F400349

General Info

Members Datasets Scaffolds Average Seq Length
309 237 281 99

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0003149|Ga0495603_0003149_7293_7634
Length 113
Sequence VVFGGAVVAWVLLVVAGLLEVGWSIGMKYTDGFTRLWPSVFTGFGIVASMVLLSQAAKSLPIGTAYGVWVGIGAAGAAVLGMVVLHEPVTAARIFFVSLLLVAVVGLKATSGH

Samples

Sample ID Description Type Environment
1 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2643221548 Streptomyces sp. Root55 Isolate Unclassified
4 2643221586 Lysobacter sp. Root667 Isolate Unclassified
5 2643221612 Lysobacter sp. Root76 Isolate Unclassified
6 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
7 2643221720 Lysobacter sp. Root916 Isolate Unclassified
8 2643221727 Lysobacter sp. Root96 Isolate Unclassified
9 2643221728 Lysobacter sp. Root983 Isolate Unclassified
10 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
11 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
12 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
13 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
14 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
15 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
16 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
17 2867369537 Streptomyces sp. Z26 Isolate Unclassified
18 2867475112 Streptomyces sp. TM32 Isolate Unclassified
19 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
20 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
21 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
22 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
23 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
24 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
25 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
28 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
150 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
153 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
154 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
155 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
156 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
157 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
158 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
162 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
236 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
237 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.64
Metatranscriptomes 1.29
Isolates 9.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 0.65
Rhizoplane 1.62
Rhizosphere 88.03
Stem 0
Stem Tuber 0
Unclassified 6.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10046287 3300002067 Bacteria 1262
2 JGI25152J39213_1053224 3300002773 Bacteria 520
3 Ga0006562J51391_1012554 3300003578 Bacteria 4490
4 Ga0006562J51391_1012556 3300003578 Bacteria 10910
5 Ga0065704_10461226 3300005289 Archaea 697
6 Ga0065707_10174137 3300005295 Archaea 1450
7 Ga0070676_10187352 3300005328 Bacteria 1349
8 Ga0070676_10491025 3300005328 Bacteria 870
9 Ga0070677_10144705 3300005333 Bacteria 1100
10 Ga0070666_10177984 3300005335 Bacteria 1491
11 Ga0070680_101255083 3300005336 Bacteria 641
12 Ga0070682_101902533 3300005337 Bacteria 521
13 Ga0068868_100059350 3300005338 Bacteria 3026
14 Ga0070660_100118779 3300005339 Bacteria 2108
15 Ga0070689_100131051 3300005340 Bacteria 2011
16 Ga0070689_100253287 3300005340 Bacteria 1453
17 Ga0070661_100729889 3300005344 Bacteria 809
18 Ga0070668_100114853 3300005347 Bacteria 2146
19 Ga0070668_102251028 3300005347 Bacteria 504
20 Ga0070671_100069081 3300005355 Bacteria 2946
21 Ga0070673_100064745 3300005364 Bacteria 2913
22 Ga0070688_101075421 3300005365 Bacteria 642
23 Ga0070688_101412247 3300005365 Bacteria 564
24 Ga0070659_100194322 3300005366 Bacteria 1669
25 Ga0070667_101949637 3300005367 Bacteria 553
26 Ga0070701_11231768 3300005438 Unclassified 532
27 Ga0070700_100020069 3300005441 Bacteria 3866
28 Ga0070700_100288303 3300005441 Bacteria 1193
29 Ga0070663_100016847 3300005455 Bacteria 4755
30 Ga0070678_100191069 3300005456 Bacteria 1683
31 Ga0070662_100515083 3300005457 Bacteria 999
32 Ga0070662_101937506 3300005457 Bacteria 509
33 Ga0070681_10992972 3300005458 Bacteria 759
34 Ga0070685_10552479 3300005466 Bacteria 822
35 Ga0068853_100003225 3300005539 Bacteria 12471
36 Ga0068853_100241740 3300005539 Bacteria 1655
37 Ga0068853_102423279 3300005539 Bacteria 508
38 Ga0070672_100064321 3300005543 Bacteria 2898
39 Ga0070672_101815473 3300005543 Bacteria 548
40 Ga0070693_100771056 3300005547 Bacteria 710
