F400276

General Info

Members Datasets Scaffolds Average Seq Length
309 206 618 259

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10143700|Ga0265338_101437002
Length 258
Sequence MTPVLVFDIETVPDVAGLRKLNGIAAEISDEQVAAMAFQRRRQATGNDFLQLHLQRVVAISCALRDRESFRVWSLGEPGDGEGQLIQRFFDGVEKYTPQIVSWNGGGFDLPVLHYRGMMHGVHAARYWDQGEDDREFKWNNYISRYHARHLDLMDLLAMYQPRGAAPLDQFAQLLGFPGKIGLEGSQVWQAWQDGKIAQIRGYCEADVANTYLVYLRFQQMRGALPPEKYRQEIDLVRTTLEKLPDPHWREFLELWPA

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
200 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
201 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
205 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 6.47
Rhizosphere 80.26
Stem 0
Stem Tuber 0
Unclassified 6.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10143700 3300028800 Bacteria 1865
2 JGI25406J46586_10004971 3300003203 Bacteria 6178
3 rootL2_10216200 3300003322 Bacteria 1603
4 Ga0070683_100316237 3300005329 Bacteria 1486
5 Ga0070690_100068905 3300005330 Bacteria 2295
6 Ga0070670_100282049 3300005331 Bacteria 1450
7 Ga0070677_10128642 3300005333 Bacteria 1153
8 Ga0068869_100092139 3300005334 Bacteria 2281
9 Ga0070680_100006635 3300005336 Bacteria 8803
10 Ga0070680_100008785 3300005336 Bacteria 7750
11 Ga0068868_100175227 3300005338 Bacteria 1777
12 Ga0070689_100188058 3300005340 Bacteria 1680
13 Ga0070691_10111678 3300005341 Bacteria 1368
14 Ga0070675_100455981 3300005354 Bacteria 1147
15 Ga0070671_100000281 3300005355 Bacteria 34546
16 Ga0070671_100028032 3300005355 Bacteria 4637
17 Ga0070673_100117131 3300005364 Bacteria 2217
18 Ga0070688_100131322 3300005365 Bacteria 1690
19 Ga0070667_100007695 3300005367 Bacteria 8934
20 Ga0070667_100189825 3300005367 Bacteria 1820
21 Ga0070667_100420364 3300005367 Bacteria 1218
22 Ga0070709_10012711 3300005434 Bacteria 4715
23 Ga0070709_10047342 3300005434 Bacteria 2678
24 Ga0070714_100062368 3300005435 Bacteria 3204
25 Ga0070713_100005802 3300005436 Bacteria 8484
26 Ga0070710_10013504 3300005437 Bacteria 4094
27 Ga0070701_10020951 3300005438 Bacteria 3112
28 Ga0070701_10024627 3300005438 Bacteria 2913
29 Ga0070711_100055809 3300005439 Bacteria 2730
30 Ga0070711_100139151 3300005439 Bacteria 1818
31 Ga0070705_100024723 3300005440 Bacteria 3247
32 Ga0070700_100147008 3300005441 Bacteria 1608
33 Ga0070694_100040091 3300005444 Bacteria 3121
34 Ga0070694_100060103 3300005444 Bacteria 2591
35 Ga0070681_10004635 3300005458 Bacteria 13126
36 Ga0070681_10116634 3300005458 Bacteria 2607
37 Ga0070679_100007866 3300005530 Bacteria 9997
38 Ga0070679_100088414 3300005530 Bacteria 3085
39 Ga0070679_100098382 3300005530 Unclassified 2913
40 Ga0070684_100061171 3300005535 Bacteria 3296
41 Ga0070672_100330690 3300005543 Bacteria 1296
42 Ga0070686_100071741 3300005544 Bacteria 2269
43 Ga0070686_100100890 3300005544 Bacteria 1950
44 Ga0070696_100070611 3300005546 Bacteria 2457
45 Ga0070665_100007335 3300005548 Bacteria 11217
46 Ga0070665_100011391 3300005548 Bacteria 8992
47 Ga0070665_100021946 3300005548 Bacteria 6421
48 Ga0070665_100247624 3300005548 Bacteria 1782
49 Ga0068855_100003497 3300005563 Bacteria 19239
50 Ga0070664_100032685 3300005564 Bacteria 4352
51 Ga0070664_100831569 3300005564 Unclassified 864
52 Ga0068854_100217198 3300005578 Bacteria 1511
