_10147167 3300025945 Bacteria 1912
128 Ga0207679_10193449 3300025945 Bacteria 1693
129 Ga0207712_10064484 3300025961 Bacteria 2612
130 Ga0207712_10441780 3300025961 Bacteria 1101
131 Ga0207668_10051673 3300025972 Bacteria 2840
132 Ga0207668_10300411 3300025972 Bacteria 1325
133 Ga0207678_10247296 3300026067 Bacteria 1527
134 Ga0207708_10003676 3300026075 Bacteria 11329
135 Ga0207702_10567033 3300026078 Bacteria 1112
136 Ga0207648_10845452 3300026089 Bacteria 853
137 Ga0207648_11234314 3300026089 Bacteria 702
138 Ga0207674_10093451 3300026116 Bacteria 2996
139 Ga0207675_100189227 3300026118 Bacteria 1974
140 Ga0207675_100825316 3300026118 Bacteria 941
141 Ga0207683_10565771 3300026121 Bacteria 1051
142 Ga0207428_10054825 3300027907 Bacteria 3173
143 Ga0207428_10506100 3300027907 Bacteria 877
144 Ga0268265_10636416 3300028380 Bacteria 1024
145 Ga0268264_11057284 3300028381 Bacteria 819
146 Ga0307413_10091056 3300031824 Bacteria 1986
147 Ga0307410_10073794 3300031852 Bacteria 2374
148 Ga0307406_10044402 3300031901 Bacteria 2785
149 Ga0307406_10549415 3300031901 Bacteria 945
150 Ga0307406_10613717 3300031901 Bacteria 898
151 Ga0307406_10751528 3300031901 Bacteria 819
152 Ga0307407_10060299 3300031903 Bacteria 2214
153 Ga0307407_10085105 3300031903 Bacteria 1923
154 Ga0307412_10223970 3300031911 Bacteria 1443
155 Ga0307409_100196113 3300031995 Bacteria 1802
156 Ga0307409_100247594 3300031995 Bacteria 1627
157 Ga0307409_100325498 3300031995 Bacteria 1440
158 Ga0307409_100493419 3300031995 Bacteria 1191
159 Ga0307409_100620897 3300031995 Bacteria 1071
160 Ga0307409_100626730 3300031995 Bacteria 1066
161 Ga0307409_101422672 3300031995 Bacteria 720
162 Ga0307411_10479154 3300032005 Bacteria 1047
163 Ga0307411_10792233 3300032005 Bacteria 834
164 Ga0307411_10992881 3300032005 Bacteria 751
165 Ga0307415_100005629 3300032126 Bacteria 6669
166 Ga0307415_100599919 3300032126 Unclassified 980
167 Ga0307415_101034125 3300032126 Bacteria 765
168 Ga0395898_0124998 3300037466 Bacteria 2464
169 Ga0395898_0768089 3300037466 Bacteria 905
170 Ga0395898_1749260 3300037466 Bacteria 544
171 Ga0395898_1790053 3300037466 Bacteria 536
172 Ga0395905_0070293 3300037471 Bacteria 3280
173 Ga0395901_0115607 3300038443 Bacteria 2818
174 Ga0395901_0243075 3300038443 Bacteria 1877
175 Ga0395901_0519417 3300038443 Bacteria 1210
176 Ga0395901_0576239 3300038443 Bacteria 1138
177 Ga0395901_0733166 3300038443 Bacteria 983
178 Ga0439455_0123430 3300042012 Bacteria 727
179 Ga0450905_003444 3300042142 Bacteria 2079
180 Ga0439444_0047105 3300042437 Bacteria 865
181 Ga0439460_0080807 3300042461 Bacteria 1020
182 Ga0466965_0429837 3300044683 Bacteria 733
183 Ga0466963_0142269 3300044694 Bacteria 1662
184 Ga0466967_0010057 3300045976 Bacteria 7069
185 Ga0466967_0210110 3300045976 Bacteria 1846
186 Ga0466967_0517949 3300045976 Bacteria 1172
187 Ga0466967_1271448 3300045976 Bacteria 733
