F400270

General Info

Members Datasets Scaffolds Average Seq Length
309 162 618 388

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10046704|Ga0207428_100467044
Length 427
Sequence LVKNGYRTIGNRQSAIYLGDDLNKEYVVDVERLLPGGLGLAHEAGKTIFVSLAAPGDRVRVAVDREQGNILFASISEILTPSPMRIEPPCPYFGSCGGCDFQQLNYEAQLAAKSEIIRDCLRRIAGLQNVPEVSVQPSAEWRYRGRAVWQFDQETKSIGYYERGSRRVCDVVDCAVLAPGLQQTLEQIRRTPKDLIPSDLRHLQAVTADNGVSVSPQFAEFRTSELQLKVGDENYTFNAEAFFQINQELLGPLLDFALKDARGETAVDLYCGVGLFTVPLARSFKQVFGVESNPVATRFARRNASRAGLDHARIITATVSDWITNATLGDGRCDFVLLDPPRAGAESAVIKGILKLEPSQISYVSCDPATLARDLKKLITGGYEMNSIAAFDLFPQTHHVETVVRLSRAAVKSVPLFDTTGEEQKVA

Samples

Sample ID Description Type Environment
1 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
141 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
144 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
145 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
146 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
147 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
148 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
149 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
150 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
151 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
152 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
153 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
154 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.97
Rhizosphere 99.03
Stem 0
Stem Tuber 0
Unclassified 19.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207428_10046704 3300027907 Bacteria 3481
2 JGI24751J29686_10000008 3300002459 Bacteria 128004
3 JGI24751J29686_10000029 3300002459 Bacteria 93445
4 JGI25406J46586_10008616 3300003203 Unclassified 4607
5 Ga0065714_10002184 3300005288 Bacteria 284511
6 Ga0065704_10132843 3300005289 Bacteria 1607
7 Ga0065712_10000112 3300005290 Bacteria 340011
8 Ga0065712_10069714 3300005290 Bacteria 6821
9 Ga0065715_10089191 3300005293 Bacteria 12857
10 Ga0065715_10102792 3300005293 Bacteria 3084
11 Ga0065707_10124013 3300005295 Bacteria 2053
12 Ga0070690_100009129 3300005330 Bacteria 5737
13 Ga0070670_100003370 3300005331 Bacteria 13235
14 Ga0070670_100047607 3300005331 Bacteria 3690
15 Ga0068869_100060743 3300005334 Bacteria 2771
16 Ga0068869_100213307 3300005334 Bacteria 1527
17 Ga0070680_100000620 3300005336 Bacteria 24634
18 Ga0070689_100000248 3300005340 Bacteria 31524
19 Ga0070687_100005226 3300005343 Bacteria 5243
20 Ga0070661_100028852 3300005344 Bacteria 4004
21 Ga0070692_10019891 3300005345 Bacteria 3246
22 Ga0070692_10052554 3300005345 Bacteria 2123
23 Ga0070671_100057339 3300005355 Bacteria 3241
24 Ga0070673_100058497 3300005364 Bacteria 3048
25 Ga0070688_100055868 3300005365 Bacteria 2477
26 Ga0070659_100061097 3300005366 Bacteria 2977
27 Ga0070659_100078376 3300005366 Bacteria 2636
28 Ga0070703_10015939 3300005406 Bacteria 2154
29 Ga0070705_100167058 3300005440 Bacteria 1477
30 Ga0070700_100000043 3300005441 Bacteria 98943
31 Ga0070700_100017425 3300005441 Bacteria 4108
32 Ga0070700_100026264 3300005441 Bacteria 3437
33 Ga0070700_100048665 3300005441 Unclassified 2628
34 Ga0070700_100064459 3300005441 Bacteria 2321
35 Ga0070700_100089091 3300005441 Bacteria 2010
36 Ga0070694_100018176 3300005444 Unclassified 4459
37 Ga0070694_100089108 3300005444 Bacteria 2161
38 Ga0070694_100111032 3300005444 Bacteria 1953
39 Ga0070678_100042034 3300005456 Bacteria 3246
