F400349
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 309 | 237 | 281 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300046455|Ga0495603_0003149|Ga0495603_0003149_7293_7634 |
| Length | 113 |
| Sequence | VVFGGAVVAWVLLVVAGLLEVGWSIGMKYTDGFTRLWPSVFTGFGIVASMVLLSQAAKSLPIGTAYGVWVGIGAAGAAVLGMVVLHEPVTAARIFFVSLLLVAVVGLKATSGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 2 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 3 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 4 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 5 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 6 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 7 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 8 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 9 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 10 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
| 11 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 12 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 13 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 14 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 15 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 16 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 17 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 18 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 19 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 20 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 21 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 22 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 23 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 24 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 25 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 26 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 27 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 28 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 95 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 137 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 139 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 140 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 142 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 143 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 144 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 145 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 146 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 147 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 149 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 150 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 151 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 153 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 154 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 155 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 156 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 157 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 158 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 159 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 160 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 161 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 162 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 163 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 164 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 165 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 166 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 167 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 168 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 169 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 170 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 171 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 172 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 173 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 208 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 209 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 210 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 222 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 225 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 234 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 235 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 236 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 237 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.64 |
| Metatranscriptomes | 1.29 |
| Isolates | 9.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.91 |
| Nodule | 0.65 |
| Rhizoplane | 1.62 |
| Rhizosphere | 88.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10046287 | 3300002067 | Bacteria | 1262 |
| 2 | JGI25152J39213_1053224 | 3300002773 | Bacteria | 520 |
| 3 | Ga0006562J51391_1012554 | 3300003578 | Bacteria | 4490 |
| 4 | Ga0006562J51391_1012556 | 3300003578 | Bacteria | 10910 |
| 5 | Ga0065704_10461226 | 3300005289 | Archaea | 697 |
| 6 | Ga0065707_10174137 | 3300005295 | Archaea | 1450 |
| 7 | Ga0070676_10187352 | 3300005328 | Bacteria | 1349 |
| 8 | Ga0070676_10491025 | 3300005328 | Bacteria | 870 |
| 9 | Ga0070677_10144705 | 3300005333 | Bacteria | 1100 |
| 10 | Ga0070666_10177984 | 3300005335 | Bacteria | 1491 |
| 11 | Ga0070680_101255083 | 3300005336 | Bacteria | 641 |
| 12 | Ga0070682_101902533 | 3300005337 | Bacteria | 521 |
| 13 | Ga0068868_100059350 | 3300005338 | Bacteria | 3026 |
| 14 | Ga0070660_100118779 | 3300005339 | Bacteria | 2108 |
| 15 | Ga0070689_100131051 | 3300005340 | Bacteria | 2011 |
| 16 | Ga0070689_100253287 | 3300005340 | Bacteria | 1453 |
| 17 | Ga0070661_100729889 | 3300005344 | Bacteria | 809 |