41 Ga0070665_100003308 3300005548 Bacteria 17260
42 Ga0070665_100053376 3300005548 Bacteria 4054
43 Ga0070665_100524813 3300005548 Bacteria 1196
44 Ga0068855_100004282 3300005563 Bacteria 17432
45 Ga0068855_100011630 3300005563 Bacteria 10634
46 Ga0068855_100448158 3300005563 Bacteria 1409
47 Ga0070664_100162140 3300005564 Bacteria 1979
48 Ga0070664_100365338 3300005564 Bacteria 1315
49 Ga0068857_100000255 3300005577 Bacteria 35825
50 Ga0068857_100266581 3300005577 Bacteria 1573
51 Ga0068857_100575309 3300005577 Bacteria 1063
52 Ga0068854_100017689 3300005578 Bacteria 4774
53 Ga0068852_100332171 3300005616 Bacteria 1479
54 Ga0068859_100235376 3300005617 Bacteria 1920
55 Ga0068861_100182282 3300005719 Bacteria 1749
56 Ga0068861_100700815 3300005719 Unclassified 941
57 Ga0068851_10062145 3300005834 Bacteria 1916
58 Ga0068863_100014482 3300005841 Bacteria 7594
59 Ga0068858_100013862 3300005842 Bacteria 7604
60 Ga0068858_100905099 3300005842 Bacteria 863
61 Ga0068860_101199384 3300005843 Bacteria 779
62 Ga0068860_101979718 3300005843 Unclassified 604
63 Ga0068862_101223677 3300005844 Bacteria 750
64 Ga0081455_10212047 3300005937 Bacteria 1442
65 Ga0070712_100487073 3300006175 Bacteria 1032
66 Ga0075428_100338163 3300006844 Bacteria 1617
67 Ga0075431_100031094 3300006847 Bacteria 5498
68 Ga0075431_100243488 3300006847 Bacteria 1829
69 Ga0075433_10059740 3300006852 Bacteria 3336
70 Ga0068865_101050314 3300006881 Unclassified 715
71 Ga0097620_100235374 3300006931 Bacteria 1920
72 Ga0105240_10060335 3300009093 Bacteria 4729
73 Ga0105240_10323370 3300009093 Bacteria 1757
74 Ga0111539_10011442 3300009094 Bacteria 11138
75 Ga0114129_10059079 3300009147 Bacteria 5362
76 Ga0105241_12033751 3300009174 Bacteria 566
77 Ga0105242_13004985 3300009176 Bacteria 522
78 Ga0105248_10003665 3300009177 Bacteria 17036
79 Ga0105237_10000026 3300009545 Bacteria 212619
80 Ga0105249_10385069 3300009553 Bacteria 1429
81 Ga0105249_12674483 3300009553 Bacteria 571
82 Ga0105239_10003689 3300010375 Bacteria 18664
83 Ga0105239_10016630 3300010375 Bacteria 8132
84 Ga0157318_1033991 3300012482 Bacteria 517
85 Ga0157371_10113535 3300013102 Bacteria 1924
86 Ga0157369_10078600 3300013105 Bacteria 3534
87 Ga0157378_10848592 3300013297 Unclassified 942
88 Ga0157378_11602752 3300013297 Bacteria 697
89 Ga0163162_10032937 3300013306 Bacteria 5147
90 Ga0157375_10094167 3300013308 Bacteria 3063
91 Ga0157375_12845401 3300013308 Bacteria 578
92 Ga0157379_10277906 3300014968 Bacteria 1524
93 Ga0157379_10452974 3300014968 Bacteria 1185
94 Ga0163161_10454634 3300017792 Bacteria 1036
95 Ga0197907_10976850 3300020069 Bacteria 543
96 Ga0206355_1182606 3300020076 Bacteria 660
97 Ga0209129_1005472 3300025258 Bacteria 4478
98 Ga0209673_1062430 3300025273 Bacteria 923
99 Ga0209758_1002454 3300025297 Bacteria 18918
100 Ga0209758_1014059 3300025297 Bacteria 4298
101 Ga0207426_1022064 3300025302 Bacteria 2191
102 Ga0207656_10004996 3300025321 Bacteria 4660
103 Ga0207688_10564774 3300025901 Unclassified 716
104 Ga0207680_10062041 3300025903 Bacteria 2282
105 Ga0207647_10016054 3300025904 Bacteria 5118
106 Ga0207645_10230526 3300025907 Bacteria 1222
107 Ga0207695_10002223 3300025913 Bacteria 29150
108 Ga0207671_10000041 3300025914 Bacteria 216095
109 Ga0207693_10382835 3300025915 Bacteria 1100
110 Ga0207649_10666646 3300025920 Bacteria 805
111 Ga0207694_10349321 3300025924 Bacteria 1224
112 Ga0207650_10718595 3300025925 Bacteria 844
113 Ga0207659_11151499 3300025926 Bacteria 667
114 Ga0207644_10007077 3300025931 Bacteria 7312
115 Ga0207706_10129216 3300025933 Bacteria 2222
116 Ga0207706_10635664 3300025933 Bacteria 915
117 Ga0207686_11676269 3300025934 Bacteria 525
118 Ga0207670_10124831 3300025936 Bacteria 1877
119 Ga0207670_10712220 3300025936 Bacteria 832
120 Ga0207691_10180824 3300025940 Bacteria 1843
121 Ga0207691_11172249 3300025940 Bacteria 638
122 Ga0207711_10026472 3300025941 Bacteria 4867
123 Ga0207679_10116683 3300025945 Bacteria 2117
124 Ga0207679_10229356 3300025945 Bacteria 1567
125 Ga0207679_10946183 3300025945 Bacteria 789
126 Ga0207667_10000921 3300025949 Bacteria 37520
127 Ga0207667_10005407 3300025949 Bacteria 15575
128 Ga0207651_10024707 3300025960 Bacteria 3722
129 Ga0207712_10056320 3300025961 Bacteria 2769
130 Ga0207668_10089333 3300025972 Bacteria 2259
131 Ga0207640_10003733 3300025981 Bacteria 8213
132 Ga0207677_10707399 3300026023 Bacteria 894
133 Ga0207703_10060230 3300026035 Bacteria 3104