40 Ga0070681_10006220 3300005458 Bacteria 11602
41 Ga0070681_10124656 3300005458 Bacteria 2509
42 Ga0070681_10416527 3300005458 Bacteria 1255
43 Ga0068867_100009961 3300005459 Bacteria 6698
44 Ga0070706_100000358 3300005467 Bacteria 55073
45 Ga0070706_100021301 3300005467 Bacteria 5971
46 Ga0070706_100158253 3300005467 Unclassified 2115
47 Ga0070707_100011874 3300005468 Bacteria 8131
48 Ga0070698_100029506 3300005471 Bacteria 5694
49 Ga0070698_100301696 3300005471 Unclassified 1532
50 Ga0070699_100003442 3300005518 Bacteria 13994
51 Ga0070679_100002229 3300005530 Bacteria 17503
52 Ga0070679_100035353 3300005530 Bacteria 4957
53 Ga0070679_100173284 3300005530 Bacteria 2130
54 Ga0070697_100026996 3300005536 Bacteria 4592
55 Ga0068853_100066487 3300005539 Unclassified 3131
56 Ga0070686_100008904 3300005544 Bacteria 5627
57 Ga0070695_100039447 3300005545 Unclassified 2985
58 Ga0070695_100130120 3300005545 Unclassified 1734
59 Ga0070695_100147449 3300005545 Unclassified 1638
60 Ga0070696_100042850 3300005546 Bacteria 3129
61 Ga0070696_100052995 3300005546 Unclassified 2823
62 Ga0070696_100116023 3300005546 Bacteria 1933
63 Ga0070696_100132680 3300005546 Unclassified 1814
64 Ga0070693_100010786 3300005547 Unclassified 4585
65 Ga0070693_100044229 3300005547 Bacteria 2518
66 Ga0070693_100060711 3300005547 Bacteria 2195
67 Ga0070665_100297804 3300005548 Bacteria 1615
68 Ga0070704_100011999 3300005549 Bacteria 5339
69 Ga0070704_100017029 3300005549 Bacteria 4610
70 Ga0070704_100189402 3300005549 Bacteria 1652
71 Ga0068855_100142745 3300005563 Bacteria 2728
72 Ga0070664_100182836 3300005564 Bacteria 1864
73 Ga0068857_100035457 3300005577 Bacteria 4418
74 Ga0068857_100240935 3300005577 Unclassified 1656
75 Ga0068857_100259846 3300005577 Bacteria 1593
76 Ga0068856_100109762 3300005614 Bacteria 2755
77 Ga0070702_100148668 3300005615 Bacteria 1501
78 Ga0068852_100141803 3300005616 Bacteria 2225
79 Ga0068859_100012022 3300005617 Bacteria 8696
80 Ga0068859_100015938 3300005617 Bacteria 7555
81 Ga0068859_100021503 3300005617 Bacteria 6475
82 Ga0068859_100090972 3300005617 Unclassified 3102
83 Ga0068859_100108165 3300005617 Unclassified 2842
84 Ga0068859_100155556 3300005617 Bacteria 2363
85 Ga0068859_100207655 3300005617 Unclassified 2044
86 Ga0068859_100226053 3300005617 Unclassified 1960
87 Ga0068859_100286056 3300005617 Bacteria 1741
88 Ga0068864_100002709 3300005618 Bacteria 14588
89 Ga0068864_100142374 3300005618 Bacteria 2164
90 Ga0068864_100250747 3300005618 Bacteria 1643
91 Ga0068866_10009943 3300005718 Unclassified 4060
92 Ga0068866_10031680 3300005718 Bacteria 2549
93 Ga0068861_100005517 3300005719 Bacteria 8569
94 Ga0068861_100092399 3300005719 Bacteria 2390
95 Ga0068861_100155783 3300005719 Unclassified 1879
96 Ga0068851_10001847 3300005834 Bacteria 9281
97 Ga0068851_10067777 3300005834 Bacteria 1841
98 Ga0068870_10004455 3300005840 Bacteria 6029
99 Ga0068870_10027330 3300005840 Unclassified 2852
100 Ga0068863_100015886 3300005841 Bacteria 7221
101 Ga0068863_100088579 3300005841 Bacteria 2933
102 Ga0068863_100091327 3300005841 Unclassified 2888
103 Ga0068863_100105889 3300005841 Bacteria 2675
104 Ga0068863_100153164 3300005841 Bacteria 2206
105 Ga0068858_100015084 3300005842 Bacteria 7267
106 Ga0068858_100053092 3300005842 Unclassified 3750
107 Ga0068860_100018076 3300005843 Bacteria 6866
108 Ga0068860_100019153 3300005843 Bacteria 6646
109 Ga0068860_100026481 3300005843 Bacteria 5590