| 18 | Ga0070668_100114853 | 3300005347 | Bacteria | 2146 |
| 19 | Ga0070668_102251028 | 3300005347 | Bacteria | 504 |
| 20 | Ga0070671_100069081 | 3300005355 | Bacteria | 2946 |
| 21 | Ga0070673_100064745 | 3300005364 | Bacteria | 2913 |
| 22 | Ga0070688_101075421 | 3300005365 | Bacteria | 642 |
| 23 | Ga0070688_101412247 | 3300005365 | Bacteria | 564 |
| 24 | Ga0070659_100194322 | 3300005366 | Bacteria | 1669 |
| 25 | Ga0070667_101949637 | 3300005367 | Bacteria | 553 |
| 26 | Ga0070701_11231768 | 3300005438 | Unclassified | 532 |
| 27 | Ga0070700_100020069 | 3300005441 | Bacteria | 3866 |
| 28 | Ga0070700_100288303 | 3300005441 | Bacteria | 1193 |
| 29 | Ga0070663_100016847 | 3300005455 | Bacteria | 4755 |
| 30 | Ga0070678_100191069 | 3300005456 | Bacteria | 1683 |
| 31 | Ga0070662_100515083 | 3300005457 | Bacteria | 999 |
| 32 | Ga0070662_101937506 | 3300005457 | Bacteria | 509 |
| 33 | Ga0070681_10992972 | 3300005458 | Bacteria | 759 |
| 34 | Ga0070685_10552479 | 3300005466 | Bacteria | 822 |
| 35 | Ga0068853_100003225 | 3300005539 | Bacteria | 12471 |
| 36 | Ga0068853_100241740 | 3300005539 | Bacteria | 1655 |
| 37 | Ga0068853_102423279 | 3300005539 | Bacteria | 508 |
| 38 | Ga0070672_100064321 | 3300005543 | Bacteria | 2898 |
| 39 | Ga0070672_101815473 | 3300005543 | Bacteria | 548 |
| 40 | Ga0070693_100771056 | 3300005547 | Bacteria | 710 |
| 41 | Ga0070665_100003308 | 3300005548 | Bacteria | 17260 |
| 42 | Ga0070665_100053376 | 3300005548 | Bacteria | 4054 |
| 43 | Ga0070665_100524813 | 3300005548 | Bacteria | 1196 |
| 44 | Ga0068855_100004282 | 3300005563 | Bacteria | 17432 |
| 45 | Ga0068855_100011630 | 3300005563 | Bacteria | 10634 |
| 46 | Ga0068855_100448158 | 3300005563 | Bacteria | 1409 |
| 47 | Ga0070664_100162140 | 3300005564 | Bacteria | 1979 |
| 48 | Ga0070664_100365338 | 3300005564 | Bacteria | 1315 |
| 49 | Ga0068857_100000255 | 3300005577 | Bacteria | 35825 |
| 50 | Ga0068857_100266581 | 3300005577 | Bacteria | 1573 |
| 51 | Ga0068857_100575309 | 3300005577 | Bacteria | 1063 |
| 52 | Ga0068854_100017689 | 3300005578 | Bacteria | 4774 |
| 53 | Ga0068852_100332171 | 3300005616 | Bacteria | 1479 |
| 54 | Ga0068859_100235376 | 3300005617 | Bacteria | 1920 |
| 55 | Ga0068861_100182282 | 3300005719 | Bacteria | 1749 |
| 56 | Ga0068861_100700815 | 3300005719 | Unclassified | 941 |
| 57 | Ga0068851_10062145 | 3300005834 | Bacteria | 1916 |
| 58 | Ga0068863_100014482 | 3300005841 | Bacteria | 7594 |
| 59 | Ga0068858_100013862 | 3300005842 | Bacteria | 7604 |
| 60 | Ga0068858_100905099 | 3300005842 | Bacteria | 863 |
| 61 | Ga0068860_101199384 | 3300005843 | Bacteria | 779 |
| 62 | Ga0068860_101979718 | 3300005843 | Unclassified | 604 |
| 63 | Ga0068862_101223677 | 3300005844 | Bacteria | 750 |
| 64 | Ga0081455_10212047 | 3300005937 | Bacteria | 1442 |
| 65 | Ga0070712_100487073 | 3300006175 | Bacteria | 1032 |
| 66 | Ga0075428_100338163 | 3300006844 | Bacteria | 1617 |
| 67 | Ga0075431_100031094 | 3300006847 | Bacteria | 5498 |
| 68 | Ga0075431_100243488 | 3300006847 | Bacteria | 1829 |
| 69 | Ga0075433_10059740 | 3300006852 | Bacteria | 3336 |
| 70 | Ga0068865_101050314 | 3300006881 | Unclassified | 715 |
| 71 | Ga0097620_100235374 | 3300006931 | Bacteria | 1920 |
| 72 | Ga0105240_10060335 | 3300009093 | Bacteria | 4729 |
| 73 | Ga0105240_10323370 | 3300009093 | Bacteria | 1757 |
| 74 | Ga0111539_10011442 | 3300009094 | Bacteria | 11138 |
| 75 | Ga0114129_10059079 | 3300009147 | Bacteria | 5362 |
| 76 | Ga0105241_12033751 | 3300009174 | Bacteria | 566 |
| 77 | Ga0105242_13004985 | 3300009176 | Bacteria | 522 |
| 78 | Ga0105248_10003665 | 3300009177 | Bacteria | 17036 |
| 79 | Ga0105237_10000026 | 3300009545 | Bacteria | 212619 |
| 80 | Ga0105249_10385069 | 3300009553 | Bacteria | 1429 |
| 81 | Ga0105249_12674483 | 3300009553 | Bacteria | 571 |
| 82 | Ga0105239_10003689 | 3300010375 | Bacteria | 18664 |
| 83 | Ga0105239_10016630 | 3300010375 | Bacteria | 8132 |
| 84 | Ga0157318_1033991 | 3300012482 | Bacteria | 517 |
| 85 | Ga0157371_10113535 | 3300013102 | Bacteria | 1924 |
| 86 | Ga0157369_10078600 | 3300013105 | Bacteria | 3534 |
| 87 | Ga0157378_10848592 | 3300013297 | Unclassified | 942 |
| 88 | Ga0157378_11602752 | 3300013297 | Bacteria | 697 |
| 89 | Ga0163162_10032937 | 3300013306 | Bacteria | 5147 |
| 90 | Ga0157375_10094167 | 3300013308 | Bacteria | 3063 |
| 91 | Ga0157375_12845401 | 3300013308 | Bacteria | 578 |
| 92 | Ga0157379_10277906 | 3300014968 | Bacteria | 1524 |
| 93 | Ga0157379_10452974 | 3300014968 | Bacteria | 1185 |
| 94 | Ga0163161_10454634 | 3300017792 | Bacteria | 1036 |
| 95 | Ga0197907_10976850 | 3300020069 | Bacteria | 543 |
| 96 | Ga0206355_1182606 | 3300020076 | Bacteria | 660 |
| 97 | Ga0209129_1005472 | 3300025258 | Bacteria | 4478 |
| 98 | Ga0209673_1062430 | 3300025273 | Bacteria | 923 |
| 99 | Ga0209758_1002454 | 3300025297 | Bacteria | 18918 |
| 100 | Ga0209758_1014059 | 3300025297 | Bacteria | 4298 |
| 101 | Ga0207426_1022064 | 3300025302 | Bacteria | 2191 |
| 102 | Ga0207656_10004996 | 3300025321 | Bacteria | 4660 |
| 103 | Ga0207688_10564774 | 3300025901 | Unclassified | 716 |
| 104 | Ga0207680_10062041 | 3300025903 | Bacteria | 2282 |
| 105 | Ga0207647_10016054 | 3300025904 | Bacteria | 5118 |
| 106 | Ga0207645_10230526 | 3300025907 | Bacteria | 1222 |
| 107 | Ga0207695_10002223 | 3300025913 | Bacteria | 29150 |
| 108 | Ga0207671_10000041 | 3300025914 | Bacteria | 216095 |
| 109 | Ga0207693_10382835 | 3300025915 | Bacteria | 1100 |
| 110 | Ga0207649_10666646 | 3300025920 | Bacteria | 805 |
| 111 | Ga0207694_10349321 | 3300025924 | Bacteria | 1224 |
| 112 | Ga0207650_10718595 | 3300025925 | Bacteria | 844 |