53 Ga0068856_100012817 3300005614 Bacteria 8114
54 Ga0068856_100267150 3300005614 Bacteria 1726
55 Ga0070702_100008777 3300005615 Bacteria 4915
56 Ga0068852_100355317 3300005616 Bacteria 1432
57 Ga0068859_100000678 3300005617 Bacteria 34157
58 Ga0068859_100650831 3300005617 Bacteria 1146
59 Ga0068864_100099871 3300005618 Bacteria 2572
60 Ga0068866_10108569 3300005718 Unclassified 1544
61 Ga0068866_10358338 3300005718 Bacteria 929
62 Ga0068861_100005744 3300005719 Bacteria 8413
63 Ga0068861_100045714 3300005719 Bacteria 3299
64 Ga0068861_100145571 3300005719 Bacteria 1939
65 Ga0068870_10066883 3300005840 Bacteria 1948
66 Ga0068863_100003345 3300005841 Bacteria 15832
67 Ga0068863_100006949 3300005841 Bacteria 11099
68 Ga0068863_100017122 3300005841 Bacteria 6951
69 Ga0068858_100000687 3300005842 Bacteria 35306
70 Ga0068858_100000883 3300005842 Bacteria 31125
71 Ga0068858_100056211 3300005842 Bacteria 3638
72 Ga0068860_100000219 3300005843 Bacteria 89810
73 Ga0068860_100047333 3300005843 Bacteria 4099
74 Ga0068860_100047810 3300005843 Bacteria 4077
75 Ga0068860_100108665 3300005843 Bacteria 2651
76 Ga0068862_100012101 3300005844 Bacteria 7130
77 Ga0081455_10002524 3300005937 Bacteria 21743
78 Ga0081539_10000004 3300005985 Bacteria 555600
79 Ga0070712_100001209 3300006175 Bacteria 15616
80 Ga0097621_100035663 3300006237 Bacteria 3976
81 Ga0097621_100206985 3300006237 Bacteria 1705
82 Ga0097621_100303087 3300006237 Bacteria 1412
83 Ga0068871_100075931 3300006358 Bacteria 2775
84 Ga0068871_100250636 3300006358 Unclassified 1542
85 Ga0068865_100012852 3300006881 Bacteria 5278
86 Ga0097620_100000678 3300006931 Bacteria 34157
87 Ga0097620_100650933 3300006931 Bacteria 1146
88 Ga0105240_10001356 3300009093 Bacteria 42000
89 Ga0105240_10015285 3300009093 Bacteria 10446
90 Ga0105240_10031348 3300009093 Bacteria 6896
91 Ga0105240_10189583 3300009093 Bacteria 2419
92 Ga0105245_10001541 3300009098 Bacteria 20894
93 Ga0105247_10000203 3300009101 Bacteria 58331
94 Ga0105247_10030623 3300009101 Bacteria 3261
95 Ga0105243_10880195 3300009148 Bacteria 889
96 Ga0105241_10036682 3300009174 Bacteria 3690
97 Ga0105242_10007582 3300009176 Bacteria 8354
98 Ga0105248_10305873 3300009177 Bacteria 1790
99 Ga0105237_10171914 3300009545 Bacteria 2167
100 Ga0105237_10358582 3300009545 Bacteria 1462
101 Ga0105237_10465322 3300009545 Unclassified 1270
102 Ga0105237_10504000 3300009545 Bacteria 1217
103 Ga0105238_10105721 3300009551 Bacteria 2796
104 Ga0105238_10457311 3300009551 Bacteria 1274
105 Ga0105249_10026581 3300009553 Bacteria 5218
106 Ga0105249_10155562 3300009553 Unclassified 2205
107 Ga0105239_10012406 3300010375 Bacteria 9487
108 Ga0105239_10569419 3300010375 Bacteria 1291
109 Ga0105246_10020049 3300011119 Bacteria 4286
110 Ga0157370_10132648 3300013104 Bacteria 2323
111 Ga0157369_10067500 3300013105 Bacteria 3845
112 Ga0157378_10042632 3300013297 Bacteria 4028
113 Ga0163162_10047882 3300013306 Bacteria 4283
114 Ga0163162_10604194 3300013306 Bacteria 1223
115 Ga0157375_10108782 3300013308 Bacteria 2867
116 Ga0163163_10011566 3300014325 Bacteria 8014
117 Ga0163163_10013220 3300014325 Bacteria 7547
118 Ga0163163_10130664 3300014325 Bacteria 2551
119 Ga0163163_10142403 3300014325 Bacteria 2440