110 Ga0068860_100040987 3300005843 Unclassified 4424
111 Ga0068860_100113646 3300005843 Bacteria 2589
112 Ga0068860_100208041 3300005843 Bacteria 1897
113 Ga0068860_100324956 3300005843 Bacteria 1510
114 Ga0068862_100015587 3300005844 Bacteria 6313
115 Ga0068862_100054538 3300005844 Bacteria 3422
116 Ga0068862_100089133 3300005844 Bacteria 2684
117 Ga0081539_10000697 3300005985 Bacteria 67380
118 Ga0081539_10001077 3300005985 Bacteria 49686
119 Ga0097621_100001043 3300006237 Bacteria 19450
120 Ga0068871_100001809 3300006358 Bacteria 14434
121 Ga0068871_100022312 3300006358 Bacteria 4880
122 Ga0068871_100094983 3300006358 Bacteria 2489
123 Ga0075430_100019107 3300006846 Bacteria 5828
124 Ga0075430_100087423 3300006846 Bacteria 2608
125 Ga0075431_100179302 3300006847 Bacteria 2174
126 Ga0075433_10027534 3300006852 Bacteria 4823
127 Ga0075433_10085542 3300006852 Bacteria 2784
128 Ga0075434_100100475 3300006871 Bacteria 2898
129 Ga0075434_100178000 3300006871 Bacteria 2146
130 Ga0075434_100208216 3300006871 Bacteria 1976
131 Ga0075434_100359738 3300006871 Bacteria 1476
132 Ga0068865_100055221 3300006881 Unclassified 2762
133 Ga0075436_100021709 3300006914 Unclassified 4405
134 Ga0097620_100012021 3300006931 Bacteria 8696
135 Ga0097620_100015938 3300006931 Bacteria 7555
136 Ga0097620_100021503 3300006931 Bacteria 6475
137 Ga0097620_100090965 3300006931 Unclassified 3102
138 Ga0097620_100108170 3300006931 Unclassified 2842
139 Ga0097620_100155552 3300006931 Bacteria 2363
140 Ga0097620_100207668 3300006931 Unclassified 2044
141 Ga0097620_100226054 3300006931 Unclassified 1960
142 Ga0097620_100286067 3300006931 Bacteria 1741
143 Ga0105240_10060700 3300009093 Unclassified 4712
144 Ga0111539_10002198 3300009094 Bacteria 26049
145 Ga0111539_10015049 3300009094 Bacteria 9641
146 Ga0111539_10106475 3300009094 Bacteria 3290
147 Ga0111539_10383445 3300009094 Bacteria 1637
148 Ga0105247_10001639 3300009101 Bacteria 15826
149 Ga0105247_10021535 3300009101 Bacteria 3879
150 Ga0114129_10022365 3300009147 Bacteria 8976
151 Ga0114129_10042019 3300009147 Bacteria 6437
152 Ga0114129_10048287 3300009147 Bacteria 5981
153 Ga0105243_10007819 3300009148 Bacteria 8220
154 Ga0105243_10033083 3300009148 Unclassified 3996
155 Ga0105241_10024789 3300009174 Unclassified 4456
156 Ga0105241_10150376 3300009174 Bacteria 1904
157 Ga0105242_10075782 3300009176 Unclassified 2802
158 Ga0105242_10151129 3300009176 Unclassified 2024
159 Ga0105242_10154651 3300009176 Unclassified 2002
160 Ga0105248_10028740 3300009177 Bacteria 6197
161 Ga0105248_10049909 3300009177 Bacteria 4691
162 Ga0105248_10141963 3300009177 Unclassified 2709
163 Ga0105248_10152638 3300009177 Bacteria 2606
164 Ga0105248_10164236 3300009177 Bacteria 2504
165 Ga0105248_10168974 3300009177 Bacteria 2465
166 Ga0105238_10011954 3300009551 Bacteria 8746
167 Ga0105249_10027454 3300009553 Bacteria 5135
168 Ga0105249_10126806 3300009553 Bacteria 2431
169 Ga0105239_10036726 3300010375 Bacteria 5376
170 Ga0157373_10160034 3300013100 Bacteria 1584
171 Ga0157374_10023641 3300013296 Bacteria 5499
172 Ga0157378_10010499 3300013297 Bacteria 8091
173 Ga0157378_10012269 3300013297 Bacteria 7502
174 Ga0157378_10044993 3300013297 Bacteria 3921
175 Ga0157378_10095048 3300013297 Unclassified 2714
176 Ga0163162_10005168 3300013306 Bacteria 12585
177 Ga0163162_10008722 3300013306 Bacteria 9865
178 Ga0163162_10045667 3300013306 Bacteria 4388