| 113 | Ga0207659_11151499 | 3300025926 | Bacteria | 667 |
| 114 | Ga0207644_10007077 | 3300025931 | Bacteria | 7312 |
| 115 | Ga0207706_10129216 | 3300025933 | Bacteria | 2222 |
| 116 | Ga0207706_10635664 | 3300025933 | Bacteria | 915 |
| 117 | Ga0207686_11676269 | 3300025934 | Bacteria | 525 |
| 118 | Ga0207670_10124831 | 3300025936 | Bacteria | 1877 |
| 119 | Ga0207670_10712220 | 3300025936 | Bacteria | 832 |
| 120 | Ga0207691_10180824 | 3300025940 | Bacteria | 1843 |
| 121 | Ga0207691_11172249 | 3300025940 | Bacteria | 638 |
| 122 | Ga0207711_10026472 | 3300025941 | Bacteria | 4867 |
| 123 | Ga0207679_10116683 | 3300025945 | Bacteria | 2117 |
| 124 | Ga0207679_10229356 | 3300025945 | Bacteria | 1567 |
| 125 | Ga0207679_10946183 | 3300025945 | Bacteria | 789 |
| 126 | Ga0207667_10000921 | 3300025949 | Bacteria | 37520 |
| 127 | Ga0207667_10005407 | 3300025949 | Bacteria | 15575 |
| 128 | Ga0207651_10024707 | 3300025960 | Bacteria | 3722 |
| 129 | Ga0207712_10056320 | 3300025961 | Bacteria | 2769 |
| 130 | Ga0207668_10089333 | 3300025972 | Bacteria | 2259 |
| 131 | Ga0207640_10003733 | 3300025981 | Bacteria | 8213 |
| 132 | Ga0207677_10707399 | 3300026023 | Bacteria | 894 |
| 133 | Ga0207703_10060230 | 3300026035 | Bacteria | 3104 |
| 134 | Ga0207639_10000690 | 3300026041 | Bacteria | 23246 |
| 135 | Ga0207639_11543794 | 3300026041 | Bacteria | 623 |
| 136 | Ga0207639_12202640 | 3300026041 | Bacteria | 512 |
| 137 | Ga0207678_10903304 | 3300026067 | Bacteria | 781 |
| 138 | Ga0207708_10036532 | 3300026075 | Bacteria | 3741 |
| 139 | Ga0207708_10660395 | 3300026075 | Bacteria | 891 |
| 140 | Ga0207641_10081055 | 3300026088 | Bacteria | 2817 |
| 141 | Ga0207674_10000106 | 3300026116 | Bacteria | 95712 |
| 142 | Ga0207674_10247526 | 3300026116 | Bacteria | 1729 |
| 143 | Ga0207674_10380330 | 3300026116 | Bacteria | 1365 |
| 144 | Ga0207675_100223254 | 3300026118 | Bacteria | 1816 |
| 145 | Ga0207675_100255174 | 3300026118 | Bacteria | 1698 |
| 146 | Ga0207675_100397675 | 3300026118 | Bacteria | 1357 |
| 147 | Ga0207683_10464549 | 3300026121 | Bacteria | 1167 |
| 148 | Ga0207698_10483958 | 3300026142 | Bacteria | 1201 |
| 149 | Ga0207698_10623220 | 3300026142 | Bacteria | 1066 |
| 150 | Ga0207428_10076220 | 3300027907 | Bacteria | 2626 |
| 151 | Ga0207428_10400459 | 3300027907 | Bacteria | 1005 |
| 152 | Ga0268266_10021077 | 3300028379 | Bacteria | 5553 |
| 153 | Ga0268266_10058815 | 3300028379 | Bacteria | 3310 |
| 154 | Ga0268265_10901420 | 3300028380 | Bacteria | 868 |
| 155 | Ga0307408_100005693 | 3300031548 | Bacteria | 8304 |
| 156 | Ga0307408_100225119 | 3300031548 | Bacteria | 1533 |
| 157 | Ga0307405_10002287 | 3300031731 | Bacteria | 8392 |
| 158 | Ga0307405_10221042 | 3300031731 | Bacteria | 1390 |
| 159 | Ga0307410_10003574 | 3300031852 | Bacteria | 7832 |
| 160 | Ga0307406_10013544 | 3300031901 | Bacteria | 4674 |
| 161 | Ga0307412_10040592 | 3300031911 | Bacteria | 3011 |
| 162 | Ga0307409_100124851 | 3300031995 | Bacteria | 2187 |
| 163 | Ga0307416_100031790 | 3300032002 | Bacteria | 3978 |
| 164 | Ga0307416_101336662 | 3300032002 | Bacteria | 822 |
| 165 | Ga0307416_101595700 | 3300032002 | Bacteria | 758 |
| 166 | Ga0307414_10006548 | 3300032004 | Bacteria | 6500 |
| 167 | Ga0307411_10000595 | 3300032005 | Bacteria | 12974 |
| 168 | Ga0307411_10013792 | 3300032005 | Bacteria | 4475 |
| 169 | Ga0307415_100378915 | 3300032126 | Bacteria | 1200 |
| 170 | Ga0307415_101960078 | 3300032126 | Bacteria | 570 |
| 171 | Ga0373943_0249133 | 3300035170 | Bacteria | 997 |
| 172 | Ga0373925_0280966 | 3300037068 | Bacteria | 1341 |
| 173 | Ga0395905_1458928 | 3300037471 | Bacteria | 588 |
| 174 | Ga0439447_072213 | 3300041407 | Bacteria | 801 |
| 175 | Ga0439461_0081199 | 3300041410 | Bacteria | 765 |
| 176 | Ga0451793_0078918 | 3300041452 | Bacteria | 913 |
| 177 | Ga0451841_0971617 | 3300041498 | Bacteria | 700 |
| 178 | Ga0439431_0014884 | 3300041997 | Bacteria | 1807 |
| 179 | Ga0439457_118841 | 3300042014 | Bacteria | 624 |
| 180 | Ga0450894_001957 | 3300042131 | Bacteria | 2841 |
| 181 | Ga0450898_124062 | 3300042134 | Bacteria | 553 |
| 182 | Ga0450906_003800 | 3300042145 | Bacteria | 3212 |
| 183 | Ga0450908_004699 | 3300042184 | Bacteria | 2632 |
| 184 | Ga0466969_0039084 | 3300044656 | Bacteria | 2385 |
| 185 | Ga0466969_0336544 | 3300044656 | Bacteria | 683 |
| 186 | Ga0466972_0351373 | 3300044658 | Bacteria | 689 |
| 187 | Ga0466977_0232976 | 3300044666 | Bacteria | 1149 |
| 188 | Ga0466982_0000009 | 3300044672 | Bacteria | 221166 |
| 189 | Ga0466965_0337276 | 3300044683 | Bacteria | 823 |
| 190 | Ga0466966_0002007 | 3300044684 | Bacteria | 13210 |
| 191 | Ga0466961_0134526 | 3300044693 | Bacteria | 1549 |
| 192 | Ga0466964_0041063 | 3300044706 | Bacteria | 1869 |
| 193 | Ga0466971_0007980 | 3300044719 | Bacteria | 4613 |
| 194 | Ga0466968_0002780 | 3300044735 | Bacteria | 6467 |
| 195 | Ga0466970_0071623 | 3300044765 | Bacteria | 1864 |
| 196 | Ga0466957_0236068 | 3300044842 | Bacteria | 1212 |
| 197 | Ga0466960_0001857 | 3300044901 | Bacteria | 7757 |
| 198 | Ga0466959_0279071 | 3300045049 | Bacteria | 1147 |
| 199 | Ga0495603_0001003 | 3300046455 | Bacteria | 16300 |
| 200 | Ga0495603_0003149 | 3300046455 | Bacteria | 9808 |
| 201 | Ga0495603_0158068 | 3300046455 | Bacteria | 1315 |
| 202 | Ga0495629_0000765 | 3300046459 | Bacteria | 25909 |
| 203 | Ga0495629_0003305 | 3300046459 | Bacteria | 12181 |
| 204 | Ga0495638_0245248 | 3300046460 | Bacteria | 990 |
| 205 | Ga0495580_0278234 | 3300046472 | Bacteria | 1142 |
| 206 | Ga0495662_0578016 | 3300046476 | Bacteria | 550 |
| 207 | Ga0495664_0582905 | 3300046477 | Bacteria | 665 |