120 Ga0157379_10032273 3300014968 Bacteria 4668
121 Ga0157379_10035300 3300014968 Bacteria 4458
122 Ga0157379_10041168 3300014968 Bacteria 4125
123 Ga0157379_10079327 3300014968 Bacteria 2940
124 Ga0157376_10208939 3300014969 Bacteria 1801
125 Ga0157376_10267239 3300014969 Bacteria 1605
126 Ga0213876_10023335 3300021384 Bacteria 3268
127 Ga0207682_10041243 3300025893 Bacteria 1883
128 Ga0207692_10038026 3300025898 Bacteria 2358
129 Ga0207642_10056663 3300025899 Unclassified 1799
130 Ga0207710_10001289 3300025900 Bacteria 12672
131 Ga0207710_10027468 3300025900 Bacteria 2464
132 Ga0207680_10011744 3300025903 Bacteria 4436
133 Ga0207685_10007395 3300025905 Bacteria 3059
134 Ga0207699_10042689 3300025906 Bacteria 2630
135 Ga0207654_10196738 3300025911 Unclassified 1325
136 Ga0207707_10012574 3300025912 Bacteria 7356
137 Ga0207707_10083881 3300025912 Bacteria 2782
138 Ga0207707_10442165 3300025912 Bacteria 1113
139 Ga0207695_10011724 3300025913 Bacteria 10587
140 Ga0207695_10016558 3300025913 Bacteria 8619
141 Ga0207695_10074857 3300025913 Bacteria 3446
142 Ga0207671_10102383 3300025914 Bacteria 2170
143 Ga0207693_10000059 3300025915 Bacteria 94053
144 Ga0207663_10039491 3300025916 Bacteria 2860
145 Ga0207663_10062873 3300025916 Bacteria 2362
146 Ga0207660_10598200 3300025917 Bacteria 898
147 Ga0207662_10013807 3300025918 Bacteria 4521
148 Ga0207652_10036958 3300025921 Bacteria 4131
149 Ga0207694_10180259 3300025924 Unclassified 1713
150 Ga0207659_10459877 3300025926 Bacteria 1073
151 Ga0207700_10109034 3300025928 Bacteria 2224
152 Ga0207644_10033300 3300025931 Bacteria 3599
153 Ga0207686_10095001 3300025934 Bacteria 1977
154 Ga0207670_10008834 3300025936 Bacteria 5711
155 Ga0207704_10014447 3300025938 Bacteria 3986
156 Ga0207704_10073918 3300025938 Bacteria 2173
157 Ga0207704_10290123 3300025938 Bacteria 1248
158 Ga0207665_10001746 3300025939 Bacteria 14583
159 Ga0207691_10082506 3300025940 Bacteria 2887
160 Ga0207711_10210129 3300025941 Bacteria 1778
161 Ga0207661_10084064 3300025944 Bacteria 2635
162 Ga0207679_10292261 3300025945 Bacteria 1401
163 Ga0207667_10001105 3300025949 Bacteria 34029
164 Ga0207712_10167215 3300025961 Unclassified 1715
165 Ga0207640_10077792 3300025981 Bacteria 2256
166 Ga0207640_10405429 3300025981 Bacteria 1111
167 Ga0207658_10279963 3300025986 Bacteria 1429
168 Ga0207677_10348562 3300026023 Bacteria 1240
169 Ga0207703_10000452 3300026035 Bacteria 43202
170 Ga0207703_10002390 3300026035 Bacteria 16318
171 Ga0207703_10054075 3300026035 Bacteria 3264
172 Ga0207678_10050276 3300026067 Bacteria 3602
173 Ga0207708_10059280 3300026075 Bacteria 2922
174 Ga0207702_10095234 3300026078 Bacteria 2615
175 Ga0207702_10343785 3300026078 Bacteria 1426
176 Ga0207641_10001095 3300026088 Bacteria 27240
177 Ga0207641_10017657 3300026088 Bacteria 5843
178 Ga0207641_10169922 3300026088 Bacteria 1989
179 Ga0207648_10153855 3300026089 Bacteria 2030
180 Ga0207674_10088122 3300026116 Bacteria 3097
181 Ga0207675_100007679 3300026118 Bacteria 10175
182 Ga0207675_100031025 3300026118 Bacteria 4977
183 Ga0207675_100122499 3300026118 Bacteria 2461
184 Ga0207698_10261734 3300026142 Bacteria 1589
185 Ga0268266_10001369 3300028379 Bacteria 29399
186 Ga0268266_10002522 3300028379 Bacteria 19488