179 Ga0157375_10006740 3300013308 Bacteria 10000
180 Ga0157375_10010025 3300013308 Bacteria 8328
181 Ga0157375_10063496 3300013308 Bacteria 3674
182 Ga0157375_10076805 3300013308 Bacteria 3368
183 Ga0157375_10483268 3300013308 Bacteria 1403
184 Ga0163163_10001896 3300014325 Bacteria 17684
185 Ga0163163_10005942 3300014325 Bacteria 10624
186 Ga0163163_10229217 3300014325 Unclassified 1907
187 Ga0157380_10013009 3300014326 Bacteria 6052
188 Ga0157380_10166561 3300014326 Bacteria 1921
189 Ga0207697_10012836 3300025315 Bacteria 3503
190 Ga0207656_10007617 3300025321 Bacteria 3953
191 Ga0207653_10003950 3300025885 Bacteria 4658
192 Ga0207710_10000591 3300025900 Bacteria 21390
193 Ga0207647_10009810 3300025904 Bacteria 6787
194 Ga0207643_10026054 3300025908 Unclassified 3235
195 Ga0207684_10000168 3300025910 Bacteria 110284
196 Ga0207654_10117332 3300025911 Bacteria 1666
197 Ga0207707_10000037 3300025912 Bacteria 144937
198 Ga0207707_10111599 3300025912 Unclassified 2390
199 Ga0207707_10248258 3300025912 Bacteria 1546
200 Ga0207660_10000155 3300025917 Bacteria 42574
201 Ga0207662_10011725 3300025918 Bacteria 4869
202 Ga0207662_10019542 3300025918 Bacteria 3857
203 Ga0207657_10079696 3300025919 Unclassified 2755
204 Ga0207649_10008641 3300025920 Bacteria 5561
205 Ga0207652_10000200 3300025921 Bacteria 63144
206 Ga0207681_10287920 3300025923 Unclassified 1296
207 Ga0207694_10017327 3300025924 Bacteria 5446
208 Ga0207650_10000087 3300025925 Bacteria 123505
209 Ga0207650_10074174 3300025925 Bacteria 2564
210 Ga0207659_10091700 3300025926 Bacteria 2270
211 Ga0207644_10061850 3300025931 Bacteria 2713
212 Ga0207644_10145276 3300025931 Bacteria 1831
213 Ga0207670_10074756 3300025936 Bacteria 2353
214 Ga0207704_10207779 3300025938 Bacteria 1438
215 Ga0207691_10003457 3300025940 Bacteria 15365
216 Ga0207691_10243562 3300025940 Bacteria 1554
217 Ga0207711_10021973 3300025941 Bacteria 5331
218 Ga0207711_10072909 3300025941 Unclassified 2983
219 Ga0207711_10235886 3300025941 Bacteria 1676
220 Ga0207711_10370673 3300025941 Bacteria 1328
221 Ga0207689_10004240 3300025942 Bacteria 13041
222 Ga0207689_10061975 3300025942 Bacteria 3076
223 Ga0207679_10098630 3300025945 Bacteria 2279
224 Ga0207651_10133058 3300025960 Bacteria 1907
225 Ga0207712_10004894 3300025961 Bacteria 8470
226 Ga0207712_10015755 3300025961 Bacteria 4882
227 Ga0207677_10057726 3300026023 Bacteria 2667
228 Ga0207677_10062130 3300026023 Unclassified 2590
229 Ga0207703_10030608 3300026035 Bacteria 4255
230 Ga0207703_10128536 3300026035 Unclassified 2185
231 Ga0207703_10197078 3300026035 Bacteria 1787
232 Ga0207703_10202808 3300026035 Bacteria 1763
233 Ga0207703_10236982 3300026035 Bacteria 1639
234 Ga0207639_10047983 3300026041 Unclassified 3230
235 Ga0207708_10000060 3300026075 Bacteria 93846
236 Ga0207708_10015289 3300026075 Bacteria 5754
237 Ga0207708_10021396 3300026075 Unclassified 4877
238 Ga0207708_10053855 3300026075 Bacteria 3066
239 Ga0207708_10075340 3300026075 Bacteria 2587
240 Ga0207708_10153591 3300026075 Bacteria 1814
241 Ga0207702_10034659 3300026078 Bacteria 4221
242 Ga0207641_10096873 3300026088 Bacteria 2592
243 Ga0207641_10179128 3300026088 Bacteria 1940
244 Ga0207641_10326366 3300026088 Unclassified 1457
245 Ga0207648_10004389 3300026089 Bacteria 14501
246 Ga0207648_10092389 3300026089 Bacteria 2646
247 Ga0207648_10095478 3300026089 Bacteria 2601
248 Ga0207676_10004117 3300026095 Bacteria 10264
249 Ga0207676_10011833 3300026095 Bacteria 6242