| 208 | Ga0495584_0051603 | 3300046491 | Bacteria | 2070 |
| 209 | Ga0495584_0647392 | 3300046491 | Bacteria | 539 |
| 210 | Ga0495585_0436751 | 3300046492 | Bacteria | 627 |
| 211 | Ga0495594_0003436 | 3300046499 | Bacteria | 8176 |
| 212 | Ga0495594_0037756 | 3300046499 | Bacteria | 2636 |
| 213 | Ga0495620_0135939 | 3300046515 | Bacteria | 963 |
| 214 | Ga0495631_0062323 | 3300046518 | Bacteria | 1616 |
| 215 | Ga0495631_0371946 | 3300046518 | Bacteria | 608 |
| 216 | Ga0495637_0036431 | 3300046520 | Bacteria | 2143 |
| 217 | Ga0495640_0031703 | 3300046533 | Bacteria | 3770 |
| 218 | Ga0495622_0007162 | 3300046557 | Bacteria | 5182 |
| 219 | Ga0495622_0074050 | 3300046557 | Bacteria | 1571 |
| 220 | Ga0495633_0572387 | 3300046558 | Bacteria | 508 |
| 221 | Ga0495656_0078347 | 3300046615 | Bacteria | 1485 |
| 222 | Ga0495588_0007758 | 3300046674 | Bacteria | 4903 |
| 223 | Ga0495588_0031189 | 3300046674 | Bacteria | 2682 |
| 224 | Ga0495613_0005675 | 3300046689 | Bacteria | 9348 |
| 225 | Ga0495613_0443512 | 3300046689 | Bacteria | 880 |
| 226 | Ga0495613_0546641 | 3300046689 | Bacteria | 775 |
| 227 | Ga0495613_0782513 | 3300046689 | Bacteria | 624 |
| 228 | Ga0495624_0776157 | 3300046690 | Bacteria | 567 |
| 229 | Ga0495671_0061218 | 3300046692 | Bacteria | 1857 |
| 230 | Ga0495581_0056220 | 3300047315 | Bacteria | 2271 |
| 231 | Ga0495604_0198580 | 3300047317 | Bacteria | 1393 |
| 232 | Ga0495636_0024050 | 3300047318 | Bacteria | 2468 |
| 233 | Ga0495636_0167168 | 3300047318 | Bacteria | 993 |
| 234 | Ga0495676_0004973 | 3300047321 | Bacteria | 12190 |
| 235 | Ga0495676_0029552 | 3300047321 | Bacteria | 4664 |
| 236 | Ga0495676_0139917 | 3300047321 | Bacteria | 1735 |
| 237 | Ga0495675_0073029 | 3300047444 | Bacteria | 2164 |
| 238 | Ga0495675_0686963 | 3300047444 | Bacteria | 574 |
| 239 | Ga0495685_085415 | 3300047447 | Bacteria | 1049 |
| 240 | Ga0495681_0289253 | 3300047470 | Bacteria | 637 |
| 241 | Ga0495686_0008066 | 3300047472 | Bacteria | 7795 |
| 242 | Ga0495593_0102634 | 3300047673 | Bacteria | 1466 |
| 243 | Ga0495614_0000230 | 3300048089 | Bacteria | 21721 |
| 244 | Ga0496102_1827428 | 3300048905 | Bacteria | 525 |
| 245 | Ga0496104_1312240 | 3300048907 | Bacteria | 627 |
| 246 | Ga0496106_0260004 | 3300048909 | Bacteria | 1389 |
| 247 | Ga0496109_0563886 | 3300048912 | Bacteria | 1074 |
| 248 | Ga0496121_0036234 | 3300048924 | Bacteria | 4399 |
| 249 | Ga0496122_0084648 | 3300048925 | Bacteria | 2192 |
| 250 | Ga0496125_0000867 | 3300048928 | Bacteria | 48475 |
| 251 | Ga0501032_0138386 | 3300049569 | Bacteria | 1604 |
| 252 | Ga0501033_0061334 | 3300049570 | Bacteria | 2772 |
| 253 | Ga0501034_0001040 | 3300049571 | Bacteria | 39567 |
| 254 | Ga0501034_0309658 | 3300049571 | Bacteria | 1514 |
| 255 | Ga0501039_0240895 | 3300049575 | Bacteria | 1422 |
| 256 | Ga0501043_1068398 | 3300049579 | Bacteria | 572 |
| 257 | Ga0501048_1388640 | 3300049582 | Bacteria | 505 |
| 258 | Ga0501069_0008333 | 3300049585 | Bacteria | 5443 |
| 259 | Ga0501069_0263083 | 3300049585 | Bacteria | 1007 |
| 260 | Ga0501070_0004331 | 3300049586 | Bacteria | 12201 |
| 261 | Ga0501070_0156792 | 3300049586 | Bacteria | 1877 |
| 262 | Ga0501074_0003897 | 3300049590 | Bacteria | 10633 |
| 263 | Ga0501227_005551 | 3300049665 | Bacteria | 2700 |
| 264 | Ga0501080_0085418 | 3300049742 | Bacteria | 2932 |
| 265 | Ga0501280_001937 | 3300049776 | Bacteria | 3611 |
| 266 | Ga0501035_0152844 | 3300049822 | Bacteria | 2002 |
| 267 | Ga0501044_0115795 | 3300049823 | Bacteria | 2686 |
| 268 | nmdc:mga00v17_321960_c1 | 3300050491 | Bacteria | 1005 |
| 269 | nmdc:mga00v17_434468_c1 | 3300050491 | Bacteria | 853 |
| 270 | nmdc:mga05p37_47801_c1 | 3300050507 | Bacteria | 5261 |
| 271 | nmdc:mga0qj67_125308_c1 | 3300050509 | Bacteria | 2079 |
| 272 | nmdc:mga06r32_299157_c1 | 3300050510 | Bacteria | 1595 |
| 273 | nmdc:mga06r32_73219_c1 | 3300050510 | Bacteria | 3318 |
| 274 | nmdc:mga08y16_533079_c1 | 3300050511 | Bacteria | 1190 |
| 275 | nmdc:mga08y16_667950_c1 | 3300050511 | Bacteria | 1042 |
| 276 | nmdc:mga0n895_1248_c1 | 3300050512 | Bacteria | 18767 |
| 277 | nmdc:mga0rr50_17473_c1 | 3300050513 | Bacteria | 4791 |
| 278 | nmdc:mga08x19_428818_c1 | 3300050514 | Bacteria | 929 |
| 279 | nmdc:mga0a205_68990_c1 | 3300050515 | Bacteria | 3415 |
| 280 | Ga0500642_0066730 | 3300053130 | Bacteria | 1629 |
| 281 | Ga0466962_0003760 | 3300061719 | Bacteria | 7249 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049776 | Ga0501280_001937 | Ga0501280_001937_2922_3239 | 75 |
| 2 | 3300009147 | Ga0114129_10059079 | Ga0114129_100590791 | 82 |
| 3 | 3300005328 | Ga0070676_10491025 | Ga0070676_104910251 | 86 |
| 4 | 3300005335 | Ga0070666_10177984 | Ga0070666_101779842 | 86 |
| 5 | 3300005340 | Ga0070689_100253287 | Ga0070689_1002532872 | 86 |
| 6 | 3300005355 | Ga0070671_100069081 | Ga0070671_1000690812 | 86 |
| 7 | 3300005364 | Ga0070673_100064745 | Ga0070673_1000647454 | 86 |
| 8 | 3300005365 | Ga0070688_101412247 | Ga0070688_1014122472 | 86 |
| 9 | 3300005456 | Ga0070678_100191069 | Ga0070678_1001910691 | 86 |
| 10 | 3300005457 | Ga0070662_100515083 | Ga0070662_1005150832 | 86 |
| 11 | 3300005543 | Ga0070672_100064321 | Ga0070672_1000643213 | 86 |
| 12 | 3300005616 | Ga0068852_100332171 | Ga0068852_1003321712 | 86 |
| 13 | 3300005844 | Ga0068862_101223677 | Ga0068862_1012236771 | 86 |
| 14 | 3300009177 | Ga0105248_10003665 | Ga0105248_100036652 | 86 |
| 15 | 3300013306 | Ga0163162_10032937 | Ga0163162_100329372 | 86 |
| 16 | 3300013308 | Ga0157375_10094167 | Ga0157375_100941671 | 86 |
| 17 | 3300014968 | Ga0157379_10277906 | Ga0157379_102779063 | 86 |