134 Ga0207639_10000690 3300026041 Bacteria 23246
135 Ga0207639_11543794 3300026041 Bacteria 623
136 Ga0207639_12202640 3300026041 Bacteria 512
137 Ga0207678_10903304 3300026067 Bacteria 781
138 Ga0207708_10036532 3300026075 Bacteria 3741
139 Ga0207708_10660395 3300026075 Bacteria 891
140 Ga0207641_10081055 3300026088 Bacteria 2817
141 Ga0207674_10000106 3300026116 Bacteria 95712
142 Ga0207674_10247526 3300026116 Bacteria 1729
143 Ga0207674_10380330 3300026116 Bacteria 1365
144 Ga0207675_100223254 3300026118 Bacteria 1816
145 Ga0207675_100255174 3300026118 Bacteria 1698
146 Ga0207675_100397675 3300026118 Bacteria 1357
147 Ga0207683_10464549 3300026121 Bacteria 1167
148 Ga0207698_10483958 3300026142 Bacteria 1201
149 Ga0207698_10623220 3300026142 Bacteria 1066
150 Ga0207428_10076220 3300027907 Bacteria 2626
151 Ga0207428_10400459 3300027907 Bacteria 1005
152 Ga0268266_10021077 3300028379 Bacteria 5553
153 Ga0268266_10058815 3300028379 Bacteria 3310
154 Ga0268265_10901420 3300028380 Bacteria 868
155 Ga0307408_100005693 3300031548 Bacteria 8304
156 Ga0307408_100225119 3300031548 Bacteria 1533
157 Ga0307405_10002287 3300031731 Bacteria 8392
158 Ga0307405_10221042 3300031731 Bacteria 1390
159 Ga0307410_10003574 3300031852 Bacteria 7832
160 Ga0307406_10013544 3300031901 Bacteria 4674
161 Ga0307412_10040592 3300031911 Bacteria 3011
162 Ga0307409_100124851 3300031995 Bacteria 2187
163 Ga0307416_100031790 3300032002 Bacteria 3978
164 Ga0307416_101336662 3300032002 Bacteria 822
165 Ga0307416_101595700 3300032002 Bacteria 758
166 Ga0307414_10006548 3300032004 Bacteria 6500
167 Ga0307411_10000595 3300032005 Bacteria 12974
168 Ga0307411_10013792 3300032005 Bacteria 4475
169 Ga0307415_100378915 3300032126 Bacteria 1200
170 Ga0307415_101960078 3300032126 Bacteria 570
171 Ga0373943_0249133 3300035170 Bacteria 997
172 Ga0373925_0280966 3300037068 Bacteria 1341
173 Ga0395905_1458928 3300037471 Bacteria 588
174 Ga0439447_072213 3300041407 Bacteria 801
175 Ga0439461_0081199 3300041410 Bacteria 765
176 Ga0451793_0078918 3300041452 Bacteria 913
177 Ga0451841_0971617 3300041498 Bacteria 700
178 Ga0439431_0014884 3300041997 Bacteria 1807
179 Ga0439457_118841 3300042014 Bacteria 624
180 Ga0450894_001957 3300042131 Bacteria 2841
181 Ga0450898_124062 3300042134 Bacteria 553
182 Ga0450906_003800 3300042145 Bacteria 3212
183 Ga0450908_004699 3300042184 Bacteria 2632
184 Ga0466969_0039084 3300044656 Bacteria 2385
185 Ga0466969_0336544 3300044656 Bacteria 683
186 Ga0466972_0351373 3300044658 Bacteria 689
187 Ga0466977_0232976 3300044666 Bacteria 1149
188 Ga0466982_0000009 3300044672 Bacteria 221166
189 Ga0466965_0337276 3300044683 Bacteria 823
190 Ga0466966_0002007 3300044684 Bacteria 13210
191 Ga0466961_0134526 3300044693 Bacteria 1549
192 Ga0466964_0041063 3300044706 Bacteria 1869
193 Ga0466971_0007980 3300044719 Bacteria 4613
194 Ga0466968_0002780 3300044735 Bacteria 6467
195 Ga0466970_0071623 3300044765 Bacteria 1864
196 Ga0466957_0236068 3300044842 Bacteria 1212
197 Ga0466960_0001857 3300044901 Bacteria 7757
198 Ga0466959_0279071 3300045049 Bacteria 1147
199 Ga0495603_0001003 3300046455 Bacteria 16300
200 Ga0495603_0003149 3300046455 Bacteria 9808
201 Ga0495603_0158068 3300046455 Bacteria 1315
202 Ga0495629_0000765 3300046459 Bacteria 25909
203 Ga0495629_0003305 3300046459 Bacteria 12181
204 Ga0495638_0245248 3300046460 Bacteria 990
205 Ga0495580_0278234 3300046472 Bacteria 1142
206 Ga0495662_0578016 3300046476 Bacteria 550
207 Ga0495664_0582905 3300046477 Bacteria 665
208 Ga0495584_0051603 3300046491 Bacteria 2070
209 Ga0495584_0647392 3300046491 Bacteria 539
210 Ga0495585_0436751 3300046492 Bacteria 627
211 Ga0495594_0003436 3300046499 Bacteria 8176
212 Ga0495594_0037756 3300046499 Bacteria 2636
213 Ga0495620_0135939 3300046515 Bacteria 963
214 Ga0495631_0062323 3300046518 Bacteria 1616
215 Ga0495631_0371946 3300046518 Bacteria 608
216 Ga0495637_0036431 3300046520 Bacteria 2143
217 Ga0495640_0031703 3300046533 Bacteria 3770
218 Ga0495622_0007162 3300046557 Bacteria 5182
219 Ga0495622_0074050 3300046557 Bacteria 1571
220 Ga0495633_0572387 3300046558 Bacteria 508
221 Ga0495656_0078347 3300046615 Bacteria 1485
222 Ga0495588_0007758 3300046674 Bacteria 4903
223 Ga0495588_0031189 3300046674 Bacteria 2682
224 Ga0495613_0005675 3300046689 Bacteria 9348
225 Ga0495613_0443512 3300046689 Bacteria 880
226 Ga0495613_0546641 3300046689 Bacteria 775
227 Ga0495613_0782513 3300046689 Bacteria 624