250 Ga0207676_10032784 3300026095 Bacteria 3918
251 Ga0207674_10000037 3300026116 Bacteria 134125
252 Ga0207674_10126989 3300026116 Bacteria 2516
253 Ga0207674_10200432 3300026116 Unclassified 1945
254 Ga0207675_100010482 3300026118 Bacteria 8682
255 Ga0207675_100014570 3300026118 Bacteria 7328
256 Ga0207683_10164324 3300026121 Bacteria 2008
257 Ga0207428_10006763 3300027907 Bacteria 10518
258 Ga0268266_10037923 3300028379 Unclassified 4104
259 Ga0268265_10214428 3300028380 Bacteria 1680
260 Ga0268264_10017852 3300028381 Bacteria 5808
261 Ga0268264_10069809 3300028381 Bacteria 2972
262 Ga0268264_10287338 3300028381 Bacteria 1543
263 Ga0307405_10004212 3300031731 Bacteria 6770
264 Ga0307405_10113381 3300031731 Unclassified 1841
265 Ga0307407_10104722 3300031903 Bacteria 1764
266 Ga0307409_100173571 3300031995 Bacteria 1900
267 Ga0307416_100360876 3300032002 Bacteria 1475
268 Ga0307414_10007353 3300032004 Bacteria 6189
269 Ga0307411_10305512 3300032005 Bacteria 1278
270 Ga0373951_0004050 3300035091 Unclassified 3507
271 Ga0373931_0176407 3300035691 Bacteria 1263
272 Ga0395899_0101196 3300037312 Unclassified 2080
273 Ga0395900_0075937 3300037418 Bacteria 3454
274 Ga0395898_0075627 3300037466 Bacteria 3253
275 Ga0242420_008767 3300038996 Unclassified 1647
276 Ga0453683_0187018 3300044673 Unclassified 1314
277 Ga0496112_0015596 3300048915 Bacteria 7097
278 Ga0496112_0082574 3300048915 Bacteria 3178
279 Ga0496112_0277822 3300048915 Bacteria 1623
280 Ga0501296_005064 3300049519 Bacteria 1458
281 Ga0501298_007756 3300049521 Unclassified 1788
282 Ga0501298_008914 3300049521 Bacteria 1696
283 Ga0501038_0004116 3300049574 Bacteria 13530
284 Ga0501202_014252 3300049652 Bacteria 1521
285 Ga0501209_045181 3300049656 Bacteria 1181
286 Ga0501216_007490 3300049660 Bacteria 1700
287 Ga0501217_003298 3300049661 Bacteria 3253
288 Ga0501217_027446 3300049661 Bacteria 1381
289 Ga0501223_012546 3300049663 Bacteria 1693
290 Ga0501224_002093 3300049664 Bacteria 2705
291 Ga0501235_014739 3300049669 Bacteria 1723
292 Ga0501239_004727 3300049672 Bacteria 1349
293 Ga0501240_002476 3300049673 Bacteria 1966
294 Ga0501243_000592 3300049675 Unclassified 4884
295 Ga0501225_0000942 3300049705 Bacteria 9076
296 Ga0501234_002169 3300049707 Bacteria 3101
297 nmdc:mga05p37_33907_c1 3300050507 Bacteria 4779
298 nmdc:mga05p37_97267_c1 3300050507 Bacteria 3626
299 nmdc:mga0qj67_275574_c1 3300050509 Bacteria 1364
300 nmdc:mga08y16_115544_c1 3300050511 Unclassified 2794
301 nmdc:mga08y16_677_c1 3300050511 Bacteria 32200
302 nmdc:mga0n895_375600_c1 3300050512 Bacteria 1439
303 nmdc:mga0n895_49333_c1 3300050512 Bacteria 4123
304 nmdc:mga0rr50_11721_c1 3300050513 Bacteria 5627
305 nmdc:mga08x19_119890_c1 3300050514 Unclassified 1763
306 nmdc:mga0a205_135115_c1 3300050515 Bacteria 2367
307 nmdc:mga0a205_266130_c1 3300050515 Unclassified 1591
308 nmdc:mga0a205_78615_c1 3300050515 Bacteria 3187
309 Ga0530510_0019564 3300061734 Unclassified 4807
310 Ga0207428_10046704
311 JGI24751J29686_10000008
312 JGI24751J29686_10000029
313 JGI25406J46586_10008616
314 Ga0065714_10002184
315 Ga0065704_10132843
316 Ga0065712_10000112
317 Ga0065712_10069714
318 Ga0065715_10089191
319 Ga0065715_10102792
320 Ga0065707_10124013
321 Ga0070690_100009129
322 Ga0070670_100003370
323 Ga0070670_100047607
324 Ga0068869_100060743
325 Ga0068869_100213307
326 Ga0070680_100000620
327 Ga0070689_100000248
328 Ga0070687_100005226