| 18 | 3300017792 | Ga0163161_10454634 | Ga0163161_104546342 | 86 |
| 19 | 3300025901 | Ga0207688_10564774 | Ga0207688_105647742 | 86 |
| 20 | 3300025903 | Ga0207680_10062041 | Ga0207680_100620415 | 86 |
| 21 | 3300025931 | Ga0207644_10007077 | Ga0207644_100070776 | 86 |
| 22 | 3300025933 | Ga0207706_10635664 | Ga0207706_106356642 | 86 |
| 23 | 3300025936 | Ga0207670_10712220 | Ga0207670_107122201 | 86 |
| 24 | 3300025940 | Ga0207691_10180824 | Ga0207691_101808241 | 86 |
| 25 | 3300025941 | Ga0207711_10026472 | Ga0207711_100264722 | 86 |
| 26 | 3300025960 | Ga0207651_10024707 | Ga0207651_100247074 | 86 |
| 27 | 3300026023 | Ga0207677_10707399 | Ga0207677_107073991 | 86 |
| 28 | 3300026067 | Ga0207678_10903304 | Ga0207678_109033042 | 86 |
| 29 | 3300026121 | Ga0207683_10464549 | Ga0207683_104645492 | 86 |
| 30 | 3300026142 | Ga0207698_10483958 | Ga0207698_104839581 | 86 |
| 31 | 3300048912 | Ga0496109_0563886 | Ga0496109_0563886_633_953 | 86 |
| 32 | 3300050491 | nmdc:mga00v17_434468_c1 | nmdc:mga00v17_434468_c1_24_338 | 86 |
| 33 | 3300009174 | Ga0105241_12033751 | Ga0105241_120337511 | 87 |
| 34 | 3300050491 | nmdc:mga00v17_321960_c1 | nmdc:mga00v17_321960_c1_207_521 | 88 |
| 35 | 3300005719 | Ga0068861_100700815 | Ga0068861_1007008152 | 89 |
| 36 | 3300005843 | Ga0068860_101979718 | Ga0068860_1019797182 | 89 |
| 37 | 3300006881 | Ga0068865_101050314 | Ga0068865_1010503142 | 89 |
| 38 | 3300013297 | Ga0157378_10848592 | Ga0157378_108485921 | 89 |
| 39 | 3300026118 | Ga0207675_100397675 | Ga0207675_1003976752 | 89 |
| 40 | 3300028380 | Ga0268265_10901420 | Ga0268265_109014202 | 89 |
| 41 | 3300006844 | Ga0075428_100338163 | Ga0075428_1003381632 | 90 |
| 42 | 3300009553 | Ga0105249_12674483 | Ga0105249_126744831 | 90 |
| 43 | 3300005347 | Ga0070668_100114853 | Ga0070668_1001148532 | 91 |
| 44 | 3300005438 | Ga0070701_11231768 | Ga0070701_112317681 | 91 |
| 45 | 3300005539 | Ga0068853_100003225 | Ga0068853_1000032257 | 91 |
| 46 | 3300005548 | Ga0070665_100053376 | Ga0070665_1000533762 | 91 |
| 47 | 3300005563 | Ga0068855_100004282 | Ga0068855_1000042829 | 91 |
| 48 | 3300005577 | Ga0068857_100575309 | Ga0068857_1005753091 | 91 |
| 49 | 3300005841 | Ga0068863_100014482 | Ga0068863_1000144824 | 91 |
| 50 | 3300006847 | Ga0075431_100031094 | Ga0075431_1000310941 | 91 |
| 51 | 3300009094 | Ga0111539_10011442 | Ga0111539_100114423 | 91 |
| 52 | 3300009553 | Ga0105249_10385069 | Ga0105249_103850692 | 91 |
| 53 | 3300010375 | Ga0105239_10003689 | Ga0105239_1000368920 | 91 |
| 54 | 3300025273 | Ga0209673_1062430 | Ga0209673_10624302 | 91 |
| 55 | 3300025949 | Ga0207667_10005407 | Ga0207667_1000540712 | 91 |
| 56 | 3300025961 | Ga0207712_10056320 | Ga0207712_100563203 | 91 |
| 57 | 3300025972 | Ga0207668_10089333 | Ga0207668_100893332 | 91 |
| 58 | 3300026041 | Ga0207639_10000690 | Ga0207639_1000069010 | 91 |
| 59 | 3300026088 | Ga0207641_10081055 | Ga0207641_100810553 | 91 |
| 60 | 3300026116 | Ga0207674_10380330 | Ga0207674_103803301 | 91 |
| 61 | 3300026118 | Ga0207675_100255174 | Ga0207675_1002551744 | 91 |
| 62 | 3300026142 | Ga0207698_10623220 | Ga0207698_106232201 | 91 |
| 63 | 3300027907 | Ga0207428_10076220 | Ga0207428_100762204 | 91 |
| 64 | 3300028379 | Ga0268266_10058815 | Ga0268266_100588152 | 91 |
| 65 | 3300041452 | Ga0451793_0078918 | Ga0451793_0078918_35_355 | 91 |
| 66 | 3300050507 | nmdc:mga05p37_47801_c1 | nmdc:mga05p37_47801_c1_2390_2707 | 91 |
| 67 | 3300050510 | nmdc:mga06r32_73219_c1 | nmdc:mga06r32_73219_c1_1243_1560 | 91 |
| 68 | 3300050511 | nmdc:mga08y16_533079_c1 | nmdc:mga08y16_533079_c1_776_1093 | 91 |
| 69 | 3300005367 | Ga0070667_101949637 | Ga0070667_1019496371 | 92 |
| 70 | 3300044656 | Ga0466969_0039084 | Ga0466969_0039084_1110_1433 | 93 |
| 71 | 3300044656 | Ga0466969_0336544 | Ga0466969_0336544_122_445 | 93 |
| 72 | 3300044658 | Ga0466972_0351373 | Ga0466972_0351373_183_506 | 93 |
| 73 | 3300044666 | Ga0466977_0232976 | Ga0466977_0232976_370_693 | 93 |
| 74 | 3300044672 | Ga0466982_0000009 | Ga0466982_0000009_174010_174333 | 93 |
| 75 | 3300044683 | Ga0466965_0337276 | Ga0466965_0337276_460_783 | 93 |
| 76 | 3300044684 | Ga0466966_0002007 | Ga0466966_0002007_10713_11036 | 93 |
| 77 | 3300044693 | Ga0466961_0134526 | Ga0466961_0134526_966_1289 | 93 |
| 78 | 3300044706 | Ga0466964_0041063 | Ga0466964_0041063_1384_1707 | 93 |
| 79 | 3300044719 | Ga0466971_0007980 | Ga0466971_0007980_4040_4363 | 93 |
| 80 | 3300044735 | Ga0466968_0002780 | Ga0466968_0002780_6051_6374 | 93 |
| 81 | 3300044765 | Ga0466970_0071623 | Ga0466970_0071623_1439_1762 | 93 |
| 82 | 3300044842 | Ga0466957_0236068 | Ga0466957_0236068_822_1145 | 93 |
| 83 | 3300044901 | Ga0466960_0001857 | Ga0466960_0001857_5836_6159 | 93 |
| 84 | 3300045049 | Ga0466959_0279071 | Ga0466959_0279071_608_931 | 93 |
| 85 | 3300061719 | Ga0466962_0003760 | Ga0466962_0003760_1280_1603 | 93 |
| 86 | 3300005366 | Ga0070659_100194322 | Ga0070659_1001943222 | 94 |
| 87 | 3300005563 | Ga0068855_100448158 | Ga0068855_1004481582 | 94 |
| 88 | 3300005564 | Ga0070664_100162140 | Ga0070664_1001621402 | 94 |
| 89 | 3300005577 | Ga0068857_100266581 | Ga0068857_1002665812 | 94 |
| 90 | 3300006175 | Ga0070712_100487073 | Ga0070712_1004870731 | 94 |
| 91 | 3300013105 | Ga0157369_10078600 | Ga0157369_100786001 | 94 |
| 92 | 3300025915 | Ga0207693_10382835 | Ga0207693_103828352 | 94 |
| 93 | 3300025924 | Ga0207694_10349321 | Ga0207694_103493212 | 94 |
| 94 | 3300025945 | Ga0207679_10116683 | Ga0207679_101166832 | 94 |
| 95 | 3300026041 | Ga0207639_11543794 | Ga0207639_115437941 | 94 |
| 96 | 3300026116 | Ga0207674_10247526 | Ga0207674_102475262 | 94 |