187 Ga0268266_10004566 3300028379 Bacteria 13232
188 Ga0268266_10155776 3300028379 Bacteria 2063
189 Ga0268266_10162339 3300028379 Bacteria 2022
190 Ga0268265_10010426 3300028380 Bacteria 6275
191 Ga0268265_10753370 3300028380 Bacteria 945
192 Ga0268264_10000057 3300028381 Bacteria 309824
193 Ga0268264_10000165 3300028381 Bacteria 147648
194 Ga0268264_10000348 3300028381 Bacteria 70273
195 Ga0268264_10041691 3300028381 Bacteria 3798
196 Ga0268264_10171366 3300028381 Bacteria 1963
197 Ga0265334_10015123 3300028573 Bacteria 3210
198 Ga0307515_10001344 3300028794 Bacteria 55675
199 Ga0307511_10001972 3300030521 Bacteria 21547
200 Ga0307511_10030761 3300030521 Bacteria 4816
201 Ga0265330_10088550 3300031235 Bacteria 1330
202 Ga0265329_10025526 3300031242 Bacteria 1954
203 Ga0265340_10054374 3300031247 Bacteria 1931
204 Ga0265331_10013020 3300031250 Bacteria 4482
205 Ga0265331_10019060 3300031250 Bacteria 3546
206 Ga0265316_10027981 3300031344 Bacteria 4656
207 Ga0307513_10124952 3300031456 Bacteria 2531
208 Ga0307509_10000013 3300031507 Bacteria 283027
209 Ga0307509_10008745 3300031507 Bacteria 12810
210 Ga0265313_10075302 3300031595 Bacteria 1545
211 Ga0307508_10267698 3300031616 Bacteria 1303
212 Ga0265314_10000277 3300031711 Bacteria 74718
213 Ga0265342_10013490 3300031712 Bacteria 5478
214 Ga0307413_10003048 3300031824 Bacteria 6960
215 Ga0307410_10016175 3300031852 Bacteria 4442
216 Ga0307407_10035106 3300031903 Bacteria 2751
217 Ga0307411_10000920 3300032005 Bacteria 11189
218 Ga0307507_10223859 3300033179 Bacteria 1260
219 Ga0307510_10000014 3300033180 Bacteria 271607
220 Ga0307510_10004929 3300033180 Bacteria 15800
221 Ga0373926_0122990 3300035083 Unclassified 979
222 Ga0373936_0012376 3300035113 Bacteria 3245
223 Ga0373945_0078878 3300035116 Unclassified 1258
224 Ga0373954_0071857 3300035118 Unclassified 1645
225 Ga0373946_0037867 3300035171 Bacteria 1962
226 Ga0373955_0047258 3300035172 Bacteria 2330
227 Ga0373925_0087478 3300037068 Bacteria 2378
228 Ga0436365_0938297 3300039437 Bacteria 6773
229 Ga0436363_1696573 3300039450 Bacteria 1624
230 Ga0439448_0042358 3300042005 Bacteria 1476
231 Ga0451577_0042274 3300042876 Bacteria 4088
232 Ga0466969_0007890 3300044656 Bacteria 5651
233 Ga0466972_0084942 3300044658 Unclassified 1505
234 Ga0453683_0015764 3300044673 Bacteria 4888
235 Ga0466966_0178527 3300044684 Bacteria 1289
236 Ga0466966_0194649 3300044684 Unclassified 1228
237 Ga0466961_0192194 3300044693 Bacteria 1265
238 Ga0453684_0002721 3300044712 Bacteria 41886
239 Ga0453684_0087679 3300044712 Bacteria 3856
240 Ga0466971_0002149 3300044719 Bacteria 8336
241 Ga0466970_0024743 3300044765 Bacteria 3140
242 Ga0466959_0202828 3300045049 Bacteria 1380
243 Ga0451576_0001016 3300045051 Bacteria 51882
244 Ga0451576_0001173 3300045051 Bacteria 46949
245 Ga0451576_0026399 3300045051 Bacteria 6248
246 Ga0451576_0095644 3300045051 Bacteria 3090
247 Ga0451576_0558316 3300045051 Bacteria 1203
248 Ga0495580_0169146 3300046472 Unclassified 1511
249 Ga0495606_0134352 3300046507 Bacteria 1467
250 Ga0495628_0179880 3300046516 Unclassified 1600
251 Ga0495630_0043030 3300046517 Bacteria 3373
252 Ga0495625_0063122 3300046660 Bacteria 2617
253 Ga0495599_0048657 3300046678 Bacteria 2658