329 Ga0070661_100028852
330 Ga0070692_10019891
331 Ga0070692_10052554
332 Ga0070671_100057339
333 Ga0070673_100058497
334 Ga0070688_100055868
335 Ga0070659_100061097
336 Ga0070659_100078376
337 Ga0070703_10015939
338 Ga0070705_100167058
339 Ga0070700_100000043
340 Ga0070700_100017425
341 Ga0070700_100026264
342 Ga0070700_100048665
343 Ga0070700_100064459
344 Ga0070700_100089091
345 Ga0070694_100018176
346 Ga0070694_100089108
347 Ga0070694_100111032
348 Ga0070678_100042034
349 Ga0070681_10006220
350 Ga0070681_10124656
351 Ga0070681_10416527
352 Ga0068867_100009961
353 Ga0070706_100000358
354 Ga0070706_100021301
355 Ga0070706_100158253
356 Ga0070707_100011874
357 Ga0070698_100029506
358 Ga0070698_100301696
359 Ga0070699_100003442
360 Ga0070679_100002229
361 Ga0070679_100035353
362 Ga0070679_100173284
363 Ga0070697_100026996
364 Ga0068853_100066487
365 Ga0070686_100008904
366 Ga0070695_100039447
367 Ga0070695_100130120
368 Ga0070695_100147449
369 Ga0070696_100042850
370 Ga0070696_100052995
371 Ga0070696_100116023
372 Ga0070696_100132680
373 Ga0070693_100010786
374 Ga0070693_100044229
375 Ga0070693_100060711
376 Ga0070665_100297804
377 Ga0070704_100011999
378 Ga0070704_100017029
379 Ga0070704_100189402
380 Ga0068855_100142745
381 Ga0070664_100182836
382 Ga0068857_100035457
383 Ga0068857_100240935
384 Ga0068857_100259846
385 Ga0068856_100109762
386 Ga0070702_100148668
387 Ga0068852_100141803
388 Ga0068859_100012022
389 Ga0068859_100015938
390 Ga0068859_100021503
391 Ga0068859_100090972
392 Ga0068859_100108165
393 Ga0068859_100155556
394 Ga0068859_100207655
395 Ga0068859_100226053
396 Ga0068859_100286056
397 Ga0068864_100002709
398 Ga0068864_100142374
399 Ga0068864_100250747
400 Ga0068866_10009943
401 Ga0068866_10031680
402 Ga0068861_100005517
403 Ga0068861_100092399
404 Ga0068861_100155783
405 Ga0068851_10001847
406 Ga0068851_10067777
407 Ga0068870_10004455
408 Ga0068870_10027330
409 Ga0068863_100015886
410 Ga0068863_100088579
411 Ga0068863_100091327
412 Ga0068863_100105889
413 Ga0068863_100153164
414 Ga0068858_100015084
415 Ga0068858_100053092
416 Ga0068860_100018076
417 Ga0068860_100019153
418 Ga0068860_100026481
419 Ga0068860_100040987
420 Ga0068860_100113646
421 Ga0068860_100208041
422 Ga0068860_100324956
423 Ga0068862_100015587
424 Ga0068862_100054538
425 Ga0068862_100089133
426 Ga0081539_10000697
427 Ga0081539_10001077
428 Ga0097621_100001043
429 Ga0068871_100001809
430 Ga0068871_100022312
431 Ga0068871_100094983
432 Ga0075430_100019107
433 Ga0075430_100087423
434 Ga0075431_100179302
435 Ga0075433_10027534
436 Ga0075433_10085542
437 Ga0075434_100100475
438 Ga0075434_100178000
439 Ga0075434_100208216
440 Ga0075434_100359738
441 Ga0068865_100055221
442 Ga0075436_100021709
443 Ga0097620_100012021
444 Ga0097620_100015938
445 Ga0097620_100021503
446 Ga0097620_100090965
447 Ga0097620_100108170
448 Ga0097620_100155552
449 Ga0097620_100207668
450 Ga0097620_100226054
451 Ga0097620_100286067
452 Ga0105240_10060700
453 Ga0111539_10002198
454 Ga0111539_10015049
455 Ga0111539_10106475
456 Ga0111539_10383445
457 Ga0105247_10001639
458 Ga0105247_10021535
459 Ga0114129_10022365
460 Ga0114129_10042019
461 Ga0114129_10048287
462 Ga0105243_10007819
463 Ga0105243_10033083
464 Ga0105241_10024789
465 Ga0105241_10150376
466 Ga0105242_10075782
467 Ga0105242_10151129
468 Ga0105242_10154651
469 Ga0105248_10028740
470 Ga0105248_10049909
471 Ga0105248_10141963
472 Ga0105248_10152638