| 97 | 3300035170 | Ga0373943_0249133 | Ga0373943_0249133_399_719 | 94 |
| 98 | 3300037068 | Ga0373925_0280966 | Ga0373925_0280966_40_360 | 94 |
| 99 | 3300046472 | Ga0495580_0278234 | Ga0495580_0278234_599_919 | 94 |
| 100 | 3300006852 | Ga0075433_10059740 | Ga0075433_100597402 | 95 |
| 101 | 3300027907 | Ga0207428_10400459 | Ga0207428_104004592 | 95 |
| 102 | 3300046455 | Ga0495603_0158068 | Ga0495603_0158068_584_898 | 95 |
| 103 | 3300046520 | Ga0495637_0036431 | Ga0495637_0036431_1129_1443 | 95 |
| 104 | 3300046692 | Ga0495671_0061218 | Ga0495671_0061218_201_515 | 95 |
| 105 | 3300047321 | Ga0495676_0139917 | Ga0495676_0139917_407_721 | 95 |
| 106 | 3300050511 | nmdc:mga08y16_667950_c1 | nmdc:mga08y16_667950_c1_612_932 | 95 |
| 107 | 3300050512 | nmdc:mga0n895_1248_c1 | nmdc:mga0n895_1248_c1_3177_3497 | 95 |
| 108 | 3300050513 | nmdc:mga0rr50_17473_c1 | nmdc:mga0rr50_17473_c1_1490_1810 | 95 |
| 109 | 3300050514 | nmdc:mga08x19_428818_c1 | nmdc:mga08x19_428818_c1_525_845 | 95 |
| 110 | 3300050515 | nmdc:mga0a205_68990_c1 | nmdc:mga0a205_68990_c1_973_1293 | 95 |
| 111 | 3300032004 | Ga0307414_10006548 | Ga0307414_100065483 | 96 |
| 112 | 3300032005 | Ga0307411_10000595 | Ga0307411_100005953 | 96 |
| 113 | 3300042131 | Ga0450894_001957 | Ga0450894_001957_2389_2709 | 96 |
| 114 | 3300042145 | Ga0450906_003800 | Ga0450906_003800_131_451 | 96 |
| 115 | 3300042184 | Ga0450908_004699 | Ga0450908_004699_135_455 | 96 |
| 116 | 3300047444 | Ga0495675_0686963 | Ga0495675_0686963_225_545 | 96 |
| 117 | 3300049665 | Ga0501227_005551 | Ga0501227_005551_819_1133 | 96 |
| 118 | 3300005289 | Ga0065704_10461226 | Ga0065704_104612261 | 97 |
| 119 | 3300005295 | Ga0065707_10174137 | Ga0065707_101741371 | 97 |
| 120 | 3300031548 | Ga0307408_100005693 | Ga0307408_1000056939 | 97 |
| 121 | 3300031731 | Ga0307405_10002287 | Ga0307405_1000228710 | 97 |
| 122 | 3300031852 | Ga0307410_10003574 | Ga0307410_100035742 | 97 |
| 123 | 3300031901 | Ga0307406_10013544 | Ga0307406_100135442 | 97 |
| 124 | 3300031911 | Ga0307412_10040592 | Ga0307412_100405924 | 97 |
| 125 | 3300031995 | Ga0307409_100124851 | Ga0307409_1001248512 | 97 |
| 126 | 3300032002 | Ga0307416_100031790 | Ga0307416_1000317904 | 97 |
| 127 | 3300032005 | Ga0307411_10013792 | Ga0307411_100137924 | 97 |
| 128 | 3300032126 | Ga0307415_100378915 | Ga0307415_1003789152 | 97 |
| 129 | 3300048925 | Ga0496122_0084648 | Ga0496122_0084648_1044_1361 | 98 |
| 130 | 3300005539 | Ga0068853_102423279 | Ga0068853_1024232791 | 99 |
| 131 | 3300012482 | Ga0157318_1033991 | Ga0157318_10339911 | 99 |
| 132 | 3300026041 | Ga0207639_12202640 | Ga0207639_122026401 | 99 |
| 133 | 3300046492 | Ga0495585_0436751 | Ga0495585_0436751_143_442 | 99 |
| 134 | 3300046515 | Ga0495620_0135939 | Ga0495620_0135939_547_846 | 99 |
| 135 | 3300046518 | Ga0495631_0371946 | Ga0495631_0371946_169_468 | 99 |
| 136 | 3300047318 | Ga0495636_0167168 | Ga0495636_0167168_152_451 | 99 |
| 137 | 3300047447 | Ga0495685_085415 | Ga0495685_085415_646_945 | 99 |
| 138 | 3300049569 | Ga0501032_0138386 | Ga0501032_0138386_370_669 | 99 |
| 139 | 3300049570 | Ga0501033_0061334 | Ga0501033_0061334_2423_2722 | 99 |
| 140 | 3300049571 | Ga0501034_0309658 | Ga0501034_0309658_28_327 | 99 |
| 141 | 3300049822 | Ga0501035_0152844 | Ga0501035_0152844_1623_1922 | 99 |
| 142 | iso_pu_bacteria | 2510065059 | 2510314937 | 100 |
| 143 | iso_pu_bacteria | 2874123672 | 2874128403 | 100 |
| 144 | iso_pu_bacteria | 2941499720 | 2941506006 | 100 |
| 145 | 3300005338 | Ga0068868_100059350 | Ga0068868_1000593502 | 101 |
| 146 | 3300005441 | Ga0070700_100288303 | Ga0070700_1002883032 | 101 |
| 147 | 3300026075 | Ga0207708_10660395 | Ga0207708_106603951 | 101 |
| 148 | 3300041498 | Ga0451841_0971617 | Ga0451841_0971617_69_389 | 101 |
| 149 | 3300047472 | Ga0495686_0008066 | Ga0495686_0008066_3613_3933 | 101 |
| 150 | 3300049579 | Ga0501043_1068398 | Ga0501043_1068398_28_333 | 101 |
| 151 | iso_pu_bacteria | 2643221586 | 2643941332 | 101 |
| 152 | iso_pu_bacteria | 2643221612 | 2644080423 | 101 |
| 153 | iso_pu_bacteria | 2643221720 | 2644662872 | 101 |
| 154 | iso_pu_bacteria | 2643221727 | 2644697036 | 101 |
| 155 | iso_pu_bacteria | 2643221728 | 2644698173 | 101 |
| 156 | iso_pu_bacteria | 2582581312 | 2585299070 | 102 |
| 157 | iso_pu_bacteria | 2643221548 | 2643765395 | 102 |
| 158 | iso_pu_bacteria | 2643221682 | 2644462534 | 102 |
| 159 | iso_pu_bacteria | 2739367875 | 2740063667 | 102 |
| 160 | iso_pu_bacteria | 2802429296 | 2804847569 | 102 |
| 161 | iso_pu_bacteria | 2808606982 | 2811848535 | 102 |
| 162 | iso_pu_bacteria | 2811994879 | 2812358663 | 102 |
| 163 | iso_pu_bacteria | 2818991463 | 2819693392 | 102 |
| 164 | iso_pu_bacteria | 2852635781 | 2852642389 | 102 |
| 165 | iso_pu_bacteria | 2862178590 | 2862184642 | 102 |
| 166 | iso_pu_bacteria | 2867369537 | 2867371465 | 102 |
| 167 | iso_pu_bacteria | 2867475112 | 2867477257 | 102 |
| 168 | iso_pu_bacteria | 2875391855 | 2875394082 | 102 |
| 169 | iso_pu_bacteria | 2912757875 | 2912760182 | 102 |
| 170 | iso_pu_bacteria | 2946045630 | 2946050532 | 102 |
| 171 | iso_pu_bacteria | 2946064051 | 2946067210 | 102 |
| 172 | iso_pu_bacteria | 2966598605 | 2966603000 | 102 |
| 173 | iso_pu_bacteria | 8025413630 | 8025417373 | 102 |
| 174 | iso_pu_bacteria | 8025478263 | 8025485035 | 102 |
| 175 | iso_pu_bacteria | 8033684223 | 8033684714 | 102 |
| 176 | 3300005336 | Ga0070680_101255083 | Ga0070680_1012550832 | 103 |
| 177 | 3300005339 | Ga0070660_100118779 | Ga0070660_1001187793 | 104 |
| 178 | 3300005548 | Ga0070665_100524813 | Ga0070665_1005248132 | 104 |
| 179 | 3300009093 | Ga0105240_10323370 | Ga0105240_103233703 | 104 |