188 Ga0495629_0543943 3300046459 Bacteria 780
189 Ga0495641_0069334 3300046461 Bacteria 1585
190 Ga0495584_0055003 3300046491 Bacteria 2003
191 Ga0495598_0121544 3300046537 Bacteria 886
192 Ga0495656_0087171 3300046615 Bacteria 1421
193 Ga0495615_0144719 3300048090 Bacteria 704
194 Ga0496100_0032654 3300048903 Bacteria 3249
195 Ga0496102_0135129 3300048905 Bacteria 2311
196 Ga0496102_1425219 3300048905 Bacteria 612
197 Ga0496104_0004547 3300048907 Bacteria 12085
198 Ga0496104_0109243 3300048907 Bacteria 2651
199 Ga0496104_0184564 3300048907 Bacteria 1997
200 Ga0496105_0120845 3300048908 Bacteria 2160
201 Ga0496105_0388358 3300048908 Bacteria 1110
202 Ga0496106_0054981 3300048909 Bacteria 3008
203 Ga0496106_0354434 3300048909 Bacteria 1179
204 Ga0496107_0320435 3300048910 Bacteria 1153
205 Ga0496108_0002743 3300048911 Bacteria 14087
206 Ga0496108_0029782 3300048911 Bacteria 4523
207 Ga0496109_0035154 3300048912 Bacteria 4518
208 Ga0496109_0148473 3300048912 Bacteria 2194
209 Ga0496110_0009808 3300048913 Bacteria 7757
210 Ga0496110_0301178 3300048913 Bacteria 1460
211 Ga0496111_0005697 3300048914 Bacteria 8026
212 Ga0496111_0092615 3300048914 Bacteria 2215
213 Ga0496111_0251654 3300048914 Bacteria 1311
214 Ga0496112_0038071 3300048915 Bacteria 4696
215 Ga0496112_0107705 3300048915 Bacteria 2757
216 Ga0496113_0058385 3300048916 Bacteria 2903
217 Ga0496113_0101427 3300048916 Bacteria 2231
218 Ga0496115_0527083 3300048918 Bacteria 947
219 Ga0496119_0467854 3300048922 Bacteria 591
220 Ga0501031_0019270 3300049568 Bacteria 4443
221 Ga0501033_0991227 3300049570 Unclassified 562
222 Ga0501034_0112629 3300049571 Bacteria 2710
223 Ga0501034_0240016 3300049571 Bacteria 1759
224 Ga0501034_0413983 3300049571 Bacteria 1270
225 Ga0501036_0015461 3300049572 Bacteria 6375
226 Ga0501036_0024825 3300049572 Bacteria 5054
227 Ga0501036_0202974 3300049572 Bacteria 1667
228 Ga0501037_0033368 3300049573 Bacteria 3802
229 Ga0501038_0282823 3300049574 Bacteria 1305
230 Ga0501039_0022730 3300049575 Bacteria 4811
231 Ga0501039_0182272 3300049575 Bacteria 1651
232 Ga0501039_0392220 3300049575 Unclassified 1090
233 Ga0501040_0020105 3300049576 Bacteria 4448
234 Ga0501040_0092931 3300049576 Bacteria 2098
235 Ga0501040_0104785 3300049576 Bacteria 1975
236 Ga0501040_0208673 3300049576 Bacteria 1388
237 Ga0501041_0014092 3300049577 Bacteria 4744
238 Ga0501041_0697909 3300049577 Bacteria 649
239 Ga0501042_0027708 3300049578 Bacteria 3985
240 Ga0501042_0301288 3300049578 Unclassified 1158
241 Ga0501042_0756852 3300049578 Bacteria 707
242 Ga0501043_0057650 3300049579 Bacteria 3049
243 Ga0501043_0365638 3300049579 Unclassified 1094
244 Ga0501046_0038216 3300049580 Bacteria 3854
245 Ga0501046_0046212 3300049580 Bacteria 3457
246 Ga0501046_0052367 3300049580 Bacteria 3217
247 Ga0501046_0278007 3300049580 Unclassified 1227
248 Ga0501046_0554124 3300049580 Unclassified 819
249 Ga0501048_0022405 3300049582 Bacteria 4621