473 Ga0105248_10164236
474 Ga0105248_10168974
475 Ga0105238_10011954
476 Ga0105249_10027454
477 Ga0105249_10126806
478 Ga0105239_10036726
479 Ga0157373_10160034
480 Ga0157374_10023641
481 Ga0157378_10010499
482 Ga0157378_10012269
483 Ga0157378_10044993
484 Ga0157378_10095048
485 Ga0163162_10005168
486 Ga0163162_10008722
487 Ga0163162_10045667
488 Ga0157375_10006740
489 Ga0157375_10010025
490 Ga0157375_10063496
491 Ga0157375_10076805
492 Ga0157375_10483268
493 Ga0163163_10001896
494 Ga0163163_10005942
495 Ga0163163_10229217
496 Ga0157380_10013009
497 Ga0157380_10166561
498 Ga0207697_10012836
499 Ga0207656_10007617
500 Ga0207653_10003950
501 Ga0207710_10000591
502 Ga0207647_10009810
503 Ga0207643_10026054
504 Ga0207684_10000168
505 Ga0207654_10117332
506 Ga0207707_10000037
507 Ga0207707_10111599
508 Ga0207707_10248258
509 Ga0207660_10000155
510 Ga0207662_10011725
511 Ga0207662_10019542
512 Ga0207657_10079696
513 Ga0207649_10008641
514 Ga0207652_10000200
515 Ga0207681_10287920
516 Ga0207694_10017327
517 Ga0207650_10000087
518 Ga0207650_10074174
519 Ga0207659_10091700
520 Ga0207644_10061850
521 Ga0207644_10145276
522 Ga0207670_10074756
523 Ga0207704_10207779
524 Ga0207691_10003457
525 Ga0207691_10243562
526 Ga0207711_10021973
527 Ga0207711_10072909
528 Ga0207711_10235886
529 Ga0207711_10370673
530 Ga0207689_10004240
531 Ga0207689_10061975
532 Ga0207679_10098630
533 Ga0207651_10133058
534 Ga0207712_10004894
535 Ga0207712_10015755
536 Ga0207677_10057726
537 Ga0207677_10062130
538 Ga0207703_10030608
539 Ga0207703_10128536
540 Ga0207703_10197078
541 Ga0207703_10202808
542 Ga0207703_10236982
543 Ga0207639_10047983
544 Ga0207708_10000060
545 Ga0207708_10015289
546 Ga0207708_10021396
547 Ga0207708_10053855
548 Ga0207708_10075340
549 Ga0207708_10153591
550 Ga0207702_10034659
551 Ga0207641_10096873
552 Ga0207641_10179128
553 Ga0207641_10326366
554 Ga0207648_10004389
555 Ga0207648_10092389
556 Ga0207648_10095478
557 Ga0207676_10004117
558 Ga0207676_10011833
559 Ga0207676_10032784
560 Ga0207674_10000037
561 Ga0207674_10126989
562 Ga0207674_10200432
563 Ga0207675_100010482
564 Ga0207675_100014570
565 Ga0207683_10164324
566 Ga0207428_10006763
567 Ga0268266_10037923
568 Ga0268265_10214428
569 Ga0268264_10017852
570 Ga0268264_10069809
571 Ga0268264_10287338
572 Ga0307405_10004212
573 Ga0307405_10113381
574 Ga0307407_10104722
575 Ga0307409_100173571
576 Ga0307416_100360876
577 Ga0307414_10007353
578 Ga0307411_10305512
579 Ga0373951_0004050
580 Ga0373931_0176407
581 Ga0395899_0101196
582 Ga0395900_0075937
583 Ga0395898_0075627
584 Ga0242420_008767
585 Ga0453683_0187018
586 Ga0496112_0015596
587 Ga0496112_0082574
588 Ga0496112_0277822
589 Ga0501296_005064
590 Ga0501298_007756
591 Ga0501298_008914
592 Ga0501038_0004116
593 Ga0501202_014252
594 Ga0501209_045181
595 Ga0501216_007490
596 Ga0501217_003298
597 Ga0501217_027446
598 Ga0501223_012546
599 Ga0501224_002093
600 Ga0501235_014739
601 Ga0501239_004727
602 Ga0501240_002476
603 Ga0501243_000592
604 Ga0501225_0000942
605 Ga0501234_002169
606 nmdc:mga05p37_33907_c1
607 nmdc:mga05p37_97267_c1
608 nmdc:mga0qj67_275574_c1
609 nmdc:mga08y16_115544_c1
610 nmdc:mga08y16_677_c1
611 nmdc:mga0n895_375600_c1
612 nmdc:mga0n895_49333_c1
613 nmdc:mga0rr50_11721_c1
614 nmdc:mga08x19_119890_c1
615 nmdc:mga0a205_135115_c1
616 nmdc:mga0a205_266130_c1
617 nmdc:mga0a205_78615_c1
618 Ga0530510_0019564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05958