| 180 | 3300009176 | Ga0105242_13004985 | Ga0105242_130049851 | 104 |
| 181 | 3300013297 | Ga0157378_11602752 | Ga0157378_116027522 | 104 |
| 182 | 3300025925 | Ga0207650_10718595 | Ga0207650_107185952 | 104 |
| 183 | 3300032126 | Ga0307415_101960078 | Ga0307415_1019600781 | 104 |
| 184 | 3300005328 | Ga0070676_10187352 | Ga0070676_101873522 | 105 |
| 185 | 3300005333 | Ga0070677_10144705 | Ga0070677_101447052 | 105 |
| 186 | 3300005337 | Ga0070682_101902533 | Ga0070682_1019025331 | 105 |
| 187 | 3300005340 | Ga0070689_100131051 | Ga0070689_1001310513 | 105 |
| 188 | 3300005365 | Ga0070688_101075421 | Ga0070688_1010754212 | 105 |
| 189 | 3300005441 | Ga0070700_100020069 | Ga0070700_1000200694 | 105 |
| 190 | 3300005457 | Ga0070662_101937506 | Ga0070662_1019375061 | 105 |
| 191 | 3300005466 | Ga0070685_10552479 | Ga0070685_105524792 | 105 |
| 192 | 3300005543 | Ga0070672_101815473 | Ga0070672_1018154731 | 105 |
| 193 | 3300005548 | Ga0070665_100003308 | Ga0070665_1000033082 | 105 |
| 194 | 3300005617 | Ga0068859_100235376 | Ga0068859_1002353762 | 105 |
| 195 | 3300005719 | Ga0068861_100182282 | Ga0068861_1001822822 | 105 |
| 196 | 3300005842 | Ga0068858_100905099 | Ga0068858_1009050992 | 105 |
| 197 | 3300005843 | Ga0068860_101199384 | Ga0068860_1011993842 | 105 |
| 198 | 3300006931 | Ga0097620_100235374 | Ga0097620_1002353742 | 105 |
| 199 | 3300025907 | Ga0207645_10230526 | Ga0207645_102305263 | 105 |
| 200 | 3300025926 | Ga0207659_11151499 | Ga0207659_111514991 | 105 |
| 201 | 3300025936 | Ga0207670_10124831 | Ga0207670_101248312 | 105 |
| 202 | 3300025940 | Ga0207691_11172249 | Ga0207691_111722492 | 105 |
| 203 | 3300025945 | Ga0207679_10946183 | Ga0207679_109461832 | 105 |
| 204 | 3300026075 | Ga0207708_10036532 | Ga0207708_100365323 | 105 |
| 205 | 3300026118 | Ga0207675_100223254 | Ga0207675_1002232542 | 105 |
| 206 | 3300028379 | Ga0268266_10021077 | Ga0268266_100210773 | 105 |
| 207 | 3300037471 | Ga0395905_1458928 | Ga0395905_1458928_23_340 | 105 |
| 208 | 3300046477 | Ga0495664_0582905 | Ga0495664_0582905_239_556 | 105 |
| 209 | 3300049575 | Ga0501039_0240895 | Ga0501039_0240895_1025_1342 | 105 |
| 210 | 3300049585 | Ga0501069_0008333 | Ga0501069_0008333_352_669 | 105 |
| 211 | 3300049585 | Ga0501069_0263083 | Ga0501069_0263083_38_355 | 105 |
| 212 | 3300049586 | Ga0501070_0004331 | Ga0501070_0004331_5265_5582 | 105 |
| 213 | 3300049586 | Ga0501070_0156792 | Ga0501070_0156792_267_584 | 105 |
| 214 | 3300049590 | Ga0501074_0003897 | Ga0501074_0003897_5117_5434 | 105 |
| 215 | 3300049742 | Ga0501080_0085418 | Ga0501080_0085418_1875_2192 | 105 |
| 216 | 3300005347 | Ga0070668_102251028 | Ga0070668_1022510282 | 106 |
| 217 | 3300005455 | Ga0070663_100016847 | Ga0070663_1000168473 | 106 |
| 218 | 3300005458 | Ga0070681_10992972 | Ga0070681_109929722 | 106 |
| 219 | 3300005547 | Ga0070693_100771056 | Ga0070693_1007710561 | 106 |
| 220 | 3300005937 | Ga0081455_10212047 | Ga0081455_102120472 | 106 |
| 221 | 3300006847 | Ga0075431_100243488 | Ga0075431_1002434882 | 106 |
| 222 | 3300013308 | Ga0157375_12845401 | Ga0157375_128454012 | 106 |
| 223 | 3300020069 | Ga0197907_10976850 | Ga0197907_109768502 | 106 |
| 224 | 3300025297 | Ga0209758_1014059 | Ga0209758_10140595 | 106 |
| 225 | 3300025302 | Ga0207426_1022064 | Ga0207426_10220644 | 106 |
| 226 | 3300025934 | Ga0207686_11676269 | Ga0207686_116762691 | 106 |
| 227 | 3300031548 | Ga0307408_100225119 | Ga0307408_1002251192 | 106 |
| 228 | 3300031731 | Ga0307405_10221042 | Ga0307405_102210422 | 106 |
| 229 | 3300032002 | Ga0307416_101336662 | Ga0307416_1013366622 | 106 |
| 230 | 3300032002 | Ga0307416_101595700 | Ga0307416_1015957001 | 106 |
| 231 | 3300041407 | Ga0439447_072213 | Ga0439447_072213_30_350 | 106 |
| 232 | 3300041410 | Ga0439461_0081199 | Ga0439461_0081199_154_474 | 106 |
| 233 | 3300041997 | Ga0439431_0014884 | Ga0439431_0014884_230_550 | 106 |
| 234 | 3300042014 | Ga0439457_118841 | Ga0439457_118841_79_399 | 106 |
| 235 | 3300042134 | Ga0450898_124062 | Ga0450898_124062_146_466 | 106 |
| 236 | 3300046455 | Ga0495603_0001003 | Ga0495603_0001003_14820_15140 | 106 |
| 237 | 3300046455 | Ga0495603_0003149 | Ga0495603_0003149_7293_7634 | 106 |
| 238 | 3300046459 | Ga0495629_0000765 | Ga0495629_0000765_5594_5914 | 106 |
| 239 | 3300046459 | Ga0495629_0003305 | Ga0495629_0003305_2836_3177 | 106 |
| 240 | 3300046460 | Ga0495638_0245248 | Ga0495638_0245248_561_881 | 106 |
| 241 | 3300046476 | Ga0495662_0578016 | Ga0495662_0578016_107_427 | 106 |
| 242 | 3300046491 | Ga0495584_0051603 | Ga0495584_0051603_1684_2004 | 106 |
| 243 | 3300046491 | Ga0495584_0647392 | Ga0495584_0647392_149_469 | 106 |
| 244 | 3300046499 | Ga0495594_0003436 | Ga0495594_0003436_2540_2860 | 106 |
| 245 | 3300046499 | Ga0495594_0037756 | Ga0495594_0037756_1836_2156 | 106 |
| 246 | 3300046518 | Ga0495631_0062323 | Ga0495631_0062323_1197_1517 | 106 |
| 247 | 3300046533 | Ga0495640_0031703 | Ga0495640_0031703_779_1099 | 106 |
| 248 | 3300046557 | Ga0495622_0007162 | Ga0495622_0007162_1061_1381 | 106 |
| 249 | 3300046557 | Ga0495622_0074050 | Ga0495622_0074050_642_962 | 106 |
| 250 | 3300046558 | Ga0495633_0572387 | Ga0495633_0572387_51_371 | 106 |
| 251 | 3300046615 | Ga0495656_0078347 | Ga0495656_0078347_532_852 | 106 |
| 252 | 3300046674 | Ga0495588_0007758 | Ga0495588_0007758_19_339 | 106 |
| 253 | 3300046674 | Ga0495588_0031189 | Ga0495588_0031189_1244_1564 | 106 |
| 254 | 3300046689 | Ga0495613_0005675 | Ga0495613_0005675_8946_9287 | 106 |
| 255 | 3300046689 | Ga0495613_0443512 | Ga0495613_0443512_14_334 | 106 |
| 256 | 3300046689 | Ga0495613_0546641 | Ga0495613_0546641_296_616 | 106 |