228 Ga0495624_0776157 3300046690 Bacteria 567
229 Ga0495671_0061218 3300046692 Bacteria 1857
230 Ga0495581_0056220 3300047315 Bacteria 2271
231 Ga0495604_0198580 3300047317 Bacteria 1393
232 Ga0495636_0024050 3300047318 Bacteria 2468
233 Ga0495636_0167168 3300047318 Bacteria 993
234 Ga0495676_0004973 3300047321 Bacteria 12190
235 Ga0495676_0029552 3300047321 Bacteria 4664
236 Ga0495676_0139917 3300047321 Bacteria 1735
237 Ga0495675_0073029 3300047444 Bacteria 2164
238 Ga0495675_0686963 3300047444 Bacteria 574
239 Ga0495685_085415 3300047447 Bacteria 1049
240 Ga0495681_0289253 3300047470 Bacteria 637
241 Ga0495686_0008066 3300047472 Bacteria 7795
242 Ga0495593_0102634 3300047673 Bacteria 1466
243 Ga0495614_0000230 3300048089 Bacteria 21721
244 Ga0496102_1827428 3300048905 Bacteria 525
245 Ga0496104_1312240 3300048907 Bacteria 627
246 Ga0496106_0260004 3300048909 Bacteria 1389
247 Ga0496109_0563886 3300048912 Bacteria 1074
248 Ga0496121_0036234 3300048924 Bacteria 4399
249 Ga0496122_0084648 3300048925 Bacteria 2192
250 Ga0496125_0000867 3300048928 Bacteria 48475
251 Ga0501032_0138386 3300049569 Bacteria 1604
252 Ga0501033_0061334 3300049570 Bacteria 2772
253 Ga0501034_0001040 3300049571 Bacteria 39567
254 Ga0501034_0309658 3300049571 Bacteria 1514
255 Ga0501039_0240895 3300049575 Bacteria 1422
256 Ga0501043_1068398 3300049579 Bacteria 572
257 Ga0501048_1388640 3300049582 Bacteria 505
258 Ga0501069_0008333 3300049585 Bacteria 5443
259 Ga0501069_0263083 3300049585 Bacteria 1007
260 Ga0501070_0004331 3300049586 Bacteria 12201
261 Ga0501070_0156792 3300049586 Bacteria 1877
262 Ga0501074_0003897 3300049590 Bacteria 10633
263 Ga0501227_005551 3300049665 Bacteria 2700
264 Ga0501080_0085418 3300049742 Bacteria 2932
265 Ga0501280_001937 3300049776 Bacteria 3611
266 Ga0501035_0152844 3300049822 Bacteria 2002
267 Ga0501044_0115795 3300049823 Bacteria 2686
268 nmdc:mga00v17_321960_c1 3300050491 Bacteria 1005
269 nmdc:mga00v17_434468_c1 3300050491 Bacteria 853
270 nmdc:mga05p37_47801_c1 3300050507 Bacteria 5261
271 nmdc:mga0qj67_125308_c1 3300050509 Bacteria 2079
272 nmdc:mga06r32_299157_c1 3300050510 Bacteria 1595
273 nmdc:mga06r32_73219_c1 3300050510 Bacteria 3318
274 nmdc:mga08y16_533079_c1 3300050511 Bacteria 1190
275 nmdc:mga08y16_667950_c1 3300050511 Bacteria 1042
276 nmdc:mga0n895_1248_c1 3300050512 Bacteria 18767
277 nmdc:mga0rr50_17473_c1 3300050513 Bacteria 4791
278 nmdc:mga08x19_428818_c1 3300050514 Bacteria 929
279 nmdc:mga0a205_68990_c1 3300050515 Bacteria 3415
280 Ga0500642_0066730 3300053130 Bacteria 1629
281 Ga0466962_0003760 3300061719 Bacteria 7249

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049776 Ga0501280_001937 Ga0501280_001937_2922_3239 75
2 3300009147 Ga0114129_10059079 Ga0114129_100590791 82
3 3300005328 Ga0070676_10491025 Ga0070676_104910251 86
4 3300005335 Ga0070666_10177984 Ga0070666_101779842 86
5 3300005340 Ga0070689_100253287 Ga0070689_1002532872 86
6 3300005355 Ga0070671_100069081 Ga0070671_1000690812 86
7 3300005364 Ga0070673_100064745 Ga0070673_1000647454 86
8 3300005365 Ga0070688_101412247 Ga0070688_1014122472 86
9 3300005456 Ga0070678_100191069 Ga0070678_1001910691 86
10 3300005457 Ga0070662_100515083 Ga0070662_1005150832 86
11 3300005543 Ga0070672_100064321 Ga0070672_1000643213 86
12 3300005616 Ga0068852_100332171 Ga0068852_1003321712 86
13 3300005844 Ga0068862_101223677 Ga0068862_1012236771 86
14 3300009177 Ga0105248_10003665 Ga0105248_100036652 86
15 3300013306 Ga0163162_10032937 Ga0163162_100329372 86
16 3300013308 Ga0157375_10094167 Ga0157375_100941671 86
17 3300014968 Ga0157379_10277906 Ga0157379_102779063 86
18 3300017792 Ga0163161_10454634 Ga0163161_104546342 86
19 3300025901 Ga0207688_10564774 Ga0207688_105647742 86
20 3300025903 Ga0207680_10062041 Ga0207680_100620415 86
21 3300025931 Ga0207644_10007077 Ga0207644_100070776 86
22 3300025933 Ga0207706_10635664 Ga0207706_106356642 86
23 3300025936 Ga0207670_10712220 Ga0207670_107122201 86
24 3300025940 Ga0207691_10180824 Ga0207691_101808241 86
25 3300025941 Ga0207711_10026472 Ga0207711_100264722 86
26 3300025960 Ga0207651_10024707 Ga0207651_100247074 86
27 3300026023 Ga0207677_10707399 Ga0207677_107073991 86
28 3300026067 Ga0207678_10903304 Ga0207678_109033042 86
29 3300026121 Ga0207683_10464549 Ga0207683_104645492 86
30 3300026142 Ga0207698_10483958 Ga0207698_104839581 86
31 3300048912 Ga0496109_0563886 Ga0496109_0563886_633_953 86
32 3300050491 nmdc:mga00v17_434468_c1 nmdc:mga00v17_434468_c1_24_338 86