tRNA_U5-meth_tr

tRNA (Uracil-5-)-methyltransferase

212

409

0.87

PF09445

Methyltransf_15

RNA cap guanine-N2 methyltransferase

263

357

0.87

PF02475

Met_10

Met-10+ like-protein

255

343

0.85

PF08241

Methyltransf_11

Methyltransferase domain

267

339

0.85

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

240

377

0.83

PF05175

MTS

Methyltransferase small domain

250

355

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yvc-assembly1.cif.gz_A solution structure of the conserved protein from the gene locus mmp0076 of methanococcus maripaludis. northeast structural genomics target mrr5. 0.8985 2 54
1yez-assembly1.cif.gz_A solution structure of the conserved protein from the gene locus mm1357 of methanosarcina mazei. northeast structural genomics target mar30. 0.8779 1 54
5zq8-assembly1.cif.gz_B crystal structure of sprlmcd with u747 stemloop rna 0.8456 1 383
5zq8-assembly1.cif.gz_B crystal structure of sprlmcd with u747 stemloop rna 0.8415 1 383
3e05-assembly2.cif.gz_C crystal structure of precorrin-6y c5,15-methyltransferase from geobacter metallireducens gs-15 0.8351 229 384
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9634 243 303 3.40.50.150
af_Q58074_11_77_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9531 1 52 2.40.50.140
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9113 242 298 3.40.50.150
af_P75817_215_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9089 225 383 3.40.50.150
af_O07191_202_403_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.904 197 384 3.40.50.150
ID Description Score Start End GO Terms
AF-K1TRH9-F1-model_v4 23S rRNA (Uracil-5-)-methyltransferase RumA 0.9721 245 383 GO:0006396
GO:0008173
GO:0032259
AF-A0A350T0Y0-F1-model_v4 23S rRNA (Uracil(1939)-C(5))-methyltransferase RlmD 0.9608 256 384 GO:0070041
GO:0070475
AF-A0A2D7A0U8-F1-model_v4 Uncharacterized protein 0.9602 282 384 GO:0070041
GO:0070475
AF-A0A7X9GAQ5-F1-model_v4 23S rRNA (Uracil-5-)-methyltransferase RumA 0.9589 305 384 GO:0006396
GO:0008173
GO:0032259
AF-A0A645GT05-F1-model_v4 23S rRNA (Uracil-C(5))-methyltransferase RlmCD (EC 2.1.1.189) 0.9574 204 383 GO:0070041
GO:0070475

Map