| 257 | 3300046689 | Ga0495613_0782513 | Ga0495613_0782513_181_501 | 106 |
| 258 | 3300046690 | Ga0495624_0776157 | Ga0495624_0776157_37_357 | 106 |
| 259 | 3300047315 | Ga0495581_0056220 | Ga0495581_0056220_264_584 | 106 |
| 260 | 3300047317 | Ga0495604_0198580 | Ga0495604_0198580_439_759 | 106 |
| 261 | 3300047318 | Ga0495636_0024050 | Ga0495636_0024050_1127_1447 | 106 |
| 262 | 3300047321 | Ga0495676_0004973 | Ga0495676_0004973_5395_5715 | 106 |
| 263 | 3300047321 | Ga0495676_0029552 | Ga0495676_0029552_2287_2628 | 106 |
| 264 | 3300047444 | Ga0495675_0073029 | Ga0495675_0073029_156_476 | 106 |
| 265 | 3300047470 | Ga0495681_0289253 | Ga0495681_0289253_177_497 | 106 |
| 266 | 3300047673 | Ga0495593_0102634 | Ga0495593_0102634_971_1312 | 106 |
| 267 | 3300048089 | Ga0495614_0000230 | Ga0495614_0000230_16035_16376 | 106 |
| 268 | 3300048905 | Ga0496102_1827428 | Ga0496102_1827428_167_487 | 106 |
| 269 | 3300048907 | Ga0496104_1312240 | Ga0496104_1312240_290_610 | 106 |
| 270 | 3300048909 | Ga0496106_0260004 | Ga0496106_0260004_426_767 | 106 |
| 271 | 3300049571 | Ga0501034_0001040 | Ga0501034_0001040_13389_13709 | 106 |
| 272 | 3300049582 | Ga0501048_1388640 | Ga0501048_1388640_132_452 | 106 |
| 273 | 3300049823 | Ga0501044_0115795 | Ga0501044_0115795_2265_2585 | 106 |
| 274 | 3300050509 | nmdc:mga0qj67_125308_c1 | nmdc:mga0qj67_125308_c1_1268_1588 | 106 |
| 275 | 3300050510 | nmdc:mga06r32_299157_c1 | nmdc:mga06r32_299157_c1_263_583 | 106 |
| 276 | 3300053130 | Ga0500642_0066730 | Ga0500642_0066730_568_888 | 106 |
| 277 | 3300002067 | JGI24735J21928_10046287 | JGI24735J21928_100462871 | 107 |
| 278 | 3300002773 | JGI25152J39213_1053224 | JGI25152J39213_10532241 | 107 |
| 279 | 3300003578 | Ga0006562J51391_1012554 | Ga0006562J51391_10125544 | 107 |
| 280 | 3300003578 | Ga0006562J51391_1012556 | Ga0006562J51391_10125568 | 107 |
| 281 | 3300005344 | Ga0070661_100729889 | Ga0070661_1007298892 | 107 |
| 282 | 3300005539 | Ga0068853_100241740 | Ga0068853_1002417403 | 107 |
| 283 | 3300005563 | Ga0068855_100011630 | Ga0068855_1000116302 | 107 |
| 284 | 3300005564 | Ga0070664_100365338 | Ga0070664_1003653382 | 107 |
| 285 | 3300005577 | Ga0068857_100000255 | Ga0068857_10000025533 | 107 |
| 286 | 3300005578 | Ga0068854_100017689 | Ga0068854_1000176892 | 107 |
| 287 | 3300005834 | Ga0068851_10062145 | Ga0068851_100621452 | 107 |
| 288 | 3300005842 | Ga0068858_100013862 | Ga0068858_1000138628 | 107 |
| 289 | 3300009093 | Ga0105240_10060335 | Ga0105240_100603353 | 107 |
| 290 | 3300009545 | Ga0105237_10000026 | Ga0105237_1000002669 | 107 |
| 291 | 3300010375 | Ga0105239_10016630 | Ga0105239_100166304 | 107 |
| 292 | 3300013102 | Ga0157371_10113535 | Ga0157371_101135353 | 107 |
| 293 | 3300014968 | Ga0157379_10452974 | Ga0157379_104529741 | 107 |
| 294 | 3300020076 | Ga0206355_1182606 | Ga0206355_11826061 | 107 |
| 295 | 3300025258 | Ga0209129_1005472 | Ga0209129_10054724 | 107 |
| 296 | 3300025297 | Ga0209758_1002454 | Ga0209758_100245416 | 107 |
| 297 | 3300025321 | Ga0207656_10004996 | Ga0207656_100049963 | 107 |
| 298 | 3300025904 | Ga0207647_10016054 | Ga0207647_100160545 | 107 |
| 299 | 3300025913 | Ga0207695_10002223 | Ga0207695_100022238 | 107 |
| 300 | 3300025914 | Ga0207671_10000041 | Ga0207671_10000041119 | 107 |
| 301 | 3300025920 | Ga0207649_10666646 | Ga0207649_106666461 | 107 |
| 302 | 3300025933 | Ga0207706_10129216 | Ga0207706_101292162 | 107 |
| 303 | 3300025945 | Ga0207679_10229356 | Ga0207679_102293563 | 107 |
| 304 | 3300025949 | Ga0207667_10000921 | Ga0207667_1000092113 | 107 |
| 305 | 3300025981 | Ga0207640_10003733 | Ga0207640_100037338 | 107 |
| 306 | 3300026035 | Ga0207703_10060230 | Ga0207703_100602304 | 107 |
| 307 | 3300026116 | Ga0207674_10000106 | Ga0207674_100001065 | 107 |
| 308 | 3300048924 | Ga0496121_0036234 | Ga0496121_0036234_3991_4314 | 107 |
| 309 | 3300048928 | Ga0496125_0000867 | Ga0496125_0000867_955_1278 | 107 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7szt-assembly1.cif.gz_A | crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) | 0.8828 | 1 | 99 |
| 8tgy-assembly1.cif.gz_E | crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea | 0.844 | 1 | 101 |
| 7szt-assembly1.cif.gz_A | crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) | 0.8355 | 1 | 99 |
| 7ssu-assembly1.cif.gz_A | structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium | 0.8341 | 1 | 96 |
| 7ssu-assembly1.cif.gz_B | structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium | 0.8164 | 1 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P69210_8_109_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.9372 | 4 | 100 | 1.10.3730.20 |
| af_P9WGF1_2_106_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.9342 | 3 | 103 | 1.10.3730.20 |
| af_P23895_1_110_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.9103 | 2 | 105 | 1.10.3730.20 |
| af_P69937_1_105_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.9065 | 1 | 101 | 1.10.3730.20 |
| af_P69212_3_109_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8971 | 1 | 105 | 1.10.3730.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9H445-F1-model_v4 | Multidrug efflux SMR transporter | 1.001 | 1 | 67 |
GO:0005886
GO:0022857 |
| AF-A0A258SQT2-F1-model_v4 | Guanidinium exporter | 0.9836 | 1 | 81 |
GO:0005886
GO:0022857 |
| AF-Q89MZ8-F1-model_v4 | Guanidinium exporter | 0.9823 | 1 | 101 |
GO:0005886
GO:0022857 GO:0055085 |
| AF-A0A0B6X717-F1-model_v4 | Guanidinium exporter | 0.9789 | 1 | 101 |
GO:0005886
GO:0022857 |
| AF-A0A3D6BKV2-F1-model_v4 | QacE family quaternary ammonium compound efflux SMR transporter | 0.9778 | 1 | 100 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar