F400400

General Info

Members Datasets Scaffolds Average Seq Length
309 209 618 205

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0000400|Ga0501031_0000400_12280_12948
Length 222
Sequence VSAHRQRPKSSSQTELDHVLIAVSDLAAAAREIEERHGLVSIAGGRHPGWGTANRIVPLGDAYLELVAVVDEAEAAQSPFGSWVAQAHPTLAKPLGWAVRTDELDDVARRLGLVVAAGSRATRDGRVMRWRMAGIEQAAAEPSLPFFIEWEHGTPPPGRATATHPAGVVQIAELQLHGDADRLAAWLGTHRLPITVRPGTPALTRIVLTATSGEIVFGDDRP

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
93 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 8.74
Rhizosphere 89
Stem 0
Stem Tuber 0
Unclassified 9.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0000400 3300049568 Bacteria 25368
2 Ga0070683_100027667 3300005329 Bacteria 5116
3 Ga0070683_100174080 3300005329 Bacteria 2043
4 Ga0070683_100679012 3300005329 Bacteria 986
5 Ga0070682_100102867 3300005337 Unclassified 1889
6 Ga0070668_100026022 3300005347 Bacteria 4437
7 Ga0070671_100425523 3300005355 Bacteria 1137
8 Ga0070674_100168990 3300005356 Bacteria 1666
9 Ga0070674_100193089 3300005356 Bacteria 1567
10 Ga0070659_100282079 3300005366 Bacteria 1382
11 Ga0070714_100825358 3300005435 Bacteria 898
12 Ga0070714_100830318 3300005435 Bacteria 896
13 Ga0070713_100255564 3300005436 Unclassified 1600
14 Ga0070711_100022883 3300005439 Bacteria 4057
15 Ga0070700_100054457 3300005441 Bacteria 2500
16 Ga0070708_100057156 3300005445 Bacteria 3472
17 Ga0068867_100116068 3300005459 Bacteria 2062
18 Ga0070706_100217162 3300005467 Bacteria 1785
19 Ga0070707_100125753 3300005468 Bacteria 2491
20 Ga0070707_100191388 3300005468 Bacteria 1995
21 Ga0070707_100456453 3300005468 Bacteria 1238
22 Ga0070698_100218325 3300005471 Bacteria 1841
23 Ga0070698_100264549 3300005471 Bacteria 1652
24 Ga0070679_100114648 3300005530 Bacteria 2680
25 Ga0070684_100124128 3300005535 Bacteria 2324
26 Ga0070684_100386748 3300005535 Bacteria 1289
27 Ga0070697_100000806 3300005536 Bacteria 23524
28 Ga0070697_100043651 3300005536 Bacteria 3631
29 Ga0068855_100064816 3300005563 Bacteria 4260
30 Ga0070664_100266846 3300005564 Bacteria 1541
31 Ga0068857_100138288 3300005577 Bacteria 2200
32 Ga0068854_100017770 3300005578 Bacteria 4765
33 Ga0068854_100297157 3300005578 Unclassified 1305
34 Ga0068856_100014846 3300005614 Bacteria 7517
35 Ga0068856_100673811 3300005614 Bacteria 1055
36 Ga0070702_100520342 3300005615 Bacteria 877
37 Ga0068852_100365651 3300005616 Bacteria 1412
38 Ga0068852_101270929 3300005616 Unclassified 758
39 Ga0068861_100356805 3300005719 Unclassified 1284
40 Ga0068860_100277858 3300005843 Bacteria 1636
41 Ga0081538_10000885 3300005981 Bacteria 32387
42 Ga0081538_10003889 3300005981 Bacteria 13949
43 Ga0081539_10009001 3300005985 Bacteria 8489
44 Ga0070717_10171164 3300006028 Bacteria 1889
45 Ga0070717_10321899 3300006028 Bacteria 1378
46 Ga0070712_100134694 3300006175 Bacteria 1877
47 Ga0070712_100313007 3300006175 Bacteria 1274
48 Ga0075428_100040637 3300006844 Bacteria 5115
49 Ga0075430_100005855 3300006846 Bacteria 10374
50 Ga0075430_100017049 3300006846 Bacteria 6187
51 Ga0075431_100002784 3300006847 Bacteria 16937
52 Ga0075434_100121092 3300006871 Bacteria 2632
53 Ga0075429_100061962 3300006880 Bacteria 3259
54 Ga0075429_100090096 3300006880 Bacteria 2675
55 Ga0075436_100084042 3300006914 Bacteria 2209
56 Ga0075435_100003414 3300007076 Bacteria 10772
57 Ga0105240_10040211 3300009093 Bacteria 5984
58 Ga0105245_10061710 3300009098 Bacteria 3380
59 Ga0114129_10013003 3300009147 Bacteria 11852
60 Ga0114129_10028407 3300009147 Bacteria 7927
61 Ga0114129_10430570 3300009147 Bacteria 1733
62 Ga0114129_10965065 3300009147 Bacteria 1076
63 Ga0105243_10108497 3300009148 Bacteria 2317
64 Ga0105242_11726494 3300009176 Unclassified 663
65 Ga0105248_10584023 3300009177 Bacteria 1261
66 Ga0157370_10143402 3300013104 Bacteria 2225
67 Ga0157369_10046518 3300013105 Bacteria 4715
68 Ga0157369_10397369 3300013105 Unclassified 1430
69 Ga0157374_10026138 3300013296 Bacteria 5250
70 Ga0157378_10078143 3300013297 Bacteria 2984
71 Ga0157378_10423890 3300013297 Bacteria 1316
72 Ga0157372_10023065 3300013307 Bacteria 6744
73 Ga0163163_11573802 3300014325 Bacteria 718
74 Ga0157377_10176163 3300014745 Bacteria 1341
75 Ga0157376_10880994 3300014969 Bacteria 912
76 Ga0213876_10007764 3300021384 Bacteria 5823
77 Ga0213875_10065869 3300021388 Bacteria 1693
78 Ga0207426_1021431 3300025302 Bacteria 2235
79 Ga0207654_10445761 3300025911 Unclassified 907
80 Ga0207707_10044743 3300025912 Bacteria 3858
81 Ga0207695_10026277 3300025913 Bacteria 6499
82 Ga0207693_10523157 3300025915 Bacteria 925
83 Ga0207660_10439226 3300025917 Bacteria 1054
84 Ga0207652_10078018 3300025921 Bacteria 2891
85 Ga0207646_10092762 3300025922 Bacteria 2703
86 Ga0207646_10168211 3300025922 Bacteria 1979
87 Ga0207646_10536577 3300025922 Unclassified 1052
88 Ga0207694_10430310 3300025924 Unclassified 1100
89 Ga0207687_10009594 3300025927 Bacteria 6327
90 Ga0207687_10114480 3300025927 Unclassified 2007
91 Ga0207700_10256841 3300025928 Unclassified 1495
92 Ga0207700_10893925 3300025928 Bacteria 795
93 Ga0207664_10315027 3300025929 Bacteria 1379
94 Ga0207711_10298075 3300025941 Bacteria 1487
95 Ga0207661_10125984 3300025944 Bacteria 2187
96 Ga0207661_10215527 3300025944 Bacteria 1694
97 Ga0207640_10016418 3300025981 Bacteria 4307
98 Ga0207703_10738199 3300026035 Bacteria 938
99 Ga0207708_10214643 3300026075 Bacteria 1539
100 Ga0207702_10016900 3300026078 Bacteria 6037
101 Ga0207702_10171251 3300026078 Bacteria 1991
102 Ga0207702_10696525 3300026078 Bacteria 1001
103 Ga0207702_11180478 3300026078 Unclassified 760
104 Ga0207648_10120678 3300026089 Bacteria 2305
105 Ga0207674_10339530 3300026116 Bacteria 1452
106 Ga0207675_100157889 3300026118 Bacteria 2162
107 Ga0207698_10290442 3300026142 Bacteria 1517
108 Ga0268265_11248562 3300028380 Unclassified 742
109 Ga0268264_10172583 3300028381 Bacteria 1957
110 Ga0265327_10107345 3300031251 Bacteria 1339
111 Ga0307408_100040859 3300031548 Unclassified 3286
112 Ga0307405_10001227 3300031731 Bacteria 10661
113 Ga0307413_10168188 3300031824 Unclassified 1548
114 Ga0307410_10001822 3300031852 Bacteria 9904
115 Ga0307410_10388499 3300031852 Unclassified 1125
116 Ga0307406_10002506 3300031901 Bacteria 10013
117 Ga0307407_10050619 3300031903 Unclassified 2377
118 Ga0307412_10019167 3300031911 Bacteria 4136
119 Ga0307409_100022961 3300031995 Bacteria 4311
120 Ga0307416_100001423 3300032002 Bacteria 13000
121 Ga0307416_100046645 3300032002 Bacteria 3422
122 Ga0307416_100442059 3300032002 Unclassified 1351
123 Ga0307411_10134207 3300032005 Unclassified 1814
124 Ga0307411_10195119 3300032005 Unclassified 1550
125 Ga0307415_100001569 3300032126 Bacteria 11012
126 Ga0373926_0249460 3300035083 Unclassified 688
127 Ga0373944_0018635 3300035089 Bacteria 1984
128 Ga0373923_0019194 3300035111 Bacteria 2644
129 Ga0373936_0075544 3300035113 Bacteria 1395
130 Ga0373943_0003907 3300035170 Bacteria 6785
131 Ga0373943_0346038 3300035170 Bacteria 851
132 Ga0373955_0118164 3300035172 Bacteria 1539
133 Ga0373935_0015004 3300035692 Bacteria 4678
134 Ga0373947_0010956 3300035725 Bacteria 5205
135 Ga0373947_0080647 3300035725 Bacteria 2013
136 Ga0373925_0111039 3300037068 Bacteria 2118
137 Ga0373925_0117469 3300037068 Bacteria 2061
138 Ga0395899_0054924 3300037312 Bacteria 2946
139 Ga0395900_0143915 3300037418 Bacteria 2439
140 Ga0395900_0855661 3300037418 Bacteria 835
141 Ga0395898_0019515 3300037466 Bacteria 6898
142 Ga0395905_0039693 3300037471 Bacteria 4416
143 Ga0436364_0225640 3300037853 Bacteria 2012
144 Ga0395901_0094148 3300038443 Bacteria 3137
145 Ga0436365_0154238 3300039437 Bacteria 1246
146 Ga0436365_1576742 3300039437 Bacteria 7505
147 Ga0436363_1197989 3300039450 Bacteria 1298
148 Ga0439440_0007118 3300042993 Bacteria 2267
149 Ga0466963_0002471 3300044694 Bacteria 10336
150 Ga0466963_0004281 3300044694 Bacteria 8285
151 Ga0466963_0936109 3300044694 Unclassified 610
152 Ga0466971_0110051 3300044719 Bacteria 1270
153 Ga0466959_0022559 3300045049 Bacteria 4655
154 Ga0466958_0077435 3300045836 Bacteria 2042
155 Ga0466967_0042385 3300045976 Bacteria 3932
156 Ga0466967_0057462 3300045976 Bacteria 3435
157 Ga0466967_0103223 3300045976 Bacteria 2609
158 Ga0495603_0013733 3300046455 Bacteria 4901
159 Ga0495629_0058965 3300046459 Bacteria 2684
160 Ga0495629_0435521 3300046459 Unclassified 889
161 Ga0495641_0016673 3300046461 Bacteria 3860
162 Ga0495580_0031832 3300046472 Bacteria 3809
163 Ga0495582_0016964 3300046473 Bacteria 3987
164 Ga0495639_0011049 3300046475 Bacteria 3891
165 Ga0495639_0187790 3300046475 Bacteria 1008
166 Ga0495662_0007491 3300046476 Bacteria 5394
167 Ga0495662_0021611 3300046476 Bacteria 3109
168 Ga0495664_0020791 3300046477 Bacteria 3789
169 Ga0495608_0071214 3300046511 Bacteria 2268
170 Ga0495628_0028751 3300046516 Bacteria 4515
171 Ga0495630_0081892 3300046517 Bacteria 2435
172 Ga0495666_0007724 3300046526 Bacteria 5382
173 Ga0495652_0169413 3300046529 Bacteria 1687
174 Ga0495640_0057776 3300046533 Bacteria 2647
175 Ga0495640_0081183 3300046533 Bacteria 2155
176 Ga0495586_0113383 3300046535 Bacteria 1510
177 Ga0495586_0210812 3300046535 Bacteria 1102
178 Ga0495587_0169792 3300046536 Bacteria 1239
179 Ga0495667_0016083 3300046559 Bacteria 5057
180 Ga0495667_0292043 3300046559 Bacteria 1034
181 Ga0495634_0015859 3300046642 Bacteria 5398
182 Ga0495634_0159198 3300046642 Bacteria 1424
183 Ga0495635_0021697 3300046663 Bacteria 4475
184 Ga0495588_0022076 3300046674 Bacteria 3144
185 Ga0495657_0008083 3300046675 Bacteria 8067
186 Ga0495623_0044491 3300046679 Bacteria 2821
187 Ga0495658_0001268 3300046683 Bacteria 13273
188 Ga0495658_0025643 3300046683 Bacteria 3153
189 Ga0495658_0215997 3300046683 Unclassified 1199
190 Ga0495613_0010217 3300046689 Bacteria 6973
191 Ga0495624_0019336 3300046690 Bacteria 4549
192 Ga0495624_0032991 3300046690 Bacteria 3355
193 Ga0495600_0045791 3300046809 Bacteria 2854
194 Ga0495581_0199293 3300047315 Bacteria 1171
195 Ga0495604_0049870 3300047317 Bacteria 3251
196 Ga0495674_0009199 3300047319 Bacteria 9387
197 Ga0495674_0033457 3300047319 Bacteria 4656
198 Ga0495676_0019841 3300047321 Bacteria 5908
199 Ga0495676_0026045 3300047321 Bacteria 5039
200 Ga0495676_0189351 3300047321 Bacteria 1436
201 Ga0495680_0012863 3300047322 Bacteria 7332
202 Ga0495684_0008978 3300047471 Bacteria 7718
203 Ga0495593_0007132 3300047673 Bacteria 6552
204 Ga0495602_0384211 3300048088 Bacteria 1005
205 Ga0495614_0016570 3300048089 Bacteria 3206
206 Ga0496101_0003330 3300048904 Bacteria 10000
207 Ga0496101_0016428 3300048904 Bacteria 5000
208 Ga0496102_0025157 3300048905 Bacteria 5296
209 Ga0496104_0003202 3300048907 Bacteria 14075
210 Ga0496104_0215117 3300048907 Unclassified 1833
211 Ga0496105_0111964 3300048908 Bacteria 2252
212 Ga0496105_0177412 3300048908 Bacteria 1745
213 Ga0496106_0004652 3300048909 Bacteria 10175
214 Ga0496107_0012817 3300048910 Bacteria 5858
215 Ga0496108_0130815 3300048911 Unclassified 2157
216 Ga0496108_0363694 3300048911 Bacteria 1263
217 Ga0496108_0658605 3300048911 Bacteria 910
218 Ga0496109_0028017 3300048912 Bacteria 5035
219 Ga0496109_0251880 3300048912 Bacteria 1663
220 Ga0496109_0653521 3300048912 Bacteria 988
221 Ga0496110_0517059 3300048913 Bacteria 1086
222 Ga0496111_0145772 3300048914 Bacteria 1755
223 Ga0496111_0214237 3300048914 Bacteria 1431
224 Ga0496112_0035143 3300048915 Bacteria 4879
225 Ga0496112_0570974 3300048915 Bacteria 1064
226 Ga0496113_0242776 3300048916 Bacteria 1437
227 Ga0496113_0785352 3300048916 Unclassified 757
228 Ga0496114_0005440 3300048917 Bacteria 9959
229 Ga0496114_0033079 3300048917 Bacteria 4259
230 Ga0496114_0113077 3300048917 Bacteria 2327
231 Ga0496114_0319451 3300048917 Unclassified 1372
232 Ga0496115_0004565 3300048918 Bacteria 10021
233 Ga0501031_0020248 3300049568 Bacteria 4337
234 Ga0501032_0002536 3300049569 Bacteria 14299
235 Ga0501032_0008899 3300049569 Bacteria 7298
236 Ga0501033_0001229 3300049570 Bacteria 22974
237 Ga0501034_0095615 3300049571 Bacteria 2967
238 Ga0501036_0000263 3300049572 Bacteria 35782
239 Ga0501036_0032382 3300049572 Bacteria 4416
240 Ga0501037_0000164 3300049573 Bacteria 62585
241 Ga0501037_0016010 3300049573 Bacteria 5519
242 Ga0501038_0000137 3300049574 Bacteria 62980
243 Ga0501038_0039173 3300049574 Bacteria 4146
244 Ga0501039_0001457 3300049575 Bacteria 17383
245 Ga0501039_0033492 3300049575 Bacteria 3961
246 Ga0501040_0001867 3300049576 Bacteria 13512
247 Ga0501041_0001225 3300049577 Bacteria 14057
248 Ga0501041_0007383 3300049577 Bacteria 6454
249 Ga0501042_0006159 3300049578 Bacteria 7778
250 Ga0501042_0009998 3300049578 Bacteria 6343
251 Ga0501043_0002050 3300049579 Bacteria 17198
252 Ga0501046_0000485 3300049580 Bacteria 39752
253 Ga0501047_0007371 3300049581 Bacteria 10344
254 Ga0501047_0060602 3300049581 Bacteria 3651
255 Ga0501048_0000104 3300049582 Bacteria 46669
256 Ga0501048_0017521 3300049582 Bacteria 5274
257 Ga0501067_0116859 3300049583 Bacteria 1483
258 Ga0501068_0000299 3300049584 Bacteria 24797
259 Ga0501069_0003005 3300049585 Bacteria 8680
260 Ga0501069_0009828 3300049585 Bacteria 5058
261 Ga0501070_0008554 3300049586 Bacteria 8653
262 Ga0501070_0096499 3300049586 Bacteria 2445
263 Ga0501070_0336387 3300049586 Bacteria 1227
264 Ga0501071_0011749 3300049587 Bacteria 5908
265 Ga0501071_0016524 3300049587 Bacteria 5076
266 Ga0501072_0001526 3300049588 Bacteria 17331
267 Ga0501072_0001784 3300049588 Bacteria 16016
268 Ga0501072_0596556 3300049588 Bacteria 871
269 Ga0501073_0009526 3300049589 Bacteria 7168
270 Ga0501073_0015528 3300049589 Bacteria 5524
271 Ga0501074_0001524 3300049590 Bacteria 15666
272 Ga0501075_0002416 3300049591 Bacteria 12418
273 Ga0501075_0014818 3300049591 Bacteria 5590
274 Ga0501076_0000279 3300049592 Bacteria 31787
275 Ga0501076_0001706 3300049592 Bacteria 14831
276 Ga0501077_0000516 3300049593 Bacteria 23424
277 Ga0501077_0002044 3300049593 Bacteria 12175
278 Ga0501077_0004308 3300049593 Bacteria 8614
279 Ga0501079_0003125 3300049741 Bacteria 12127
280 Ga0501079_0003733 3300049741 Bacteria 11234
281 Ga0501080_0003546 3300049742 Bacteria 13746
282 Ga0501080_0113719 3300049742 Unclassified 2509
283 Ga0501081_0001301 3300049743 Bacteria 15215
284 Ga0501083_0000877 3300049744 Bacteria 19884
285 Ga0501035_0000585 3300049822 Bacteria 40152
286 Ga0501044_0009290 3300049823 Bacteria 10730
287 Ga0501044_0020470 3300049823 Bacteria 7064
288 Ga0501045_0011831 3300049824 Bacteria 6130
289 nmdc:mga05p37_8680_c1 3300050507 Bacteria 12009
290 nmdc:mga09592_36703_c1 3300050508 Bacteria 4106
291 nmdc:mga09592_81113_c1 3300050508 Bacteria 2764
292 nmdc:mga0qj67_942_c1 3300050509 Bacteria 20015
293 nmdc:mga06r32_40527_c1 3300050510 Bacteria 4422
294 nmdc:mga0rr50_37899_c1 3300050513 Bacteria 3484
295 nmdc:mga08x19_14509_c1 3300050514 Bacteria 4779
296 Ga0495601_0003733 3300053077 Bacteria 8766
297 Ga0495601_0189509 3300053077 Bacteria 1344
298 Ga0495612_0004612 3300053078 Bacteria 5709
299 Ga0495595_0034588 3300053084 Bacteria 2286
300 Ga0495619_0083410 3300053085 Bacteria 2155
301 Ga0495619_0086117 3300053085 Bacteria 2123
302 Ga0501084_0000284 3300054114 Bacteria 38222
303 Ga0501084_0021148 3300054114 Bacteria 5425
304 Ga0501082_0017931 3300060353 Bacteria 6097
305 Ga0501082_0532047 3300060353 Bacteria 1028
306 Ga0501082_0731862 3300060353 Bacteria 866
307 Ga0466962_0014156 3300061719 Bacteria 3843
308 Ga0530510_0000229 3300061734 Bacteria 35007
309 Ga0530510_0126575 3300061734 Bacteria 1878
310 Ga0501031_0000400
311 Ga0070683_100027667
312 Ga0070683_100174080
313 Ga0070683_100679012
314 Ga0070682_100102867
315 Ga0070668_100026022
316 Ga0070671_100425523
317 Ga0070674_100168990
318 Ga0070674_100193089
319 Ga0070659_100282079
320 Ga0070714_100825358
321 Ga0070714_100830318
322 Ga0070713_100255564
323 Ga0070711_100022883
324 Ga0070700_100054457
325 Ga0070708_100057156
326 Ga0068867_100116068
327 Ga0070706_100217162
328 Ga0070707_100125753
329 Ga0070707_100191388
330 Ga0070707_100456453
331 Ga0070698_100218325
332 Ga0070698_100264549
333 Ga0070679_100114648
334 Ga0070684_100124128
335 Ga0070684_100386748
336 Ga0070697_100000806
337 Ga0070697_100043651
338 Ga0068855_100064816
339 Ga0070664_100266846
340 Ga0068857_100138288
341 Ga0068854_100017770
342 Ga0068854_100297157
343 Ga0068856_100014846
344 Ga0068856_100673811
345 Ga0070702_100520342
346 Ga0068852_100365651
347 Ga0068852_101270929
348 Ga0068861_100356805
349 Ga0068860_100277858
350 Ga0081538_10000885
351 Ga0081538_10003889
352 Ga0081539_10009001
353 Ga0070717_10171164
354 Ga0070717_10321899
355 Ga0070712_100134694
356 Ga0070712_100313007
357 Ga0075428_100040637
358 Ga0075430_100005855
359 Ga0075430_100017049
360 Ga0075431_100002784
361 Ga0075434_100121092
362 Ga0075429_100061962
363 Ga0075429_100090096
364 Ga0075436_100084042
365 Ga0075435_100003414
366 Ga0105240_10040211
367 Ga0105245_10061710
368 Ga0114129_10013003
369 Ga0114129_10028407
370 Ga0114129_10430570
371 Ga0114129_10965065
372 Ga0105243_10108497
373 Ga0105242_11726494
374 Ga0105248_10584023
375 Ga0157370_10143402
376 Ga0157369_10046518
377 Ga0157369_10397369
378 Ga0157374_10026138
379 Ga0157378_10078143
380 Ga0157378_10423890
381 Ga0157372_10023065
382 Ga0163163_11573802
383 Ga0157377_10176163
384 Ga0157376_10880994
385 Ga0213876_10007764
386 Ga0213875_10065869
387 Ga0207426_1021431
388 Ga0207654_10445761
389 Ga0207707_10044743
390 Ga0207695_10026277
391 Ga0207693_10523157
392 Ga0207660_10439226
393 Ga0207652_10078018
394 Ga0207646_10092762
395 Ga0207646_10168211
396 Ga0207646_10536577
397 Ga0207694_10430310
398 Ga0207687_10009594
399 Ga0207687_10114480
400 Ga0207700_10256841
401 Ga0207700_10893925
402 Ga0207664_10315027
403 Ga0207711_10298075
404 Ga0207661_10125984
405 Ga0207661_10215527
406 Ga0207640_10016418
407 Ga0207703_10738199
408 Ga0207708_10214643
409 Ga0207702_10016900
410 Ga0207702_10171251
411 Ga0207702_10696525
412 Ga0207702_11180478
413 Ga0207648_10120678
414 Ga0207674_10339530
415 Ga0207675_100157889
416 Ga0207698_10290442
417 Ga0268265_11248562
418 Ga0268264_10172583
419 Ga0265327_10107345
420 Ga0307408_100040859
421 Ga0307405_10001227
422 Ga0307413_10168188
423 Ga0307410_10001822
424 Ga0307410_10388499
425 Ga0307406_10002506
426 Ga0307407_10050619
427 Ga0307412_10019167
428 Ga0307409_100022961
429 Ga0307416_100001423
430 Ga0307416_100046645
431 Ga0307416_100442059
432 Ga0307411_10134207
433 Ga0307411_10195119
434 Ga0307415_100001569
435 Ga0373926_0249460
436 Ga0373944_0018635
437 Ga0373923_0019194
438 Ga0373936_0075544
439 Ga0373943_0003907
440 Ga0373943_0346038
441 Ga0373955_0118164
442 Ga0373935_0015004
443 Ga0373947_0010956
444 Ga0373947_0080647
445 Ga0373925_0111039
446 Ga0373925_0117469
447 Ga0395899_0054924
448 Ga0395900_0143915
449 Ga0395900_0855661
450 Ga0395898_0019515
451 Ga0395905_0039693
452 Ga0436364_0225640
453 Ga0395901_0094148
454 Ga0436365_0154238
455 Ga0436365_1576742
456 Ga0436363_1197989
457 Ga0439440_0007118
458 Ga0466963_0002471
459 Ga0466963_0004281
460 Ga0466963_0936109
461 Ga0466971_0110051
462 Ga0466959_0022559
463 Ga0466958_0077435
464 Ga0466967_0042385
465 Ga0466967_0057462
466 Ga0466967_0103223
467 Ga0495603_0013733
468 Ga0495629_0058965
469 Ga0495629_0435521
470 Ga0495641_0016673
471 Ga0495580_0031832
472 Ga0495582_0016964
473 Ga0495639_0011049
474 Ga0495639_0187790
475 Ga0495662_0007491
476 Ga0495662_0021611
477 Ga0495664_0020791
478 Ga0495608_0071214
479 Ga0495628_0028751
480 Ga0495630_0081892
481 Ga0495666_0007724
482 Ga0495652_0169413
483 Ga0495640_0057776
484 Ga0495640_0081183
485 Ga0495586_0113383
486 Ga0495586_0210812
487 Ga0495587_0169792
488 Ga0495667_0016083
489 Ga0495667_0292043
490 Ga0495634_0015859
491 Ga0495634_0159198
492 Ga0495635_0021697
493 Ga0495588_0022076
494 Ga0495657_0008083
495 Ga0495623_0044491
496 Ga0495658_0001268
497 Ga0495658_0025643
498 Ga0495658_0215997
499 Ga0495613_0010217
500 Ga0495624_0019336
501 Ga0495624_0032991
502 Ga0495600_0045791
503 Ga0495581_0199293
504 Ga0495604_0049870
505 Ga0495674_0009199
506 Ga0495674_0033457
507 Ga0495676_0019841
508 Ga0495676_0026045
509 Ga0495676_0189351
510 Ga0495680_0012863
511 Ga0495684_0008978
512 Ga0495593_0007132
513 Ga0495602_0384211
514 Ga0495614_0016570
515 Ga0496101_0003330
516 Ga0496101_0016428
517 Ga0496102_0025157
518 Ga0496104_0003202
519 Ga0496104_0215117
520 Ga0496105_0111964
521 Ga0496105_0177412
522 Ga0496106_0004652
523 Ga0496107_0012817
524 Ga0496108_0130815
525 Ga0496108_0363694
526 Ga0496108_0658605
527 Ga0496109_0028017
528 Ga0496109_0251880
529 Ga0496109_0653521
530 Ga0496110_0517059
531 Ga0496111_0145772
532 Ga0496111_0214237
533 Ga0496112_0035143
534 Ga0496112_0570974
535 Ga0496113_0242776
536 Ga0496113_0785352
537 Ga0496114_0005440
538 Ga0496114_0033079
539 Ga0496114_0113077
540 Ga0496114_0319451
541 Ga0496115_0004565
542 Ga0501031_0020248
543 Ga0501032_0002536
544 Ga0501032_0008899
545 Ga0501033_0001229
546 Ga0501034_0095615
547 Ga0501036_0000263
548 Ga0501036_0032382
549 Ga0501037_0000164
550 Ga0501037_0016010
551 Ga0501038_0000137
552 Ga0501038_0039173
553 Ga0501039_0001457
554 Ga0501039_0033492