33 3300009174 Ga0105241_12033751 Ga0105241_120337511 87
34 3300050491 nmdc:mga00v17_321960_c1 nmdc:mga00v17_321960_c1_207_521 88
35 3300005719 Ga0068861_100700815 Ga0068861_1007008152 89
36 3300005843 Ga0068860_101979718 Ga0068860_1019797182 89
37 3300006881 Ga0068865_101050314 Ga0068865_1010503142 89
38 3300013297 Ga0157378_10848592 Ga0157378_108485921 89
39 3300026118 Ga0207675_100397675 Ga0207675_1003976752 89
40 3300028380 Ga0268265_10901420 Ga0268265_109014202 89
41 3300006844 Ga0075428_100338163 Ga0075428_1003381632 90
42 3300009553 Ga0105249_12674483 Ga0105249_126744831 90
43 3300005347 Ga0070668_100114853 Ga0070668_1001148532 91
44 3300005438 Ga0070701_11231768 Ga0070701_112317681 91
45 3300005539 Ga0068853_100003225 Ga0068853_1000032257 91
46 3300005548 Ga0070665_100053376 Ga0070665_1000533762 91
47 3300005563 Ga0068855_100004282 Ga0068855_1000042829 91
48 3300005577 Ga0068857_100575309 Ga0068857_1005753091 91
49 3300005841 Ga0068863_100014482 Ga0068863_1000144824 91
50 3300006847 Ga0075431_100031094 Ga0075431_1000310941 91
51 3300009094 Ga0111539_10011442 Ga0111539_100114423 91
52 3300009553 Ga0105249_10385069 Ga0105249_103850692 91
53 3300010375 Ga0105239_10003689 Ga0105239_1000368920 91
54 3300025273 Ga0209673_1062430 Ga0209673_10624302 91
55 3300025949 Ga0207667_10005407 Ga0207667_1000540712 91
56 3300025961 Ga0207712_10056320 Ga0207712_100563203 91
57 3300025972 Ga0207668_10089333 Ga0207668_100893332 91
58 3300026041 Ga0207639_10000690 Ga0207639_1000069010 91
59 3300026088 Ga0207641_10081055 Ga0207641_100810553 91
60 3300026116 Ga0207674_10380330 Ga0207674_103803301 91
61 3300026118 Ga0207675_100255174 Ga0207675_1002551744 91
62 3300026142 Ga0207698_10623220 Ga0207698_106232201 91
63 3300027907 Ga0207428_10076220 Ga0207428_100762204 91
64 3300028379 Ga0268266_10058815 Ga0268266_100588152 91
65 3300041452 Ga0451793_0078918 Ga0451793_0078918_35_355 91
66 3300050507 nmdc:mga05p37_47801_c1 nmdc:mga05p37_47801_c1_2390_2707 91
67 3300050510 nmdc:mga06r32_73219_c1 nmdc:mga06r32_73219_c1_1243_1560 91
68 3300050511 nmdc:mga08y16_533079_c1 nmdc:mga08y16_533079_c1_776_1093 91
69 3300005367 Ga0070667_101949637 Ga0070667_1019496371 92
70 3300044656 Ga0466969_0039084 Ga0466969_0039084_1110_1433 93
71 3300044656 Ga0466969_0336544 Ga0466969_0336544_122_445 93
72 3300044658 Ga0466972_0351373 Ga0466972_0351373_183_506 93
73 3300044666 Ga0466977_0232976 Ga0466977_0232976_370_693 93
74 3300044672 Ga0466982_0000009 Ga0466982_0000009_174010_174333 93
75 3300044683 Ga0466965_0337276 Ga0466965_0337276_460_783 93
76 3300044684 Ga0466966_0002007 Ga0466966_0002007_10713_11036 93
77 3300044693 Ga0466961_0134526 Ga0466961_0134526_966_1289 93
78 3300044706 Ga0466964_0041063 Ga0466964_0041063_1384_1707 93
79 3300044719 Ga0466971_0007980 Ga0466971_0007980_4040_4363 93
80 3300044735 Ga0466968_0002780 Ga0466968_0002780_6051_6374 93
81 3300044765 Ga0466970_0071623 Ga0466970_0071623_1439_1762 93
82 3300044842 Ga0466957_0236068 Ga0466957_0236068_822_1145 93
83 3300044901 Ga0466960_0001857 Ga0466960_0001857_5836_6159 93
84 3300045049 Ga0466959_0279071 Ga0466959_0279071_608_931 93
85 3300061719 Ga0466962_0003760 Ga0466962_0003760_1280_1603 93
86 3300005366 Ga0070659_100194322 Ga0070659_1001943222 94
87 3300005563 Ga0068855_100448158 Ga0068855_1004481582 94
88 3300005564 Ga0070664_100162140 Ga0070664_1001621402 94
89 3300005577 Ga0068857_100266581 Ga0068857_1002665812 94
90 3300006175 Ga0070712_100487073 Ga0070712_1004870731 94
91 3300013105 Ga0157369_10078600 Ga0157369_100786001 94
92 3300025915 Ga0207693_10382835 Ga0207693_103828352 94
93 3300025924 Ga0207694_10349321 Ga0207694_103493212 94
94 3300025945 Ga0207679_10116683 Ga0207679_101166832 94
95 3300026041 Ga0207639_11543794 Ga0207639_115437941 94
96 3300026116 Ga0207674_10247526 Ga0207674_102475262 94
97 3300035170 Ga0373943_0249133 Ga0373943_0249133_399_719 94
98 3300037068 Ga0373925_0280966 Ga0373925_0280966_40_360 94
99 3300046472 Ga0495580_0278234 Ga0495580_0278234_599_919 94
100 3300006852 Ga0075433_10059740 Ga0075433_100597402 95
101 3300027907 Ga0207428_10400459 Ga0207428_104004592 95
102 3300046455 Ga0495603_0158068 Ga0495603_0158068_584_898 95
103 3300046520 Ga0495637_0036431 Ga0495637_0036431_1129_1443 95
104 3300046692 Ga0495671_0061218 Ga0495671_0061218_201_515 95
105 3300047321 Ga0495676_0139917 Ga0495676_0139917_407_721 95
106 3300050511 nmdc:mga08y16_667950_c1 nmdc:mga08y16_667950_c1_612_932 95
107 3300050512 nmdc:mga0n895_1248_c1 nmdc:mga0n895_1248_c1_3177_3497 95
108 3300050513 nmdc:mga0rr50_17473_c1 nmdc:mga0rr50_17473_c1_1490_1810 95
109 3300050514 nmdc:mga08x19_428818_c1 nmdc:mga08x19_428818_c1_525_845 95
110 3300050515 nmdc:mga0a205_68990_c1 nmdc:mga0a205_68990_c1_973_1293 95
111 3300032004 Ga0307414_10006548 Ga0307414_100065483 96
112 3300032005 Ga0307411_10000595 Ga0307411_100005953 96
113 3300042131 Ga0450894_001957 Ga0450894_001957_2389_2709 96
114 3300042145 Ga0450906_003800 Ga0450906_003800_131_451 96
115 3300042184 Ga0450908_004699 Ga0450908_004699_135_455 96
116 3300047444 Ga0495675_0686963 Ga0495675_0686963_225_545 96
117 3300049665 Ga0501227_005551 Ga0501227_005551_819_1133 96
118 3300005289 Ga0065704_10461226 Ga0065704_104612261 97
119 3300005295 Ga0065707_10174137 Ga0065707_101741371 97
120 3300031548 Ga0307408_100005693 Ga0307408_1000056939 97
121 3300031731 Ga0307405_10002287 Ga0307405_1000228710 97
122 3300031852 Ga0307410_10003574 Ga0307410_100035742 97
123 3300031901 Ga0307406_10013544 Ga0307406_100135442 97
124 3300031911 Ga0307412_10040592 Ga0307412_100405924 97
125 3300031995 Ga0307409_100124851 Ga0307409_1001248512 97
126 3300032002 Ga0307416_100031790 Ga0307416_1000317904 97
127 3300032005 Ga0307411_10013792 Ga0307411_100137924 97
128 3300032126 Ga0307415_100378915 Ga0307415_1003789152 97
129 3300048925 Ga0496122_0084648 Ga0496122_0084648_1044_1361 98
130 3300005539 Ga0068853_102423279 Ga0068853_1024232791 99
131 3300012482 Ga0157318_1033991 Ga0157318_10339911 99
132 3300026041 Ga0207639_12202640 Ga0207639_122026401 99
133 3300046492 Ga0495585_0436751 Ga0495585_0436751_143_442 99
134 3300046515 Ga0495620_0135939 Ga0495620_0135939_547_846 99
135 3300046518 Ga0495631_0371946 Ga0495631_0371946_169_468 99
136 3300047318 Ga0495636_0167168 Ga0495636_0167168_152_451 99
137 3300047447 Ga0495685_085415 Ga0495685_085415_646_945 99
138 3300049569 Ga0501032_0138386 Ga0501032_0138386_370_669 99
139 3300049570 Ga0501033_0061334 Ga0501033_0061334_2423_2722 99
140 3300049571 Ga0501034_0309658 Ga0501034_0309658_28_327 99
141 3300049822 Ga0501035_0152844 Ga0501035_0152844_1623_1922 99
142 iso_pu_bacteria 2510065059 2510314937 100
143 iso_pu_bacteria 2874123672 2874128403 100
144 iso_pu_bacteria 2941499720 2941506006 100
145 3300005338 Ga0068868_100059350 Ga0068868_1000593502 101
146 3300005441 Ga0070700_100288303 Ga0070700_1002883032 101
147 3300026075 Ga0207708_10660395 Ga0207708_106603951 101
148 3300041498 Ga0451841_0971617 Ga0451841_0971617_69_389 101
149 3300047472 Ga0495686_0008066 Ga0495686_0008066_3613_3933 101
150 3300049579 Ga0501043_1068398 Ga0501043_1068398_28_333 101
151 iso_pu_bacteria 2643221586 2643941332 101
152 iso_pu_bacteria 2643221612 2644080423 101
153 iso_pu_bacteria 2643221720 2644662872 101
154 iso_pu_bacteria 2643221727 2644697036 101
155 iso_pu_bacteria 2643221728 2644698173 101
156 iso_pu_bacteria 2582581312 2585299070 102
157 iso_pu_bacteria 2643221548 2643765395 102
158 iso_pu_bacteria 2643221682 2644462534 102
159 iso_pu_bacteria 2739367875 2740063667 102
160 iso_pu_bacteria 2802429296 2804847569 102
161 iso_pu_bacteria 2808606982 2811848535 102
162 iso_pu_bacteria 2811994879 2812358663 102
163 iso_pu_bacteria 2818991463 2819693392 102
164 iso_pu_bacteria 2852635781 2852642389 102
165 iso_pu_bacteria 2862178590 2862184642 102
166 iso_pu_bacteria 2867369537 2867371465 102
167 iso_pu_bacteria 2867475112 2867477257 102
168 iso_pu_bacteria 2875391855 2875394082 102
169 iso_pu_bacteria 2912757875 2912760182 102
170 iso_pu_bacteria 2946045630 2946050532 102
171 iso_pu_bacteria 2946064051 2946067210 102
172 iso_pu_bacteria 2966598605 2966603000 102
173 iso_pu_bacteria 8025413630 8025417373 102
174 iso_pu_bacteria 8025478263 8025485035 102
175 iso_pu_bacteria 8033684223 8033684714 102
176 3300005336 Ga0070680_101255083 Ga0070680_1012550832 103
177 3300005339 Ga0070660_100118779 Ga0070660_1001187793 104
178 3300005548 Ga0070665_100524813 Ga0070665_1005248132 104
179 3300009093 Ga0105240_10323370 Ga0105240_103233703 104
180 3300009176 Ga0105242_13004985 Ga0105242_130049851 104
181 3300013297 Ga0157378_11602752 Ga0157378_116027522 104
182 3300025925 Ga0207650_10718595 Ga0207650_107185952 104
183 3300032126 Ga0307415_101960078 Ga0307415_1019600781 104
184 3300005328 Ga0070676_10187352 Ga0070676_101873522 105
185 3300005333 Ga0070677_10144705 Ga0070677_101447052 105
186 3300005337 Ga0070682_101902533 Ga0070682_1019025331 105