254 Ga0495671_0002091 3300046692 Bacteria 12790
255 Ga0495674_0312819 3300047319 Unclassified 1281
256 Ga0495687_048707 3300047443 Bacteria 1816
257 Ga0496100_0039894 3300048903 Bacteria 2983
258 Ga0496100_0390373 3300048903 Bacteria 1058
259 Ga0496101_0006421 3300048904 Bacteria 7564
260 Ga0496102_0002578 3300048905 Bacteria 15455
261 Ga0496102_0053432 3300048905 Bacteria 3682
262 Ga0496102_0248592 3300048905 Bacteria 1676
263 Ga0496103_0017783 3300048906 Bacteria 4259
264 Ga0496103_0044658 3300048906 Bacteria 2731
265 Ga0496103_0053349 3300048906 Bacteria 2506
266 Ga0496105_0058225 3300048908 Bacteria 3189
267 Ga0496106_0032584 3300048909 Bacteria 3886
268 Ga0496106_0537090 3300048909 Bacteria 939
269 Ga0496107_0256260 3300048910 Bacteria 1302
270 Ga0496111_0025898 3300048914 Bacteria 4138
271 Ga0496112_0041805 3300048915 Bacteria 4485
272 Ga0496113_0086411 3300048916 Bacteria 2410
273 Ga0496114_0052110 3300048917 Bacteria 3408
274 Ga0496114_0220095 3300048917 Bacteria 1666
275 Ga0496114_0285455 3300048917 Bacteria 1456
276 Ga0496115_0078161 3300048918 Bacteria 2692
277 Ga0496117_0000228 3300048920 Bacteria 106070
278 Ga0496118_0000005 3300048921 Bacteria 697350
279 Ga0496119_0012059 3300048922 Bacteria 7064
280 Ga0496119_0040996 3300048922 Bacteria 2954
281 Ga0496120_0000400 3300048923 Bacteria 69985
282 Ga0496120_0011296 3300048923 Bacteria 6150
283 Ga0496121_0000522 3300048924 Bacteria 73298
284 Ga0496121_0012127 3300048924 Bacteria 9461
285 Ga0496121_0048500 3300048924 Bacteria 3612
286 Ga0496124_0027173 3300048927 Bacteria 5142
287 Ga0496125_0001232 3300048928 Bacteria 38287
288 Ga0496125_0026567 3300048928 Bacteria 5271
289 Ga0496125_0150638 3300048928 Bacteria 1598
290 Ga0496126_0022188 3300048929 Bacteria 6182
291 Ga0496126_0088400 3300048929 Bacteria 2729
292 Ga0496126_0142609 3300048929 Bacteria 2060
293 Ga0496126_0162125 3300048929 Bacteria 1910
294 Ga0501038_0447079 3300049574 Bacteria 994
295 Ga0501042_0180453 3300049578 Bacteria 1523
296 Ga0501073_0331265 3300049589 Unclassified 1051
297 Ga0501074_0261282 3300049590 Bacteria 1231
298 Ga0501077_0403556 3300049593 Bacteria 874
299 Ga0500583_0011266 3300053092 Bacteria 3361
300 Ga0500641_0046873 3300053096 Bacteria 1766
301 Ga0500556_0000152 3300053104 Bacteria 57878
302 Ga0500591_021260 3300053115 Bacteria 3146
303 Ga0500642_0087954 3300053130 Bacteria 1434
304 Ga0500658_0048917 3300053134 Bacteria 1721
305 Ga0500622_0006483 3300053156 Bacteria 6774
306 Ga0500637_0003453 3300053178 Bacteria 7303
307 Ga0500637_0045340 3300053178 Bacteria 2493
308 Ga0500625_028605 3300053729 Bacteria 2645
309 Ga0466962_0002674 3300061719 Bacteria 8481
310 Ga0265338_10143700
311 JGI25406J46586_10004971
312 rootL2_10216200
313 Ga0070683_100316237
314 Ga0070690_100068905
315 Ga0070670_100282049
316 Ga0070677_10128642
317 Ga0068869_100092139
318 Ga0070680_100006635
319 Ga0070680_100008785
320 Ga0068868_100175227
321 Ga0070689_100188058
322 Ga0070691_10111678
323 Ga0070675_100455981
324 Ga0070671_100000281
325 Ga0070671_100028032
326 Ga0070673_100117131
327 Ga0070688_100131322
328 Ga0070667_100007695
329 Ga0070667_100189825
330 Ga0070667_100420364
331 Ga0070709_10012711
332 Ga0070709_10047342
333 Ga0070714_100062368
334 Ga0070713_100005802
335 Ga0070710_10013504
336 Ga0070701_10020951
337 Ga0070701_10024627
338 Ga0070711_100055809
339 Ga0070711_100139151
340 Ga0070705_100024723
341 Ga0070700_100147008
342 Ga0070694_100040091
343 Ga0070694_100060103
344 Ga0070681_10004635
345 Ga0070681_10116634
346 Ga0070679_100007866
347 Ga0070679_100088414
348 Ga0070679_100098382
349 Ga0070684_100061171
350 Ga0070672_100330690
351 Ga0070686_100071741
352 Ga0070686_100100890
353 Ga0070696_100070611
354 Ga0070665_100007335
355 Ga0070665_100011391
356 Ga0070665_100021946
357 Ga0070665_100247624
358 Ga0068855_100003497
359 Ga0070664_100032685
360 Ga0070664_100831569
361 Ga0068854_100217198
362 Ga0068856_100012817
363 Ga0068856_100267150
364 Ga0070702_100008777
365 Ga0068852_100355317
366 Ga0068859_100000678
367 Ga0068859_100650831
368 Ga0068864_100099871
369 Ga0068866_10108569
370 Ga0068866_10358338
371 Ga0068861_100005744
372 Ga0068861_100045714
373 Ga0068861_100145571
374 Ga0068870_10066883
375 Ga0068863_100003345
376 Ga0068863_100006949
377 Ga0068863_100017122
378 Ga0068858_100000687
379 Ga0068858_100000883
380 Ga0068858_100056211
381 Ga0068860_100000219
382 Ga0068860_100047333
383 Ga0068860_100047810
384 Ga0068860_100108665
385 Ga0068862_100012101
386 Ga0081455_10002524
387 Ga0081539_10000004
388 Ga0070712_100001209
389 Ga0097621_100035663
390 Ga0097621_100206985
391 Ga0097621_100303087
392 Ga0068871_100075931
393 Ga0068871_100250636
394 Ga0068865_100012852
395 Ga0097620_100000678
396 Ga0097620_100650933
397 Ga0105240_10001356
398 Ga0105240_10015285
399 Ga0105240_10031348
400 Ga0105240_10189583
401 Ga0105245_10001541
402 Ga0105247_10000203
403 Ga0105247_10030623
404 Ga0105243_10880195
405 Ga0105241_10036682
406 Ga0105242_10007582
407 Ga0105248_10305873
408 Ga0105237_10171914
409 Ga0105237_10358582
410 Ga0105237_10465322
411 Ga0105237_10504000
412 Ga0105238_10105721
413 Ga0105238_10457311
414 Ga0105249_10026581
415 Ga0105249_10155562
416 Ga0105239_10012406
417 Ga0105239_10569419
418 Ga0105246_10020049
419 Ga0157370_10132648
420 Ga0157369_10067500
421 Ga0157378_10042632
422 Ga0163162_10047882
423 Ga0163162_10604194
424 Ga0157375_10108782
425 Ga0163163_10011566
426 Ga0163163_10013220
427 Ga0163163_10130664
428 Ga0163163_10142403
429 Ga0157379_10032273
430 Ga0157379_10035300
431 Ga0157379_10041168
432 Ga0157379_10079327
433 Ga0157376_10208939
434 Ga0157376_10267239
435 Ga0213876_10023335
436 Ga0207682_10041243
437 Ga0207692_10038026
438 Ga0207642_10056663
439 Ga0207710_10001289
440 Ga0207710_10027468
441 Ga0207680_10011744
442 Ga0207685_10007395
443 Ga0207699_10042689
444 Ga0207654_10196738
445 Ga0207707_10012574
446 Ga0207707_10083881
447 Ga0207707_10442165
448 Ga0207695_10011724
449 Ga0207695_10016558
450 Ga0207695_10074857
451 Ga0207671_10102383
452 Ga0207693_10000059
453 Ga0207663_10039491
454 Ga0207663_10062873
455 Ga0207660_10598200
456 Ga0207662_10013807
457 Ga0207652_10036958
458 Ga0207694_10180259
459 Ga0207659_10459877
460 Ga0207700_10109034
461 Ga0207644_10033300
462 Ga0207686_10095001
463 Ga0207670_10008834
464 Ga0207704_10014447
465 Ga0207704_10073918
466 Ga0207704_10290123
467 Ga0207665_10001746
468 Ga0207691_10082506
469 Ga0207711_10210129
470 Ga0207661_10084064
471 Ga0207679_10292261
472 Ga0207667_10001105
473 Ga0207712_10167215
474 Ga0207640_10077792
475 Ga0207640_10405429
476 Ga0207658_10279963
477 Ga0207677_10348562
478 Ga0207703_10000452
479 Ga0207703_10002390
480 Ga0207703_10054075
481 Ga0207678_10050276
482 Ga0207708_10059280
483 Ga0207702_10095234
484 Ga0207702_10343785
485 Ga0207641_10001095
486 Ga0207641_10017657
487 Ga0207641_10169922
488 Ga0207648_10153855
489 Ga0207674_10088122
490 Ga0207675_100007679
491 Ga0207675_100031025
492 Ga0207675_100122499
493 Ga0207698_10261734
494 Ga0268266_10001369
495 Ga0268266_10002522
496 Ga0268266_10004566
497 Ga0268266_10155776
498 Ga0268266_10162339
499 Ga0268265_10010426
500 Ga0268265_10753370
501 Ga0268264_10000057
502 Ga0268264_10000165
503 Ga0268264_10000348
504 Ga0268264_10041691
505 Ga0268264_10171366
506 Ga0265334_10015123
507 Ga0307515_10001344
508 Ga0307511_10001972
509 Ga0307511_10030761
510 Ga0265330_10088550
511 Ga0265329_10025526
512 Ga0265340_10054374
513 Ga0265331_10013020
514 Ga0265331_10019060
515 Ga0265316_10027981
516 Ga0307513_10124952
517 Ga0307509_10000013
518 Ga0307509_10008745
519 Ga0265313_10075302
520 Ga0307508_10267698
521 Ga0265314_10000277
522 Ga0265342_10013490
523 Ga0307413_10003048
524 Ga0307410_10016175
525 Ga0307407_10035106
526 Ga0307411_10000920
527 Ga0307507_10223859
528 Ga0307510_10000014
529 Ga0307510_10004929
530 Ga0373926_0122990
531 Ga0373936_0012376
532 Ga0373945_0078878
533 Ga0373954_0071857
534 Ga0373946_0037867
535 Ga0373955_0047258
536 Ga0373925_0087478
537 Ga0436365_0938297
538 Ga0436363_1696573
539 Ga0439448_0042358
540 Ga0451577_0042274
541 Ga0466969_0007890
542 Ga0466972_0084942
543 Ga0453683_0015764
544 Ga0466966_0178527
545 Ga0466966_0194649
546 Ga0466961_0192194
547 Ga0453684_0002721
548 Ga0453684_0087679
549 Ga0466971_0002149
550 Ga0466970_0024743
551 Ga0466959_0202828
552 Ga0451576_0001016
553 Ga0451576_0001173
554 Ga0451576_0026399
555 Ga0451576_0095644
556 Ga0451576_0558316
557 Ga0495580_0169146
558 Ga0495606_0134352
559 Ga0495628_0179880
560 Ga0495630_0043030
561 Ga0495625_0063122
562 Ga0495599_0048657
563 Ga0495671_0002091
564 Ga0495674_0312819
565 Ga0495687_048707
566 Ga0496100_0039894
567 Ga0496100_0390373
568 Ga0496101_0006421
569 Ga0496102_0002578
570 Ga0496102_0053432
571 Ga0496102_0248592
572 Ga0496103_0017783
573 Ga0496103_0044658
574 Ga0496103_0053349
575 Ga0496105_0058225
576 Ga0496106_0032584
577 Ga0496106_0537090
578 Ga0496107_0256260
579 Ga0496111_0025898
580 Ga0496112_0041805
581 Ga0496113_0086411
582 Ga0496114_0052110
583 Ga0496114_0220095
584 Ga0496114_0285455
585 Ga0496115_0078161
586 Ga0496117_0000228
587 Ga0496118_0000005
588 Ga0496119_0012059
589 Ga0496119_0040996
590 Ga0496120_0000400
591 Ga0496120_0011296
592 Ga0496121_0000522
593 Ga0496121_0012127
594 Ga0496121_0048500
595 Ga0496124_0027173
596 Ga0496125_0001232
597 Ga0496125_0026567
598 Ga0496125_0150638
599 Ga0496126_0022188
600 Ga0496126_0088400
601 Ga0496126_0142609
602 Ga0496126_0162125
603 Ga0501038_0447079
604 Ga0501042_0180453
605 Ga0501073_0331265
606 Ga0501074_0261282
607 Ga0501077_0403556
608 Ga0500583_0011266
609 Ga0500641_0046873
610 Ga0500556_0000152
611 Ga0500591_021260
612 Ga0500642_0087954
613 Ga0500658_0048917
614 Ga0500622_0006483
615 Ga0500637_0003453
616 Ga0500637_0045340
617 Ga0500625_028605
618 Ga0466962_0002674

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10108

DNA_pol_B_exo2

Predicted 3'-5' exonuclease related to the exonuclease domain of PolB

47

256

0.99

PF13482

RNase_H_2

RNase_H superfamily

48

219

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhb-assembly1.cif.gz_A crystal structure of dna polymerase from thermococcus gorgonarius in complex with hypoxanthine-containing dna 0.6863 1 216
4ahc-assembly1.cif.gz_A crystal structure of an evolved replicating dna polymerase 0.6824 1 216
7b0f-assembly1.cif.gz_A tgot_6g12 binary complex 0.6785 1 216
7b0g-assembly1.cif.gz_A tgot_6g12 binary with 2 hctps 0.6785 1 216
3a2f-assembly1.cif.gz_A crystal structure of pyrococcus furiosus dna polymerase/pcna monomer mutant complex 0.6732 1 216
ID Description Score Start End Superfamily
af_Q57811_1_166_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7339 1 210 3.30.420.10
af_Q57811_1_166_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7263 1 210 3.30.420.10
5h12A02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6724 1 225 3.30.420.10
2rldA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.6345 183 256 1.20.1440.60
2gv9A03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6256 3 216 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A080LVY7-F1-model_v4 Putative 3'-5' exonuclease related to the exonuclease domain of PolB 0.9835 181 254 GO:0004527
AF-A0A6S6SDV9-F1-model_v4 Polysaccharide biosynthesis protein WlaX 0.9778 1 122 GO:0003676
AF-A0A536S471-F1-model_v4 3'-5' exonuclease 0.9747 175 254 GO:0004527
AF-A0A356IM12-F1-model_v4 3'-5' exonuclease 0.9738 179 256 GO:0004527
AF-A0A3D2V3T9-F1-model_v4 3'-5' exonuclease 0.9682 170 254 GO:0004527

Map