F400217

General Info

Members Datasets Scaffolds Average Seq Length
309 143 305 225

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10880790|Ga0163162_108807901
Length 256
Sequence MRPLRHHQVAQSRLKLLPRLQTLRKGELVSLYYQDDFVTLYHGDCLTEHREWLDTDVLVTDPPYGMKIAQRSMGHSNGRMDKSLRVANAVAGDETTEARDDALEAWGKRPAIMFGTWTVDRPKGTKQRLIWHKSNTYPNLTRSPWFTTDEEIYIIGKGFCGEPERNVYITNELRSGAHGLAATTGHPTPKPVGLMERLIEKCPPGVVADPFAGSGATLVAAKNLGRKVVGVELEEKYCEIIAKRCAQDVLDIFGAA

Samples

Sample ID Description Type Environment
1 2643221649 Leifsonia sp. Root4 Isolate Unclassified
2 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
3 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
4 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
5 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
63 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
83 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
116 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
120 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
124 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 0.97
Rhizosphere 93.53
Stem 0
Stem Tuber 0
Unclassified 4.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1014361 3300000549 Bacteria 931
2 JGI24738J21930_10000254 3300002075 Viruses 14512
3 rootH2_10081884 3300003320 Unclassified 22048
4 rootH1_10039199 3300003323 Bacteria 36197
5 Ga0065714_10005394 3300005288 Bacteria 6629
6 Ga0065714_10013442 3300005288 Bacteria 1917
7 Ga0065714_10015752 3300005288 Unclassified 2493
8 Ga0065714_10023047 3300005288 Bacteria 1452
9 Ga0065714_10065238 3300005288 Viruses 11521
10 Ga0065714_10065516 3300005288 Bacteria 9633
11 Ga0065714_10065685 3300005288 Bacteria 8858
12 Ga0065714_10071940 3300005288 Viruses 3458
13 Ga0065714_10072522 3300005288 Bacteria 3352
14 Ga0065714_10077805 3300005288 Viruses 2626
15 Ga0065714_10093340 3300005288 Unclassified 1850
16 Ga0065714_10107415 3300005288 Bacteria 1532
17 Ga0065714_10123065 3300005288 Unclassified 1325
18 Ga0065712_10072010 3300005290 Viruses 4932
19 Ga0065712_10090708 3300005290 Bacteria 2399
20 Ga0065715_10092554 3300005293 Bacteria 5039
21 Ga0070691_10249789 3300005341 Bacteria 951
22 Ga0070687_100000042 3300005343 Bacteria 40760
23 Ga0070687_100000391 3300005343 Bacteria 14898
24 Ga0070671_100386826 3300005355 Bacteria 1196
25 Ga0070710_10097162 3300005437 Viruses 1747
26 Ga0070701_10041025 3300005438 Bacteria 2356
27 Ga0070700_100022696 3300005441 Bacteria 3665
28 Ga0070694_100393541 3300005444 Viruses 1083
29 Ga0070708_100206287 3300005445 Bacteria 1841
30 Ga0070698_100038673 3300005471 Bacteria 4915
31 Ga0070699_100012825 3300005518 Bacteria 7225
32 Ga0070679_100070732 3300005530 Viruses 3480
33 Ga0070686_100217734 3300005544 Viruses 1378
34 Ga0070695_100049175 3300005545 Viruses 2699
35 Ga0070665_100346500 3300005548 Bacteria 1491
36 Ga0068855_100019579 3300005563 Bacteria 8129
37 Ga0068855_100086887 3300005563 Viruses 3615
38 Ga0068855_100255069 3300005563 Unclassified 1955
39 Ga0068854_100038101 3300005578 Bacteria 3379
40 Ga0068856_100000765 3300005614 Bacteria 34897
41 Ga0068856_100014326 3300005614 Bacteria 7668
42 Ga0068856_100133905 3300005614 Unclassified 2483
43 Ga0068856_100666364 3300005614 Bacteria 1061
44 Ga0070702_100002621 3300005615 Bacteria 7835
45 Ga0068863_100004964 3300005841 Viruses 13114
46 Ga0081538_10014881 3300005981 Bacteria 6058
47 Ga0070712_100000391 3300006175 Bacteria 25006
48 Ga0070712_100365130 3300006175 Bacteria 1185
49 Ga0075362_10045202 3300006177 Bacteria 1955
50 Ga0075434_100000176 3300006871 Bacteria 41470
51 Ga0105240_10023613 3300009093 Bacteria 8124
52 Ga0105240_10086097 3300009093 Viruses 3849
53 Ga0105248_10146034 3300009177 Bacteria 2669
54 Ga0105238_10062834 3300009551 Bacteria 3714
55 Ga0105246_10000661 3300011119 Bacteria 19321
56 Ga0157373_10064089 3300013100 Bacteria 2602
57 Ga0157373_10097335 3300013100 Bacteria 2071
58 Ga0157373_10117353 3300013100 Bacteria 1870
59 Ga0157371_10013406 3300013102 Bacteria 6225
60 Ga0157371_10023616 3300013102 Bacteria 4497
61 Ga0157371_10141730 3300013102 Viruses 1712
62 Ga0157371_10146880 3300013102 Bacteria 1680
63 Ga0157371_10183956 3300013102 Bacteria 1495
64 Ga0157371_10438847 3300013102 Unclassified 959
65 Ga0157371_10490196 3300013102 Unclassified 907
66 Ga0157371_10502031 3300013102 Bacteria 896
67 Ga0157370_10002367 3300013104 Bacteria 22730
68 Ga0157370_10038253 3300013104 Viruses 4642
69 Ga0157370_10093688 3300013104 Viruses 2819
70 Ga0157370_10105923 3300013104 Bacteria 2631
71 Ga0157370_10174825 3300013104 Bacteria 1996
72 Ga0157370_10346133 3300013104 Bacteria 1370
73 Ga0157370_10456692 3300013104 Viruses 1174
74 Ga0157369_10000781 3300013105 Bacteria 41076
75 Ga0157369_10000839 3300013105 Bacteria 39271
76 Ga0157369_10001183 3300013105 Bacteria 32532
77 Ga0157369_10037860 3300013105 Bacteria 5278
78 Ga0157369_10047395 3300013105 Viruses 4667
79 Ga0157369_10051800 3300013105 Bacteria 4442
80 Ga0157369_10074457 3300013105 Bacteria 3641
81 Ga0157369_10089852 3300013105 Bacteria 3280
82 Ga0157369_10137242 3300013105 Viruses 2589
83 Ga0157369_10187053 3300013105 Bacteria 2178
84 Ga0157369_10290775 3300013105 Bacteria 1701
85 Ga0157369_10305988 3300013105 Bacteria 1653
86 Ga0157369_10525559 3300013105 Viruses 1224
87 Ga0157378_10104454 3300013297 Viruses 2590
88 Ga0163162_10006728 3300013306 Bacteria 11151
89 Ga0163162_10015023 3300013306 Viruses 7563
90 Ga0163162_10022622 3300013306 Bacteria 6196
91 Ga0163162_10032917 3300013306 Bacteria 5149
92 Ga0163162_10057951 3300013306 Viruses 3901
93 Ga0163162_10067860 3300013306 Viruses 3617
94 Ga0163162_10111413 3300013306 Bacteria 2834
95 Ga0163162_10117036 3300013306 Bacteria 2766
96 Ga0163162_10127440 3300013306 Unclassified 2653
97 Ga0163162_10237678 3300013306 Unclassified 1952
98 Ga0163162_10245784 3300013306 Viruses 1921
99 Ga0163162_10419576 3300013306 Bacteria 1470
100 Ga0163162_10552308 3300013306 Unclassified 1280
101 Ga0163162_10627109 3300013306 Bacteria 1200
102 Ga0163162_10856951 3300013306 Unclassified 1023
103 Ga0163162_10867988 3300013306 Unclassified 1017
104 Ga0163162_10880790 3300013306 Unclassified 1009
105 Ga0163162_11122201 3300013306 Unclassified 891
106 Ga0157372_10000532 3300013307 Bacteria 42143
107 Ga0157372_10042547 3300013307 Bacteria 5025
108 Ga0157375_10001381 3300013308 Bacteria 20977
109 Ga0157375_10013426 3300013308 Bacteria 7289
110 Ga0157375_10018365 3300013308 Bacteria 6341
111 Ga0157375_10025342 3300013308 Bacteria 5509
112 Ga0157375_10027598 3300013308 Bacteria 5309
113 Ga0157375_10040436 3300013308 Bacteria 4494
114 Ga0157375_10108115 3300013308 Bacteria 2875
115 Ga0157375_10132081 3300013308 Unclassified 2617
116 Ga0157375_10135819 3300013308 Viruses 2583
117 Ga0157375_10149278 3300013308 Bacteria 2471
118 Ga0157375_10153297 3300013308 Bacteria 2441
119 Ga0157375_10180911 3300013308 Bacteria 2260
120 Ga0157375_10187589 3300013308 Viruses 2222
121 Ga0157375_10232335 3300013308 Bacteria 2003
122 Ga0157375_10249601 3300013308 Unclassified 1935
123 Ga0157375_10319510 3300013308 Bacteria 1717
124 Ga0157375_10387001 3300013308 Bacteria 1565
125 Ga0157375_10425556 3300013308 Unclassified 1494
126 Ga0157375_10427947 3300013308 Viruses 1490
127 Ga0157375_10523022 3300013308 Unclassified 1349
128 Ga0157375_10708101 3300013308 Viruses 1160
129 Ga0157375_10747603 3300013308 Viruses 1129
130 Ga0157375_10861512 3300013308 Unclassified 1052
131 Ga0157375_10895121 3300013308 Bacteria 1032
132 Ga0157375_11147484 3300013308 Unclassified 910
133 Ga0157375_11560646 3300013308 Unclassified 780
134 Ga0163161_10002099 3300017792 Viruses 14433
135 Ga0163161_10003945 3300017792 Bacteria 10410
136 Ga0163161_10011900 3300017792 Viruses 6038
137 Ga0163161_10107020 3300017792 Viruses 2087
138 Ga0163161_10122044 3300017792 Bacteria 1959
139 Ga0163161_10173851 3300017792 Unclassified 1648
140 Ga0163161_10421072 3300017792 Unclassified 1074
141 Ga0207692_10080585 3300025898 Viruses 1740
142 Ga0207695_10064403 3300025913 Viruses 3774
143 Ga0207693_10003270 3300025915 Bacteria 13877
144 Ga0207662_10000102 3300025918 Bacteria 40761
145 Ga0207662_10008052 3300025918 Bacteria 5753
146 Ga0207694_10079150 3300025924 Bacteria 2577
147 Ga0207644_10038135 3300025931 Bacteria 3383
148 Ga0207711_10211312 3300025941 Unclassified 1772
149 Ga0207667_10071737 3300025949 Viruses 3600
150 Ga0207667_10438937 3300025949 Unclassified 1327
151 Ga0207667_10878185 3300025949 Unclassified 890
152 Ga0207640_10030576 3300025981 Bacteria 3318
153 Ga0207708_10037249 3300026075 Bacteria 3705
154 Ga0207702_10000738 3300026078 Bacteria 34925
155 Ga0207702_10010487 3300026078 Bacteria 7751
156 Ga0207702_10061356 3300026078 Viruses 3207
157 Ga0207702_11006189 3300026078 Bacteria 827
158 Ga0207641_10005679 3300026088 Viruses 10619
159 Ga0268266_10345597 3300028379 Bacteria 1397
160 Ga0268265_10310403 3300028380 Unclassified 1424
161 Ga0316176_1050470 3300030732 Unclassified 2242
162 Ga0314311_1010696 3300030733 Bacteria 1530
163 Ga0307408_100004996 3300031548 Bacteria 8902
164 Ga0307408_100006616 3300031548 Bacteria 7688
165 Ga0307408_100154493 3300031548 Viruses 1815
166 Ga0307408_100206756 3300031548 Bacteria 1593
167 Ga0307408_100221112 3300031548 Bacteria 1545
168 Ga0307408_100389639 3300031548 Viruses 1193
169 Ga0307408_100620631 3300031548 Unclassified 963
170 Ga0307405_10154183 3300031731 Unclassified 1619
171 Ga0307405_10157797 3300031731 Unclassified 1603
172 Ga0307405_10321398 3300031731 Bacteria 1182
173 Ga0307405_10633300 3300031731 Bacteria 877
174 Ga0307413_10009216 3300031824 Bacteria 4714
175 Ga0307413_10165514 3300031824 Bacteria 1559
176 Ga0307413_10188782 3300031824 Bacteria 1477
177 Ga0307413_10277914 3300031824 Viruses 1258
178 Ga0307413_10669174 3300031824 Bacteria 858
179 Ga0307410_10000353 3300031852 Viruses 17812
180 Ga0307406_10000064 3300031901 Bacteria 59902
181 Ga0307407_10064337 3300031903 Bacteria 2155
182 Ga0307412_10003560 3300031911 Bacteria 8647
183 Ga0307412_10004050 3300031911 Viruses 8169
184 Ga0307412_10010770 3300031911 Viruses 5276
185 Ga0307412_10038538 3300031911 Bacteria 3078
186 Ga0307412_10042539 3300031911 Bacteria 2953
187 Ga0307412_10057193 3300031911 Viruses 2602
188 Ga0307412_10061433 3300031911 Viruses 2526
189 Ga0307412_10172538 3300031911 Viruses 1618
190 Ga0307412_10203992 3300031911 Viruses 1503
191 Ga0307412_10286595 3300031911 Unclassified 1295
192 Ga0307409_100000082 3300031995 Bacteria 34285
193 Ga0307416_100204028 3300032002 Unclassified 1879
194 Ga0307416_100372117 3300032002 Bacteria 1455
195 Ga0307416_100541689 3300032002 Bacteria 1236
196 Ga0307416_101378175 3300032002 Archaea 811
197 Ga0307416_101393223 3300032002 Bacteria 807
198 Ga0307414_10063052 3300032004 Viruses 2633
199 Ga0307414_10780657 3300032004 Unclassified 870
200 Ga0307415_100013727 3300032126 Bacteria 4737
201 Ga0307510_10000413 3300033180 Bacteria 40918
202 Ga0395899_0024684 3300037312 Bacteria 4543
203 Ga0395899_0041399 3300037312 Bacteria 3442
204 Ga0395899_0085929 3300037312 Bacteria 2285
205 Ga0395899_0235851 3300037312 Bacteria 1261
206 Ga0395900_0003573 3300037418 Bacteria 16709
207 Ga0395900_0007531 3300037418 Bacteria 11243
208 Ga0395900_0045633 3300037418 Bacteria 4514
209 Ga0395900_0257856 3300037418 Bacteria 1742
210 Ga0395898_0020467 3300037466 Bacteria 6719
211 Ga0395898_0034450 3300037466 Bacteria 5046
212 Ga0395898_0076650 3300037466 Bacteria 3228
213 Ga0395898_0319411 3300037466 Bacteria 1481
214 Ga0395898_0322791 3300037466 Unclassified 1473
215 Ga0395898_0355648 3300037466 Bacteria 1396
216 Ga0395898_0569345 3300037466 Unclassified 1075
217 Ga0395901_0049680 3300038443 Bacteria 4358
218 Ga0395901_0090903 3300038443 Bacteria 3195
219 Ga0395901_0197506 3300038443 Unclassified 2109
220 Ga0395901_0407304 3300038443 Bacteria 1396
221 Ga0395901_1005893 3300038443 Unclassified 809
222 Ga0451807_0906938 3300041486 Unclassified 1753
223 Ga0451853_0093388 3300041512 Bacteria 4473
224 Ga0439442_002189 3300042002 Bacteria 3850
225 Ga0450920_000806 3300042122 Viruses 5052
226 Ga0450920_001143 3300042122 Bacteria 4350
227 Ga0466969_0054814 3300044656 Unclassified 1952
228 Ga0466961_0048557 3300044693 Bacteria 2713
229 Ga0466961_0158800 3300044693 Bacteria 1410
230 Ga0466961_0321094 3300044693 Bacteria 944
231 Ga0453684_0004128 3300044712 Bacteria 31459
232 Ga0453684_0053511 3300044712 Bacteria 5268
233 Ga0466958_0000015 3300045836 Bacteria 50629
234 Ga0495651_0051591 3300046462 Bacteria 3170
235 Ga0495653_0017461 3300046463 Bacteria 5835
236 Ga0495650_0000895 3300046471 Bacteria 35129
237 Ga0495605_0004919 3300046474 Bacteria 7814
238 Ga0495594_0000088 3300046499 Bacteria 42204
239 Ga0495608_0118753 3300046511 Bacteria 1696
240 Ga0495630_0657357 3300046517 Bacteria 802
241 Ga0495643_0037165 3300046522 Unclassified 2673
242 Ga0495640_0036309 3300046533 Viruses 3482
243 Ga0495640_0048430 3300046533 Bacteria 2937
244 Ga0495586_0012123 3300046535 Bacteria 4577
245 Ga0495586_0047434 3300046535 Bacteria 2319
246 Ga0495586_0148491 3300046535 Bacteria 1318
247 Ga0495667_0008682 3300046559 Bacteria 6897
248 Ga0495656_0007451 3300046615 Bacteria 3866
249 Ga0495668_0046760 3300046616 Unclassified 2404
250 Ga0495668_0211283 3300046616 Bacteria 1062
251 Ga0495634_0028764 3300046642 Bacteria 3854
252 Ga0495611_0260835 3300046648 Bacteria 802
253 Ga0495635_0045205 3300046663 Bacteria 3038
254 Ga0495661_0094987 3300046665 Unclassified 1689
255 Ga0495599_0004777 3300046678 Bacteria 8055
256 Ga0495658_0075313 3300046683 Unclassified 1969
257 Ga0495669_0064865 3300046684 Bacteria 1657
258 Ga0495670_0164064 3300046691 Bacteria 1168
259 Ga0495589_0065247 3300046794 Unclassified 1785
260 Ga0495660_0004403 3300046810 Bacteria 8527
261 Ga0495581_0022398 3300047315 Bacteria 3661
262 Ga0495581_0088102 3300047315 Unclassified 1800
263 Ga0495581_0285709 3300047315 Bacteria 964
264 Ga0495636_0000511 3300047318 Bacteria 14269
265 Ga0495674_0019914 3300047319 Bacteria 6220
266 Ga0495675_0002878 3300047444 Viruses 10326
267 Ga0495677_0068477 3300047445 Unclassified 1321
268 Ga0495681_0000265 3300047470 Bacteria 42302
269 Ga0495681_0042213 3300047470 Unclassified 2209
270 Ga0495684_0011398 3300047471 Bacteria 6864
271 Ga0495684_0011474 3300047471 Bacteria 6844
272 Ga0495593_0053759 3300047673 Viruses 2124
273 Ga0495593_0066327 3300047673 Viruses 1881
274 Ga0495614_0070736 3300048089 Bacteria 1504
275 Ga0495615_0008092 3300048090 Bacteria 2019
276 Ga0496100_0321178 3300048903 Viruses 1163
277 Ga0496115_0104887 3300048918 Unclassified 2320
278 Ga0496119_0195899 3300048922 Bacteria 1049
279 Ga0496120_0006001 3300048923 Bacteria 9463
280 Ga0496124_0005324 3300048927 Bacteria 14540
281 Ga0496124_0078268 3300048927 Bacteria 2725
282 Ga0496125_0054484 3300048928 Bacteria 3268
283 Ga0496126_0003754 3300048929 Bacteria 18886
284 Ga0501032_0000453 3300049569 Bacteria 33206
285 Ga0501034_0012219 3300049571 Bacteria 8878
286 Ga0501037_0000213 3300049573 Bacteria 51760
287 Ga0501038_0000083 3300049574 Bacteria 80545
288 Ga0501038_0052717 3300049574 Viruses 3506
289 Ga0501038_0191162 3300049574 Unclassified 1647
290 Ga0501039_0000068 3300049575 Bacteria 79387
291 Ga0501043_0011850 3300049579 Bacteria 6830
292 Ga0501043_0023679 3300049579 Bacteria 4816
293 Ga0501047_0001286 3300049581 Bacteria 24775
294 Ga0501070_0009578 3300049586 Bacteria 8182
295 Ga0501070_0023357 3300049586 Bacteria 5180
296 Ga0501071_0363395 3300049587 Bacteria 1102
297 Ga0501073_0149928 3300049589 Bacteria 1616
298 Ga0501221_018751 3300049704 Unclassified 1336
299 Ga0501080_0454861 3300049742 Bacteria 1147
300 Ga0501044_0000756 3300049823 Bacteria 39054
301 Ga0501044_0063771 3300049823 Viruses 3763
302 Ga0501044_0124965 3300049823 Bacteria 2570
303 nmdc:mga03683_606_c1 3300050489 Bacteria 10303
304 nmdc:mga0n895_460_c1 3300050512 Bacteria 27262
305 Ga0500658_0012183 3300053134 Viruses 3168

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1005893 Ga0395901_1005893_213_755 147
2 3300013306 Ga0163162_10867988 Ga0163162_108679882 162
3 3300005444 Ga0070694_100393541 Ga0070694_1003935412 169
4 3300005545 Ga0070695_100049175 Ga0070695_1000491753 169
5 3300005343 Ga0070687_100000042 Ga0070687_1000000424 171
6 3300005563 Ga0068855_100255069 Ga0068855_1002550696 171
7 3300025918 Ga0207662_10000102 Ga0207662_1000010260 171
8 3300025949 Ga0207667_10438937 Ga0207667_104389372 171
9 3300046499 Ga0495594_0000088 Ga0495594_0000088_37895_38533 171
10 iso_pu_bacteria 2984551494 2984555214 171
11 3300005288 Ga0065714_10123065 Ga0065714_101230651 172
12 3300013105 Ga0157369_10047395 Ga0157369_100473953 173
13 3300013105 Ga0157369_10000781 Ga0157369_1000078148 174
14 3300037418 Ga0395900_0257856 Ga0395900_0257856_398_1039 174
15 3300037466 Ga0395898_0319411 Ga0395898_0319411_711_1400 174
16 3300038443 Ga0395901_0090903 Ga0395901_0090903_1423_2064 174
17 3300005438 Ga0070701_10041025 Ga0070701_100410252 175
18 3300006177 Ga0075362_10045202 Ga0075362_100452023 175
19 3300047444 Ga0495675_0002878 Ga0495675_0002878_2768_3421 175
20 3300050489 nmdc:mga03683_606_c1 nmdc:mga03683_606_c1_5113_5769 175
21 3300005544 Ga0070686_100217734 Ga0070686_1002177343 176
22 3300013308 Ga0157375_10187589 Ga0157375_101875895 176
23 3300031995 Ga0307409_100000082 Ga0307409_10000008247 176
24 3300032002 Ga0307416_100204028 Ga0307416_1002040283 176
25 3300032126 Ga0307415_100013727 Ga0307415_1000137271 176
26 3300046535 Ga0495586_0012123 Ga0495586_0012123_2094_2753 176
27 3300046691 Ga0495670_0164064 Ga0495670_0164064_195_854 176
28 3300049574 Ga0501038_0191162 Ga0501038_0191162_620_1276 176
29 3300049581 Ga0501047_0001286 Ga0501047_0001286_11937_12593 176
30 3300049823 Ga0501044_0000756 Ga0501044_0000756_422_1078 176
31 3300049823 Ga0501044_0063771 Ga0501044_0063771_1241_1897 176
32 3300005288 Ga0065714_10072522 Ga0065714_100725224 177
33 3300005290 Ga0065712_10072010 Ga0065712_100720103 177
34 3300013100 Ga0157373_10097335 Ga0157373_100973352 177
35 3300013102 Ga0157371_10490196 Ga0157371_104901962 177
36 3300013104 Ga0157370_10174825 Ga0157370_101748252 177
37 3300013104 Ga0157370_10346133 Ga0157370_103461332 177
38 3300013105 Ga0157369_10000839 Ga0157369_100008395 177
39 3300013105 Ga0157369_10037860 Ga0157369_100378603 177
40 3300013306 Ga0163162_10057951 Ga0163162_100579514 177
41 3300013308 Ga0157375_10025342 Ga0157375_100253425 177
42 3300013308 Ga0157375_10108115 Ga0157375_101081153 177
43 3300013308 Ga0157375_10180911 Ga0157375_101809113 177
44 3300017792 Ga0163161_10011900 Ga0163161_100119009 177
45 3300031548 Ga0307408_100206756 Ga0307408_1002067563 177
46 3300031903 Ga0307407_10064337 Ga0307407_100643373 177
47 3300032004 Ga0307414_10063052 Ga0307414_100630527 177
48 3300037466 Ga0395898_0569345 Ga0395898_0569345_140_811 177
49 3300005518 Ga0070699_100012825 Ga0070699_10001282512 178
50 3300013102 Ga0157371_10146880 Ga0157371_101468803 178
51 3300013105 Ga0157369_10137242 Ga0157369_101372426 178
52 3300037312 Ga0395899_0235851 Ga0395899_0235851_446_1105 178
53 3300037418 Ga0395900_0003573 Ga0395900_0003573_11924_12583 178
54 3300037466 Ga0395898_0076650 Ga0395898_0076650_793_1452 178
55 3300037466 Ga0395898_0322791 Ga0395898_0322791_465_1169 178
56 3300046535 Ga0495586_0047434 Ga0495586_0047434_1526_2188 178
57 3300047315 Ga0495581_0285709 Ga0495581_0285709_192_854 178
58 3300047471 Ga0495684_0011474 Ga0495684_0011474_2074_2736 178
59 3300049704 Ga0501221_018751 Ga0501221_018751_298_960 178
60 iso_pu_bacteria 2643221649 2644277301 178
61 iso_pu_bacteria 2857740372 2857743285 178
62 3300005341 Ga0070691_10249789 Ga0070691_102497891 179
63 3300005614 Ga0068856_100000765 Ga0068856_10000076530 179
64 3300013104 Ga0157370_10002367 Ga0157370_1000236719 179
65 3300013105 Ga0157369_10001183 Ga0157369_1000118318 179
66 3300026078 Ga0207702_10000738 Ga0207702_1000073847 179
67 3300031548 Ga0307408_100389639 Ga0307408_1003896393 179
68 3300031852 Ga0307410_10000353 Ga0307410_1000035310 179
69 3300032002 Ga0307416_100372117 Ga0307416_1003721172 179
70 3300032002 Ga0307416_101378175 Ga0307416_1013781751 179
71 3300037418 Ga0395900_0045633 Ga0395900_0045633_1242_1901 179
72 3300037466 Ga0395898_0034450 Ga0395898_0034450_542_1219 179
73 3300038443 Ga0395901_0049680 Ga0395901_0049680_2686_3345 179
74 3300044712 Ga0453684_0053511 Ga0453684_0053511_2332_2997 179
75 3300046683 Ga0495658_0075313 Ga0495658_0075313_133_792 179
76 3300047318 Ga0495636_0000511 Ga0495636_0000511_2098_2775 179
77 3300053134 Ga0500658_0012183 Ga0500658_0012183_1421_2080 179
78 3300003323 rootH1_10039199 rootH1_1003919941 180
79 3300005288 Ga0065714_10015752 Ga0065714_100157524 180
80 3300005614 Ga0068856_100014326 Ga0068856_1000143269 180
81 3300005841 Ga0068863_100004964 Ga0068863_1000049646 180
82 3300013100 Ga0157373_10064089 Ga0157373_100640891 180
83 3300013102 Ga0157371_10141730 Ga0157371_101417303 180
84 3300013105 Ga0157369_10290775 Ga0157369_102907752 180
85 3300013306 Ga0163162_10237678 Ga0163162_102376782 180
86 3300013308 Ga0157375_10387001 Ga0157375_103870013 180
87 3300013308 Ga0157375_10708101 Ga0157375_107081012 180
88 3300026078 Ga0207702_10010487 Ga0207702_100104879 180
89 3300026088 Ga0207641_10005679 Ga0207641_100056797 180
90 3300031548 Ga0307408_100154493 Ga0307408_1001544933 180
91 3300031824 Ga0307413_10188782 Ga0307413_101887823 180
92 3300031911 Ga0307412_10010770 Ga0307412_100107705 180
93 3300031911 Ga0307412_10172538 Ga0307412_101725383 180
94 3300046535 Ga0495586_0148491 Ga0495586_0148491_220_912 180
95 3300046615 Ga0495656_0007451 Ga0495656_0007451_2917_3582 180
96 3300046616 Ga0495668_0046760 Ga0495668_0046760_1079_1741 180
97 3300046794 Ga0495589_0065247 Ga0495589_0065247_941_1603 180
98 3300046810 Ga0495660_0004403 Ga0495660_0004403_3316_3978 180
99 3300047315 Ga0495581_0022398 Ga0495581_0022398_218_910 180
100 3300047470 Ga0495681_0042213 Ga0495681_0042213_104_766 180
101 3300047673 Ga0495593_0066327 Ga0495593_0066327_1009_1680 180
102 3300048922 Ga0496119_0195899 Ga0496119_0195899_45_764 180
103 3300048923 Ga0496120_0006001 Ga0496120_0006001_3934_4653 180
104 3300048927 Ga0496124_0078268 Ga0496124_0078268_1614_2333 180
105 3300005355 Ga0070671_100386826 Ga0070671_1003868261 181
106 3300005471 Ga0070698_100038673 Ga0070698_1000386732 181
107 3300005548 Ga0070665_100346500 Ga0070665_1003465003 181
108 3300013104 Ga0157370_10105923 Ga0157370_101059235 181
109 3300013104 Ga0157370_10456692 Ga0157370_104566922 181
110 3300013306 Ga0163162_10111413 Ga0163162_101114133 181
111 3300017792 Ga0163161_10003945 Ga0163161_1000394520 181
112 3300025931 Ga0207644_10038135 Ga0207644_100381353 181
113 3300028379 Ga0268266_10345597 Ga0268266_103455973 181
114 3300031548 Ga0307408_100221112 Ga0307408_1002211122 181
115 3300031731 Ga0307405_10154183 Ga0307405_101541833 181
116 3300031824 Ga0307413_10009216 Ga0307413_1000921610 181
117 3300048090 Ga0495615_0008092 Ga0495615_0008092_620_1279 181
118 iso_pu_bacteria 2855676851 2855682474 181
119 3300005343 Ga0070687_100000391 Ga0070687_10000039122 182
120 3300005445 Ga0070708_100206287 Ga0070708_1002062873 182
121 3300005578 Ga0068854_100038101 Ga0068854_1000381014 182
122 3300013308 Ga0157375_11560646 Ga0157375_115606462 182
123 3300025918 Ga0207662_10008052 Ga0207662_100080529 182
124 3300025981 Ga0207640_10030576 Ga0207640_100305764 182
125 3300046522 Ga0495643_0037165 Ga0495643_0037165_748_1431 182
126 3300047445 Ga0495677_0068477 Ga0495677_0068477_225_908 182
127 3300005563 Ga0068855_100019579 Ga0068855_10001957916 183
128 3300006175 Ga0070712_100365130 Ga0070712_1003651302 183
129 3300013102 Ga0157371_10013406 Ga0157371_1001340612 183
130 3300013102 Ga0157371_10023616 Ga0157371_100236164 183
131 3300013105 Ga0157369_10074457 Ga0157369_100744577 183
132 3300013105 Ga0157369_10305988 Ga0157369_103059883 183
133 3300013307 Ga0157372_10000532 Ga0157372_1000053217 183
134 3300013308 Ga0157375_10249601 Ga0157375_102496012 183
135 3300025949 Ga0207667_10878185 Ga0207667_108781851 183
136 3300031548 Ga0307408_100006616 Ga0307408_1000066162 183
137 3300037312 Ga0395899_0041399 Ga0395899_0041399_1323_1997 183
138 3300037466 Ga0395898_0355648 Ga0395898_0355648_109_783 183
139 3300038443 Ga0395901_0407304 Ga0395901_0407304_109_783 183
140 3300042002 Ga0439442_002189 Ga0439442_002189_3129_3812 183
141 3300042122 Ga0450920_000806 Ga0450920_000806_1898_2581 183
142 3300044656 Ga0466969_0054814 Ga0466969_0054814_411_1112 183
143 3300044693 Ga0466961_0048557 Ga0466961_0048557_1495_2175 183
144 3300013105 Ga0157369_10089852 Ga0157369_100898522 184
145 3300013297 Ga0157378_10104454 Ga0157378_101044546 184
146 3300031911 Ga0307412_10004050 Ga0307412_1000405016 184
147 3300041486 Ga0451807_0906938 Ga0451807_0906938_483_1133 184
148 3300041512 Ga0451853_0093388 Ga0451853_0093388_1465_2115 184
149 3300046471 Ga0495650_0000895 Ga0495650_0000895_7577_8266 184
150 3300003320 rootH2_10081884 rootH2_1008188442 185
151 3300005288 Ga0065714_10013442 Ga0065714_100134422 185
152 3300005288 Ga0065714_10071940 Ga0065714_100719406 185
153 3300005290 Ga0065712_10090708 Ga0065712_100907085 185
154 3300005441 Ga0070700_100022696 Ga0070700_1000226966 185
155 3300005614 Ga0068856_100133905 Ga0068856_1001339052 185
156 3300006871 Ga0075434_100000176 Ga0075434_10000017626 185
157 3300009551 Ga0105238_10062834 Ga0105238_100628348 185
158 3300013100 Ga0157373_10117353 Ga0157373_101173533 185
159 3300013105 Ga0157369_10187053 Ga0157369_101870533 185
160 3300013306 Ga0163162_10022622 Ga0163162_1002262211 185
161 3300013306 Ga0163162_10032917 Ga0163162_100329174 185
162 3300013306 Ga0163162_11122201 Ga0163162_111222012 185
163 3300013308 Ga0157375_10132081 Ga0157375_101320812 185
164 3300013308 Ga0157375_10153297 Ga0157375_101532972 185
165 3300017792 Ga0163161_10173851 Ga0163161_101738513 185
166 3300025924 Ga0207694_10079150 Ga0207694_100791504 185
167 3300026075 Ga0207708_10037249 Ga0207708_100372496 185
168 3300026078 Ga0207702_10061356 Ga0207702_100613565 185
169 3300030732 Ga0316176_1050470 Ga0316176_10504703 185
170 3300031911 Ga0307412_10038538 Ga0307412_100385385 185
171 3300031911 Ga0307412_10042539 Ga0307412_100425394 185
172 3300033180 Ga0307510_10000413 Ga0307510_1000041333 185
173 3300046663 Ga0495635_0045205 Ga0495635_0045205_1275_1964 185
174 3300050512 nmdc:mga0n895_460_c1 nmdc:mga0n895_460_c1_10024_10698 185
175 3300009093 Ga0105240_10086097 Ga0105240_100860977 186
176 3300011119 Ga0105246_10000661 Ga0105246_100006619 186
177 3300013102 Ga0157371_10502031 Ga0157371_105020312 186
178 3300013104 Ga0157370_10093688 Ga0157370_100936882 186
179 3300013105 Ga0157369_10051800 Ga0157369_100518006 186
180 3300013105 Ga0157369_10525559 Ga0157369_105255591 186
181 3300013306 Ga0163162_10117036 Ga0163162_101170363 186
182 3300017792 Ga0163161_10002099 Ga0163161_1000209922 186
183 3300025913 Ga0207695_10064403 Ga0207695_100644038 186
184 3300031731 Ga0307405_10321398 Ga0307405_103213982 186
185 3300031824 Ga0307413_10669174 Ga0307413_106691741 186
186 3300031911 Ga0307412_10061433 Ga0307412_100614334 186
187 3300032002 Ga0307416_101393223 Ga0307416_1013932231 186
188 3300037312 Ga0395899_0085929 Ga0395899_0085929_1533_2213 186
189 3300045836 Ga0466958_0000015 Ga0466958_0000015_5724_6407 186
190 3300046462 Ga0495651_0051591 Ga0495651_0051591_332_1009 186
191 3300046463 Ga0495653_0017461 Ga0495653_0017461_3176_3853 186
192 3300046511 Ga0495608_0118753 Ga0495608_0118753_225_902 186
193 3300046517 Ga0495630_0657357 Ga0495630_0657357_76_753 186
194 3300046559 Ga0495667_0008682 Ga0495667_0008682_4700_5377 186
195 3300046648 Ga0495611_0260835 Ga0495611_0260835_81_746 186
196 3300046665 Ga0495661_0094987 Ga0495661_0094987_799_1467 186
197 3300047319 Ga0495674_0019914 Ga0495674_0019914_2393_3067 186
198 3300047471 Ga0495684_0011398 Ga0495684_0011398_5620_6297 186
199 3300049586 Ga0501070_0023357 Ga0501070_0023357_4422_5126 186
200 3300005288 Ga0065714_10005394 Ga0065714_100053944 187
201 3300005288 Ga0065714_10065516 Ga0065714_100655169 187
202 3300005288 Ga0065714_10077805 Ga0065714_100778052 187
203 3300005293 Ga0065715_10092554 Ga0065715_100925544 187
204 3300005614 Ga0068856_100666364 Ga0068856_1006663641 187
205 3300013102 Ga0157371_10183956 Ga0157371_101839563 187
206 3300013306 Ga0163162_10006728 Ga0163162_1000672823 187
207 3300013308 Ga0157375_10040436 Ga0157375_100404369 187
208 3300013308 Ga0157375_10232335 Ga0157375_102323352 187
209 3300013308 Ga0157375_10425556 Ga0157375_104255563 187
210 3300013308 Ga0157375_10523022 Ga0157375_105230223 187
211 3300013308 Ga0157375_11147484 Ga0157375_111474841 187
212 3300026078 Ga0207702_11006189 Ga0207702_110061891 187
213 3300031548 Ga0307408_100004996 Ga0307408_10000499612 187
214 3300031548 Ga0307408_100620631 Ga0307408_1006206312 187
215 3300031824 Ga0307413_10165514 Ga0307413_101655145 187
216 3300031824 Ga0307413_10277914 Ga0307413_102779143 187
217 3300031901 Ga0307406_10000064 Ga0307406_100000648 187
218 3300032004 Ga0307414_10780657 Ga0307414_107806571 187
219 3300037312 Ga0395899_0024684 Ga0395899_0024684_413_1090 187
220 3300044693 Ga0466961_0321094 Ga0466961_0321094_45_740 187
221 3300046616 Ga0495668_0211283 Ga0495668_0211283_110_805 187
222 3300046684 Ga0495669_0064865 Ga0495669_0064865_905_1612 187
223 3300049569 Ga0501032_0000453 Ga0501032_0000453_19516_20280 187
224 3300049571 Ga0501034_0012219 Ga0501034_0012219_2219_2983 187
225 3300049573 Ga0501037_0000213 Ga0501037_0000213_28412_29176 187
226 3300049574 Ga0501038_0000083 Ga0501038_0000083_51349_52113 187
227 3300049574 Ga0501038_0052717 Ga0501038_0052717_857_1537 187
228 3300049575 Ga0501039_0000068 Ga0501039_0000068_51364_52128 187
229 3300049579 Ga0501043_0023679 Ga0501043_0023679_670_1434 187
230 3300049586 Ga0501070_0009578 Ga0501070_0009578_2891_3655 187
231 3300049587 Ga0501071_0363395 Ga0501071_0363395_324_1088 187
232 3300049589 Ga0501073_0149928 Ga0501073_0149928_32_796 187
233 3300005288 Ga0065714_10023047 Ga0065714_100230472 188
234 3300005288 Ga0065714_10065685 Ga0065714_100656857 188
235 3300005288 Ga0065714_10093340 Ga0065714_100933402 188
236 3300005288 Ga0065714_10107415 Ga0065714_101074152 188
237 3300005530 Ga0070679_100070732 Ga0070679_1000707327 188
238 3300005563 Ga0068855_100086887 Ga0068855_1000868874 188
239 3300005615 Ga0070702_100002621 Ga0070702_1000026213 188
240 3300009093 Ga0105240_10023613 Ga0105240_1002361315 188
241 3300013102 Ga0157371_10438847 Ga0157371_104388472 188
242 3300013306 Ga0163162_10015023 Ga0163162_100150235 188
243 3300013306 Ga0163162_10067860 Ga0163162_100678603 188
244 3300013306 Ga0163162_10245784 Ga0163162_102457843 188
245 3300013306 Ga0163162_10419576 Ga0163162_104195761 188
246 3300013306 Ga0163162_10552308 Ga0163162_105523082 188
247 3300013306 Ga0163162_10856951 Ga0163162_108569512 188
248 3300013307 Ga0157372_10042547 Ga0157372_100425473 188
249 3300013308 Ga0157375_10018365 Ga0157375_100183652 188
250 3300013308 Ga0157375_10135819 Ga0157375_101358196 188
251 3300013308 Ga0157375_10861512 Ga0157375_108615123 188
252 3300013308 Ga0157375_10895121 Ga0157375_108951212 188
253 3300017792 Ga0163161_10107020 Ga0163161_101070203 188
254 3300025949 Ga0207667_10071737 Ga0207667_100717376 188
255 3300031731 Ga0307405_10633300 Ga0307405_106333002 188
256 3300032002 Ga0307416_100541689 Ga0307416_1005416892 188
257 3300037418 Ga0395900_0007531 Ga0395900_0007531_3404_4054 188
258 3300037466 Ga0395898_0020467 Ga0395898_0020467_3006_3698 188
259 3300038443 Ga0395901_0197506 Ga0395901_0197506_379_1029 188
260 3300042122 Ga0450920_001143 Ga0450920_001143_2050_2730 188
261 3300044693 Ga0466961_0158800 Ga0466961_0158800_124_795 188
262 3300046474 Ga0495605_0004919 Ga0495605_0004919_701_1375 188
263 3300049579 Ga0501043_0011850 Ga0501043_0011850_5808_6515 188
264 3300049742 Ga0501080_0454861 Ga0501080_0454861_177_884 188
265 3300049823 Ga0501044_0124965 Ga0501044_0124965_281_988 188
266 3300005437 Ga0070710_10097162 Ga0070710_100971623 189
267 3300006175 Ga0070712_100000391 Ga0070712_1000003916 189
268 3300009177 Ga0105248_10146034 Ga0105248_101460346 189
269 3300013104 Ga0157370_10038253 Ga0157370_100382532 189
270 3300013306 Ga0163162_10127440 Ga0163162_101274402 189
271 3300013306 Ga0163162_10627109 Ga0163162_106271092 189
272 3300013308 Ga0157375_10013426 Ga0157375_100134265 189
273 3300013308 Ga0157375_10027598 Ga0157375_100275983 189
274 3300013308 Ga0157375_10149278 Ga0157375_101492783 189
275 3300013308 Ga0157375_10319510 Ga0157375_103195102 189
276 3300013308 Ga0157375_10747603 Ga0157375_107476032 189
277 3300017792 Ga0163161_10122044 Ga0163161_101220443 189
278 3300017792 Ga0163161_10421072 Ga0163161_104210722 189
279 3300025898 Ga0207692_10080585 Ga0207692_100805852 189
280 3300025915 Ga0207693_10003270 Ga0207693_100032702 189
281 3300025941 Ga0207711_10211312 Ga0207711_102113124 189
282 3300030733 Ga0314311_1010696 Ga0314311_10106962 189
283 3300031731 Ga0307405_10157797 Ga0307405_101577972 189
284 3300031911 Ga0307412_10003560 Ga0307412_100035607 189
285 3300031911 Ga0307412_10057193 Ga0307412_100571933 189
286 3300031911 Ga0307412_10203992 Ga0307412_102039923 189
287 3300031911 Ga0307412_10286595 Ga0307412_102865952 189
288 3300046678 Ga0495599_0004777 Ga0495599_0004777_2864_3526 189
289 3300047315 Ga0495581_0088102 Ga0495581_0088102_733_1413 189
290 3300047673 Ga0495593_0053759 Ga0495593_0053759_430_1110 189
291 3300048089 Ga0495614_0070736 Ga0495614_0070736_154_834 189
292 3300013308 Ga0157375_10001381 Ga0157375_1000138128 190
293 3300048903 Ga0496100_0321178 Ga0496100_0321178_137_805 190
294 3300048918 Ga0496115_0104887 Ga0496115_0104887_939_1607 190
295 3300002075 JGI24738J21930_10000254 JGI24738J21930_1000025427 191
296 3300005288 Ga0065714_10065238 Ga0065714_100652386 191
297 3300013306 Ga0163162_10880790 Ga0163162_108807901 191
298 3300013308 Ga0157375_10427947 Ga0157375_104279472 191
299 3300047470 Ga0495681_0000265 Ga0495681_0000265_34239_34925 191
300 3300044712 Ga0453684_0004128 Ga0453684_0004128_27925_28632 192
301 3300048927 Ga0496124_0005324 Ga0496124_0005324_4283_5005 193
302 3300048928 Ga0496125_0054484 Ga0496125_0054484_141_863 193
303 3300048929 Ga0496126_0003754 Ga0496126_0003754_830_1552 193
304 3300046533 Ga0495640_0036309 Ga0495640_0036309_2074_2721 204
305 3300028380 Ga0268265_10310403 Ga0268265_103104031 206
306 3300046533 Ga0495640_0048430 Ga0495640_0048430_123_803 216
307 3300046642 Ga0495634_0028764 Ga0495634_0028764_2319_2999 216
308 3300005981 Ga0081538_10014881 Ga0081538_100148816 218
309 3300000549 LJQas_1014361 LJQas_10143612 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01555

N6_N4_Mtase

DNA methylase

159

243

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cgg-assembly2.cif.gz_B crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution 0.8976 161 212
2nxe-assembly2.cif.gz_B t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with s-adenosyl-l-methionine 0.8862 161 213
3cjq-assembly3.cif.gz_G ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 0.8775 160 213
3gdh-assembly2.cif.gz_B methyltransferase domain of human trimethylguanosine synthase 1 (tgs1) bound to m7gtp and adenosyl-homocysteine (active form) 0.8588 158 213
5t67-assembly1.cif.gz_B x-ray structure of the kijd1 c3-methyltransferase from actinomadura kijaniata in complex with sah and dtdp-sugar product 0.8339 159 212
ID Description Score Start End Superfamily
af_P9WJZ3_50_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9114 157 212 3.40.50.150
3v8vB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8941 157 213 3.40.50.150
af_P9WLY7_8_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8729 158 215 3.40.50.150
af_Q9LIN4_192_384_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8723 157 204 3.40.50.150
af_P9WLY9_5_208_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8598 158 214 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6M3LE78-F1-model_v4 Putative methyltransferase 0.8745 126 220 GO:0003677
GO:0005737
GO:0008170
GO:0032259
AF-A0A0G3BQK5-F1-model_v4 Adenine-specific methyltransferase 0.8574 144 214 GO:0003677
GO:0005737
GO:0008170
GO:0009007
GO:0009307
GO:0032259
AF-A0A6M3Y1C5-F1-model_v4 Putative methyltransferase 0.8424 2 220 GO:0003677
GO:0005737
GO:0008170
GO:0009307
GO:0032259
AF-A0A7C1RKP5-F1-model_v4 Site-specific DNA-methyltransferase 0.8365 150 222 GO:0003677
GO:0005737
GO:0008170
GO:0009007
GO:0009307
GO:0032259
AF-A0A0F9NKF6-F1-model_v4 DNA methylase N-4/N-6 domain-containing protein 0.8358 1 221 GO:0003677
GO:0008170
GO:0032259

Feature Viewer

pLDDT pTM Quality
76.43 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map