187 3300005340 Ga0070689_100131051 Ga0070689_1001310513 105
188 3300005365 Ga0070688_101075421 Ga0070688_1010754212 105
189 3300005441 Ga0070700_100020069 Ga0070700_1000200694 105
190 3300005457 Ga0070662_101937506 Ga0070662_1019375061 105
191 3300005466 Ga0070685_10552479 Ga0070685_105524792 105
192 3300005543 Ga0070672_101815473 Ga0070672_1018154731 105
193 3300005548 Ga0070665_100003308 Ga0070665_1000033082 105
194 3300005617 Ga0068859_100235376 Ga0068859_1002353762 105
195 3300005719 Ga0068861_100182282 Ga0068861_1001822822 105
196 3300005842 Ga0068858_100905099 Ga0068858_1009050992 105
197 3300005843 Ga0068860_101199384 Ga0068860_1011993842 105
198 3300006931 Ga0097620_100235374 Ga0097620_1002353742 105
199 3300025907 Ga0207645_10230526 Ga0207645_102305263 105
200 3300025926 Ga0207659_11151499 Ga0207659_111514991 105
201 3300025936 Ga0207670_10124831 Ga0207670_101248312 105
202 3300025940 Ga0207691_11172249 Ga0207691_111722492 105
203 3300025945 Ga0207679_10946183 Ga0207679_109461832 105
204 3300026075 Ga0207708_10036532 Ga0207708_100365323 105
205 3300026118 Ga0207675_100223254 Ga0207675_1002232542 105
206 3300028379 Ga0268266_10021077 Ga0268266_100210773 105
207 3300037471 Ga0395905_1458928 Ga0395905_1458928_23_340 105
208 3300046477 Ga0495664_0582905 Ga0495664_0582905_239_556 105
209 3300049575 Ga0501039_0240895 Ga0501039_0240895_1025_1342 105
210 3300049585 Ga0501069_0008333 Ga0501069_0008333_352_669 105
211 3300049585 Ga0501069_0263083 Ga0501069_0263083_38_355 105
212 3300049586 Ga0501070_0004331 Ga0501070_0004331_5265_5582 105
213 3300049586 Ga0501070_0156792 Ga0501070_0156792_267_584 105
214 3300049590 Ga0501074_0003897 Ga0501074_0003897_5117_5434 105
215 3300049742 Ga0501080_0085418 Ga0501080_0085418_1875_2192 105
216 3300005347 Ga0070668_102251028 Ga0070668_1022510282 106
217 3300005455 Ga0070663_100016847 Ga0070663_1000168473 106
218 3300005458 Ga0070681_10992972 Ga0070681_109929722 106
219 3300005547 Ga0070693_100771056 Ga0070693_1007710561 106
220 3300005937 Ga0081455_10212047 Ga0081455_102120472 106
221 3300006847 Ga0075431_100243488 Ga0075431_1002434882 106
222 3300013308 Ga0157375_12845401 Ga0157375_128454012 106
223 3300020069 Ga0197907_10976850 Ga0197907_109768502 106
224 3300025297 Ga0209758_1014059 Ga0209758_10140595 106
225 3300025302 Ga0207426_1022064 Ga0207426_10220644 106
226 3300025934 Ga0207686_11676269 Ga0207686_116762691 106
227 3300031548 Ga0307408_100225119 Ga0307408_1002251192 106
228 3300031731 Ga0307405_10221042 Ga0307405_102210422 106
229 3300032002 Ga0307416_101336662 Ga0307416_1013366622 106
230 3300032002 Ga0307416_101595700 Ga0307416_1015957001 106
231 3300041407 Ga0439447_072213 Ga0439447_072213_30_350 106
232 3300041410 Ga0439461_0081199 Ga0439461_0081199_154_474 106
233 3300041997 Ga0439431_0014884 Ga0439431_0014884_230_550 106
234 3300042014 Ga0439457_118841 Ga0439457_118841_79_399 106
235 3300042134 Ga0450898_124062 Ga0450898_124062_146_466 106
236 3300046455 Ga0495603_0001003 Ga0495603_0001003_14820_15140 106
237 3300046455 Ga0495603_0003149 Ga0495603_0003149_7293_7634 106
238 3300046459 Ga0495629_0000765 Ga0495629_0000765_5594_5914 106
239 3300046459 Ga0495629_0003305 Ga0495629_0003305_2836_3177 106
240 3300046460 Ga0495638_0245248 Ga0495638_0245248_561_881 106
241 3300046476 Ga0495662_0578016 Ga0495662_0578016_107_427 106
242 3300046491 Ga0495584_0051603 Ga0495584_0051603_1684_2004 106
243 3300046491 Ga0495584_0647392 Ga0495584_0647392_149_469 106
244 3300046499 Ga0495594_0003436 Ga0495594_0003436_2540_2860 106
245 3300046499 Ga0495594_0037756 Ga0495594_0037756_1836_2156 106
246 3300046518 Ga0495631_0062323 Ga0495631_0062323_1197_1517 106
247 3300046533 Ga0495640_0031703 Ga0495640_0031703_779_1099 106
248 3300046557 Ga0495622_0007162 Ga0495622_0007162_1061_1381 106
249 3300046557 Ga0495622_0074050 Ga0495622_0074050_642_962 106
250 3300046558 Ga0495633_0572387 Ga0495633_0572387_51_371 106
251 3300046615 Ga0495656_0078347 Ga0495656_0078347_532_852 106
252 3300046674 Ga0495588_0007758 Ga0495588_0007758_19_339 106
253 3300046674 Ga0495588_0031189 Ga0495588_0031189_1244_1564 106
254 3300046689 Ga0495613_0005675 Ga0495613_0005675_8946_9287 106
255 3300046689 Ga0495613_0443512 Ga0495613_0443512_14_334 106
256 3300046689 Ga0495613_0546641 Ga0495613_0546641_296_616 106
257 3300046689 Ga0495613_0782513 Ga0495613_0782513_181_501 106
258 3300046690 Ga0495624_0776157 Ga0495624_0776157_37_357 106
259 3300047315 Ga0495581_0056220 Ga0495581_0056220_264_584 106
260 3300047317 Ga0495604_0198580 Ga0495604_0198580_439_759 106
261 3300047318 Ga0495636_0024050 Ga0495636_0024050_1127_1447 106
262 3300047321 Ga0495676_0004973 Ga0495676_0004973_5395_5715 106
263 3300047321 Ga0495676_0029552 Ga0495676_0029552_2287_2628 106
264 3300047444 Ga0495675_0073029 Ga0495675_0073029_156_476 106
265 3300047470 Ga0495681_0289253 Ga0495681_0289253_177_497 106
266 3300047673 Ga0495593_0102634 Ga0495593_0102634_971_1312 106
267 3300048089 Ga0495614_0000230 Ga0495614_0000230_16035_16376 106
268 3300048905 Ga0496102_1827428 Ga0496102_1827428_167_487 106
269 3300048907 Ga0496104_1312240 Ga0496104_1312240_290_610 106
270 3300048909 Ga0496106_0260004 Ga0496106_0260004_426_767 106
271 3300049571 Ga0501034_0001040 Ga0501034_0001040_13389_13709 106
272 3300049582 Ga0501048_1388640 Ga0501048_1388640_132_452 106
273 3300049823 Ga0501044_0115795 Ga0501044_0115795_2265_2585 106
274 3300050509 nmdc:mga0qj67_125308_c1 nmdc:mga0qj67_125308_c1_1268_1588 106
275 3300050510 nmdc:mga06r32_299157_c1 nmdc:mga06r32_299157_c1_263_583 106
276 3300053130 Ga0500642_0066730 Ga0500642_0066730_568_888 106
277 3300002067 JGI24735J21928_10046287 JGI24735J21928_100462871 107
278 3300002773 JGI25152J39213_1053224 JGI25152J39213_10532241 107
279 3300003578 Ga0006562J51391_1012554 Ga0006562J51391_10125544 107
280 3300003578 Ga0006562J51391_1012556 Ga0006562J51391_10125568 107
281 3300005344 Ga0070661_100729889 Ga0070661_1007298892 107
282 3300005539 Ga0068853_100241740 Ga0068853_1002417403 107
283 3300005563 Ga0068855_100011630 Ga0068855_1000116302 107
284 3300005564 Ga0070664_100365338 Ga0070664_1003653382 107
285 3300005577 Ga0068857_100000255 Ga0068857_10000025533 107
286 3300005578 Ga0068854_100017689 Ga0068854_1000176892 107
287 3300005834 Ga0068851_10062145 Ga0068851_100621452 107
288 3300005842 Ga0068858_100013862 Ga0068858_1000138628 107
289 3300009093 Ga0105240_10060335 Ga0105240_100603353 107
290 3300009545 Ga0105237_10000026 Ga0105237_1000002669 107
291 3300010375 Ga0105239_10016630 Ga0105239_100166304 107
292 3300013102 Ga0157371_10113535 Ga0157371_101135353 107
293 3300014968 Ga0157379_10452974 Ga0157379_104529741 107
294 3300020076 Ga0206355_1182606 Ga0206355_11826061 107
295 3300025258 Ga0209129_1005472 Ga0209129_10054724 107
296 3300025297 Ga0209758_1002454 Ga0209758_100245416 107
297 3300025321 Ga0207656_10004996 Ga0207656_100049963 107
298 3300025904 Ga0207647_10016054 Ga0207647_100160545 107
299 3300025913 Ga0207695_10002223 Ga0207695_100022238 107
300 3300025914 Ga0207671_10000041 Ga0207671_10000041119 107
301 3300025920 Ga0207649_10666646 Ga0207649_106666461 107
302 3300025933 Ga0207706_10129216 Ga0207706_101292162 107
303 3300025945 Ga0207679_10229356 Ga0207679_102293563 107
304 3300025949 Ga0207667_10000921 Ga0207667_1000092113 107
305 3300025981 Ga0207640_10003733 Ga0207640_100037338 107
306 3300026035 Ga0207703_10060230 Ga0207703_100602304 107
307 3300026116 Ga0207674_10000106 Ga0207674_100001065 107
308 3300048924 Ga0496121_0036234 Ga0496121_0036234_3991_4314 107
309 3300048928 Ga0496125_0000867 Ga0496125_0000867_955_1278 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

8

100

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.8828 1 99
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.844 1 101
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.8355 1 99
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8341 1 96
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8164 1 98
ID Description Score Start End Superfamily
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9372 4 100 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9342 3 103 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9103 2 105 1.10.3730.20
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9065 1 101 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8971 1 105 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A7V9H445-F1-model_v4 Multidrug efflux SMR transporter 1.001 1 67 GO:0005886
GO:0022857
AF-A0A258SQT2-F1-model_v4 Guanidinium exporter 0.9836 1 81 GO:0005886
GO:0022857
AF-Q89MZ8-F1-model_v4 Guanidinium exporter 0.9823 1 101 GO:0005886
GO:0022857
GO:0055085
AF-A0A0B6X717-F1-model_v4 Guanidinium exporter 0.9789 1 101 GO:0005886
GO:0022857
AF-A0A3D6BKV2-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9778 1 100 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
84.12 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map