250 Ga0501048_0039590 3300049582 Bacteria 3381
251 Ga0501048_0221686 3300049582 Bacteria 1341
252 Ga0501048_0359706 3300049582 Bacteria 1038
253 Ga0501068_0022364 3300049584 Bacteria 3697
254 Ga0501068_0188204 3300049584 Bacteria 1307
255 Ga0501068_0414046 3300049584 Bacteria 870
256 Ga0501069_0429755 3300049585 Bacteria 783
257 Ga0501070_0039588 3300049586 Bacteria 3931
258 Ga0501070_0392581 3300049586 Bacteria 1123
259 Ga0501070_0418280 3300049586 Bacteria 1083
260 Ga0501071_0037440 3300049587 Bacteria 3464
261 Ga0501071_0058540 3300049587 Bacteria 2787
262 Ga0501071_0229774 3300049587 Bacteria 1397
263 Ga0501071_0395813 3300049587 Bacteria 1054
264 Ga0501072_0024205 3300049588 Bacteria 4722
265 Ga0501072_0216268 3300049588 Unclassified 1527
266 Ga0501073_0026343 3300049589 Bacteria 4166
267 Ga0501073_0275595 3300049589 Unclassified 1161
268 Ga0501074_0010376 3300049590 Bacteria 6757
269 Ga0501074_0979754 3300049590 Bacteria 595
270 Ga0501075_0433506 3300049591 Bacteria 1002
271 Ga0501076_0084824 3300049592 Bacteria 2545
272 Ga0501076_0096424 3300049592 Bacteria 2382
273 Ga0501076_0126943 3300049592 Bacteria 2067
274 Ga0501076_1621350 3300049592 Bacteria 531
275 Ga0501077_0488482 3300049593 Bacteria 789
276 Ga0501079_0157398 3300049741 Bacteria 1771
277 Ga0501079_0426804 3300049741 Bacteria 1041
278 Ga0501079_0704466 3300049741 Bacteria 795
279 Ga0501080_0849438 3300049742 Bacteria 798
280 Ga0501081_0028942 3300049743 Bacteria 3741
281 Ga0501081_0080291 3300049743 Bacteria 2283
282 Ga0501083_0051882 3300049744 Bacteria 2757
283 Ga0501035_0016989 3300049822 Bacteria 6706
284 Ga0501035_0080707 3300049822 Bacteria 2872
285 Ga0501035_0738214 3300049822 Unclassified 791
286 Ga0501044_0302860 3300049823 Bacteria 1527
287 Ga0501045_0015153 3300049824 Bacteria 5472
288 Ga0501045_0068399 3300049824 Bacteria 2609
289 nmdc:mga05p37_494044_c1 3300050507 Bacteria 1406
290 nmdc:mga09592_606919_c1 3300050508 Bacteria 937
291 nmdc:mga06r32_566499_c1 3300050510 Bacteria 1109
292 nmdc:mga06r32_767538_c1 3300050510 Bacteria 926
293 nmdc:mga08y16_1449381_c1 3300050511 Bacteria 648
294 nmdc:mga08y16_273022_c1 3300050511 Bacteria 1745
295 nmdc:mga08x19_40746_c1 3300050514 Bacteria 2957
296 nmdc:mga08x19_921948_c1 3300050514 Bacteria 621
297 Ga0501084_0017441 3300054114 Bacteria 5970
298 Ga0501084_0075923 3300054114 Bacteria 2816
299 Ga0501084_0338453 3300054114 Bacteria 1271
300 Ga0501084_0475374 3300054114 Bacteria 1056
301 Ga0501084_0677108 3300054114 Unclassified 870
302 Ga0501084_0889923 3300054114 Bacteria 749
303 Ga0501082_0042224 3300060353 Bacteria 3931
304 Ga0501082_0145517 3300060353 Bacteria 2057
305 Ga0501082_0162285 3300060353 Bacteria 1942
306 Ga0501082_0189387 3300060353 Bacteria 1790
307 Ga0501082_0223357 3300060353 Bacteria 1639
308 Ga0530510_0005011 3300061734 Bacteria 9146
309 Ga0530510_0353151 3300061734 Bacteria 1104
310 Ga0501031_0015904
311 Ga0070658_10856344
312 Ga0070683_100103625
313 Ga0070683_100304003
314 Ga0070683_100615967
315 Ga0070682_101468392
316 Ga0070660_100394476
317 Ga0070689_101157159
318 Ga0070692_10341075
319 Ga0070692_10586468
320 Ga0070692_10816535
321 Ga0070668_101159106
322 Ga0070659_100172871
323 Ga0070659_100913717
324 Ga0070667_100510875
325 Ga0070714_100115718
326 Ga0070705_100017551
327 Ga0070700_100041180
328 Ga0070708_100525309
329 Ga0070708_101491003
330 Ga0070663_100383643
331 Ga0070678_100113339
332 Ga0070662_100275418
333 Ga0070681_10940329
334 Ga0068867_100287468
335 Ga0070685_10258036
336 Ga0070706_100135703
337 Ga0070707_100098601
338 Ga0070707_100119258
339 Ga0070707_100554758
340 Ga0070698_100092368
341 Ga0070698_100775975
342 Ga0070699_100867230
343 Ga0070679_100160015
344 Ga0070679_100805124
345 Ga0070684_100318671
346 Ga0070697_100000579
347 Ga0070697_100007826
348 Ga0070697_100043354
349 Ga0070697_100443995
350 Ga0070697_100459280
351 Ga0070672_100384030
352 Ga0070695_100000557
353 Ga0070695_100329380
354 Ga0070696_100035304
355 Ga0070696_100068666
356 Ga0070696_101010257
357 Ga0070665_100346850
358 Ga0070665_100708066
359 Ga0070704_100653662
360 Ga0070704_100904021
361 Ga0070664_100029021
362 Ga0070664_101035706
363 Ga0068854_100174258
364 Ga0068854_100691513
365 Ga0068856_100060697
366 Ga0068852_101844580
367 Ga0068866_10885150
368 Ga0068861_100585324
369 Ga0068860_101150874
370 Ga0081455_10051438
371 Ga0081455_10213585
372 Ga0081540_1001097
373 Ga0081539_10002960
374 Ga0070717_10000009
375 Ga0070717_10393442
376 Ga0075365_10630207
377 Ga0075432_10126666
378 Ga0075428_100040520
379 Ga0075428_101702250
380 Ga0075431_100115405
381 Ga0075434_101020335
382 Ga0075436_100059093
383 Ga0075435_100273265
384 Ga0111539_10153365
385 Ga0111539_11119306
386 Ga0105245_10198199
387 Ga0114129_10246081
388 Ga0114129_10518749
389 Ga0114129_12195134
390 Ga0105243_10276094
391 Ga0105243_10654869
392 Ga0105241_10542204
393 Ga0105242_11371415
394 Ga0105248_11401705
395 Ga0105238_10708977
396 Ga0105249_11437743
397 Ga0105239_10199104
398 Ga0105239_10601589
399 Ga0105239_11447217
400 Ga0105246_10956076
401 Ga0157371_10238316
402 Ga0163162_11375919
403 Ga0157380_10741182
404 Ga0157380_11073265
405 Ga0182008_10597999
406 Ga0157377_10334224
407 Ga0157377_10350207
408 Ga0157377_11039242
409 Ga0157376_10388352
410 Ga0213874_10228773
411 Ga0207642_10581877
412 Ga0207643_10072864
413 Ga0207684_10016241
414 Ga0207684_10096366
415 Ga0207707_10509445
416 Ga0207657_10255481
417 Ga0207649_10110288
418 Ga0207646_10078446
419 Ga0207646_10356576
420 Ga0207646_10455555
421 Ga0207646_10733717
422 Ga0207659_11035195
423 Ga0207687_11032198
424 Ga0207664_10198966
425 Ga0207664_10721056
426 Ga0207690_10376296
427 Ga0207690_10844565
428 Ga0207706_10057238
429 Ga0207706_10687219
430 Ga0207709_10058061
431 Ga0207709_10438490
432 Ga0207669_10382051
433 Ga0207691_10424138
434 Ga0207661_10379094
435 Ga0207661_10494016
436 Ga0207679_10147167
437 Ga0207679_10193449
438 Ga0207712_10064484
439 Ga0207712_10441780
440 Ga0207668_10051673
441 Ga0207668_10300411
442 Ga0207678_10247296
443 Ga0207708_10003676
444 Ga0207702_10567033
445 Ga0207648_10845452
446 Ga0207648_11234314
447 Ga0207674_10093451
448 Ga0207675_100189227
449 Ga0207675_100825316
450 Ga0207683_10565771
451 Ga0207428_10054825
452 Ga0207428_10506100
453 Ga0268265_10636416
454 Ga0268264_11057284
455 Ga0307413_10091056
456 Ga0307410_10073794
457 Ga0307406_10044402
458 Ga0307406_10549415
459 Ga0307406_10613717
460 Ga0307406_10751528
461 Ga0307407_10060299
462 Ga0307407_10085105
463 Ga0307412_10223970
464 Ga0307409_100196113
465 Ga0307409_100247594
466 Ga0307409_100325498
467 Ga0307409_100493419
468 Ga0307409_100620897
469 Ga0307409_100626730
470 Ga0307409_101422672
471 Ga0307411_10479154
472 Ga0307411_10792233
473 Ga0307411_10992881
474 Ga0307415_100005629
475 Ga0307415_100599919
476 Ga0307415_101034125
477 Ga0395898_0124998
478 Ga0395898_0768089
479 Ga0395898_1749260
480 Ga0395898_1790053
481 Ga0395905_0070293
482 Ga0395901_0115607
483 Ga0395901_0243075
484 Ga0395901_0519417
485 Ga0395901_0576239
486 Ga0395901_0733166
487 Ga0439455_0123430
488 Ga0450905_003444
489 Ga0439444_0047105
490 Ga0439460_0080807
491 Ga0466965_0429837
492 Ga0466963_0142269
493 Ga0466967_0010057
494 Ga0466967_0210110
495 Ga0466967_0517949
496 Ga0466967_1271448
497 Ga0495629_0543943
498 Ga0495641_0069334
499 Ga0495584_0055003
500 Ga0495598_0121544
501 Ga0495656_0087171
502 Ga0495615_0144719
503 Ga0496100_0032654
504 Ga0496102_0135129
505 Ga0496102_1425219
506 Ga0496104_0004547
507 Ga0496104_0109243
508 Ga0496104_0184564
509 Ga0496105_0120845
510 Ga0496105_0388358
511 Ga0496106_0054981
512 Ga0496106_0354434
513 Ga0496107_0320435
514 Ga0496108_0002743
515 Ga0496108_0029782
516 Ga0496109_0035154
517 Ga0496109_0148473
518 Ga0496110_0009808
519 Ga0496110_0301178
520 Ga0496111_0005697
521 Ga0496111_0092615
522 Ga0496111_0251654
523 Ga0496112_0038071
524 Ga0496112_0107705
525 Ga0496113_0058385
526 Ga0496113_0101427
527 Ga0496115_0527083
528 Ga0496119_0467854
529 Ga0501031_0019270
530 Ga0501033_0991227
531 Ga0501034_0112629
532 Ga0501034_0240016
533 Ga0501034_0413983
534 Ga0501036_0015461
535 Ga0501036_0024825
536 Ga0501036_0202974
537 Ga0501037_0033368
538 Ga0501038_0282823
539 Ga0501039_0022730
540 Ga0501039_0182272
541 Ga0501039_0392220
542 Ga0501040_0020105
543 Ga0501040_0092931
544 Ga0501040_0104785
545 Ga0501040_0208673
546 Ga0501041_0014092
547 Ga0501041_0697909
548 Ga0501042_0027708
549 Ga0501042_0301288
550 Ga0501042_0756852
551 Ga0501043_0057650
552 Ga0501043_0365638
553 Ga0501046_0038216
554 Ga0501046_0046212
555 Ga0501046_0052367
556 Ga0501046_0278007
557 Ga0501046_0554124
558 Ga0501048_0022405
559 Ga0501048_0039590
560 Ga0501048_0221686
561 Ga0501048_0359706
562 Ga0501068_0022364
563 Ga0501068_0188204
564 Ga0501068_0414046
565 Ga0501069_0429755
566 Ga0501070_0039588
567 Ga0501070_0392581
568 Ga0501070_0418280
569 Ga0501071_0037440
570 Ga0501071_0058540
571 Ga0501071_0229774
572 Ga0501071_0395813
573 Ga0501072_0024205
574 Ga0501072_0216268
575 Ga0501073_0026343
576 Ga0501073_0275595
577 Ga0501074_0010376
578 Ga0501074_0979754
579 Ga0501075_0433506
580 Ga0501076_0084824
581 Ga0501076_0096424
582 Ga0501076_0126943
583 Ga0501076_1621350
584 Ga0501077_0488482
585 Ga0501079_0157398
586 Ga0501079_0426804
587 Ga0501079_0704466
588 Ga0501080_0849438
589 Ga0501081_0028942
590 Ga0501081_0080291
591 Ga0501083_0051882
592 Ga0501035_0016989
593 Ga0501035_0080707
594 Ga0501035_0738214
595 Ga0501044_0302860
596 Ga0501045_0015153
597 Ga0501045_0068399
598 nmdc:mga05p37_494044_c1
599 nmdc:mga09592_606919_c1
600 nmdc:mga06r32_566499_c1
601 nmdc:mga06r32_767538_c1
602 nmdc:mga08y16_1449381_c1
603 nmdc:mga08y16_273022_c1
604 nmdc:mga08x19_40746_c1
605 nmdc:mga08x19_921948_c1
606 Ga0501084_0017441
607 Ga0501084_0075923
608 Ga0501084_0338453
609 Ga0501084_0475374
610 Ga0501084_0677108
611 Ga0501084_0889923
612 Ga0501082_0042224
613 Ga0501082_0145517
614 Ga0501082_0162285
615 Ga0501082_0189387
616 Ga0501082_0223357
617 Ga0530510_0005011
618 Ga0530510_0353151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

52

112

0.98

PF01047

MarR

MarR family

52

113

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.9057 57 126
3bja-assembly1.cif.gz_A-2 crystal structure of putative marr-like transcription regulator (np_978771.1) from bacillus cereus atcc 10987 at 2.38 a resolution 0.89 22 163
5f7p-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes 0.8856 53 117
2acj-assembly1.cif.gz_D crystal structure of the b/z junction containing dna bound to z-dna binding proteins 0.8855 56 118
3fm5-assembly3.cif.gz_B x-ray crystal structure of transcriptional regulator (marr family) from rhodococcus sp. rha1 0.8847 28 158
ID Description Score Start End Superfamily
af_Q4DKK4_76_138_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9241 59 119 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9221 52 116 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9204 53 116 1.10.10.10
af_Q2FVA7_2_143_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9199 24 164 1.10.10.10
af_P30852_292_361_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9115 72 105 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6I3CSZ0-F1-model_v4 MarR family transcriptional regulator 0.9692 2 159 GO:0003677
GO:0003700
AF-A0A094P7U1-F1-model_v4 HTH marR-type domain-containing protein 0.9679 2 159 GO:0003677
GO:0003700
AF-A0A7Z0C1V6-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.9674 1 158 GO:0003677
GO:0003700
GO:0006950
AF-A0A2N1STB5-F1-model_v4 deleted 0.9669 29 161
AF-A0A538PID5-F1-model_v4 MarR family transcriptional regulator 0.9654 2 158 GO:0003677
GO:0003700
GO:0006950

Map