555 Ga0501040_0001867
556 Ga0501041_0001225
557 Ga0501041_0007383
558 Ga0501042_0006159
559 Ga0501042_0009998
560 Ga0501043_0002050
561 Ga0501046_0000485
562 Ga0501047_0007371
563 Ga0501047_0060602
564 Ga0501048_0000104
565 Ga0501048_0017521
566 Ga0501067_0116859
567 Ga0501068_0000299
568 Ga0501069_0003005
569 Ga0501069_0009828
570 Ga0501070_0008554
571 Ga0501070_0096499
572 Ga0501070_0336387
573 Ga0501071_0011749
574 Ga0501071_0016524
575 Ga0501072_0001526
576 Ga0501072_0001784
577 Ga0501072_0596556
578 Ga0501073_0009526
579 Ga0501073_0015528
580 Ga0501074_0001524
581 Ga0501075_0002416
582 Ga0501075_0014818
583 Ga0501076_0000279
584 Ga0501076_0001706
585 Ga0501077_0000516
586 Ga0501077_0002044
587 Ga0501077_0004308
588 Ga0501079_0003125
589 Ga0501079_0003733
590 Ga0501080_0003546
591 Ga0501080_0113719
592 Ga0501081_0001301
593 Ga0501083_0000877
594 Ga0501035_0000585
595 Ga0501044_0009290
596 Ga0501044_0020470
597 Ga0501045_0011831
598 nmdc:mga05p37_8680_c1
599 nmdc:mga09592_36703_c1
600 nmdc:mga09592_81113_c1
601 nmdc:mga0qj67_942_c1
602 nmdc:mga06r32_40527_c1
603 nmdc:mga0rr50_37899_c1
604 nmdc:mga08x19_14509_c1
605 Ga0495601_0003733
606 Ga0495601_0189509
607 Ga0495612_0004612
608 Ga0495595_0034588
609 Ga0495619_0083410
610 Ga0495619_0086117
611 Ga0501084_0000284
612 Ga0501084_0021148
613 Ga0501082_0017931
614 Ga0501082_0532047
615 Ga0501082_0731862
616 Ga0466962_0014156
617 Ga0530510_0000229
618 Ga0530510_0126575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13468

Glyoxalase_3

Glyoxalase-like domain

16

192

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p8a-assembly2.cif.gz_B crystal structure of a hypothetical protein from staphylococcus aureus 0.813 3 182
3p8a-assembly1.cif.gz_A crystal structure of a hypothetical protein from staphylococcus aureus 0.8005 1 182
3p8a-assembly2.cif.gz_B crystal structure of a hypothetical protein from staphylococcus aureus 0.7546 3 182
3p8a-assembly1.cif.gz_A crystal structure of a hypothetical protein from staphylococcus aureus 0.7509 1 182
5esr-assembly1.cif.gz_A-2 crystal structure of haloalkane dehalogenase (dcca) from caulobacter crescentus 0.7122 89 109
ID Description Score Start End Superfamily
af_P11584_689_771_4.10.1240.30 Few Secondary Structures;Irregular;Hormone receptor fold; 0.8197 90 126 4.10.1240.30
3p8aA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8157 3 129 3.10.180.10
af_O17766_17_393_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7301 84 108 3.40.50.1820
3p8aA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.6699 3 129 3.10.180.10
af_A0A1D6IJX1_114_264_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6688 81 109 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A535W2F3-F1-model_v4 VOC family protein 0.9646 3 189
AF-A0A535PKY2-F1-model_v4 VOC family protein 0.9557 3 189
AF-A0A536NCP5-F1-model_v4 VOC family protein 0.952 2 189
AF-A0A535HPE4-F1-model_v4 VOC family protein 0.9516 2 189
AF-A0A4P6K383-F1-model_v4 VOC family protein 0.9265 3 187

Map