F400210
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 309 | 222 | 304 | 369 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10180258|Ga0157370_101802582 |
| Length | 418 |
| Sequence | MTALASNQPAASNGRDVSAEVLSIRRRTTMDNAGYSLAAMARYFLKLGTIGFGGPVALVGYMYRDLVESRRWISEEDYKEGLTLAQLMPGPLAAQLAMYLGYVHYRVPGATVVGAAFVLPSFVMVVAIGFAYVRFGGLPWMQAVFYGVGAAVIGIIAISAYKLTTKNVGRDRLLWLIFVLTAAFTVWTQSESVWLFLGGGVLVWWVRASPKRSLGKSIAPALAAIDSHGPPATSMLSSVDWSLLAQIGVFFAKAGAFVFGSGLAIVPFLYAGVVHDHPWLTERQFVDAVAVAMLTPGPVVITVGFIGYLVAGLPGACVAAFGTFLPCYLFTILPAPYFKKYGKRPALVSFVDGVTAAAIGAITGAVIVLAERSVVDIVTALIAFVTIGVVWRFKKVPEPVIVAVAAVIGLLAFSVMRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 3 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 4 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 5 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 94 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 147 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 148 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 149 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 150 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 151 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 152 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 153 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 176 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 178 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 179 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 180 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 181 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 182 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 183 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 209 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 210 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 211 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 219 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 222 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.06 |
| Metatranscriptomes | 0.32 |
| Isolates | 1.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.47 |
| Nodule | 0 |
| Rhizoplane | 0.65 |
| Rhizosphere | 88.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_4194132 | 2162886012 | Bacteria | 1722 |
| 2 | JGI25156J39149_1008742 | 3300002705 | Bacteria | 2523 |
| 3 | JGI25154J39366_1000357 | 3300002738 | Bacteria | 25865 |
| 4 | rootL2_10065873 | 3300003322 | Bacteria | 3827 |
| 5 | rootL2_10252722 | 3300003322 | Bacteria | 1664 |
| 6 | rootH1_10254642 | 3300003323 | Bacteria | 1553 |
| 7 | Ga0055533_1001036 | 3300003756 | Bacteria | 8038 |
| 8 | Ga0055542_1000877 | 3300003762 | Bacteria | 20920 |
| 9 | Ga0055529_1000683 | 3300003763 | Bacteria | 23311 |
| 10 | Ga0055536_1001701 | 3300003781 | Bacteria | 13024 |
| 11 | Ga0055541_1000764 | 3300003841 | Bacteria | 8141 |
| 12 | Ga0065165_1000961 | 3300005262 | Bacteria | 36182 |
| 13 | Ga0070658_10007446 | 3300005327 | Bacteria | 8837 |
| 14 | Ga0070676_10166363 | 3300005328 | Bacteria | 1423 |
| 15 | Ga0070690_100124811 | 3300005330 | Bacteria | 1732 |
| 16 | Ga0070690_100177463 | 3300005330 | Bacteria | 1470 |
| 17 | Ga0070670_100006723 | 3300005331 | Bacteria | 9747 |
| 18 | Ga0070670_100115508 | 3300005331 | Bacteria | 2314 |
| 19 | Ga0070670_100292200 | 3300005331 | Bacteria | 1424 |
| 20 | Ga0068869_100002092 | 3300005334 | Bacteria | 12003 |
| 21 | Ga0070680_100000881 | 3300005336 | Bacteria | 21276 |
| 22 | Ga0070680_100268470 | 3300005336 | Bacteria | 1444 |
| 23 | Ga0070682_100085025 | 3300005337 | Bacteria | 2057 |
| 24 | Ga0068868_100055655 | 3300005338 | Bacteria | 3122 |
| 25 | Ga0070660_100004440 | 3300005339 | Bacteria | 9692 |
| 26 | Ga0070660_100115977 | 3300005339 | Bacteria | 2135 |
| 27 | Ga0070660_100199184 | 3300005339 | Bacteria | 1624 |
| 28 | Ga0070689_100002163 | 3300005340 | Bacteria | 12740 |
| 29 | Ga0070689_100025481 | 3300005340 | Bacteria | 4443 |
| 30 | Ga0070691_10024447 | 3300005341 | Bacteria | 2807 |
| 31 | Ga0070687_100009558 | 3300005343 | Bacteria | 4161 |
| 32 | Ga0070661_100009262 | 3300005344 | Bacteria | 6807 |
| 33 | Ga0070661_100012104 | 3300005344 | Bacteria | 6031 |
| 34 | Ga0070669_100006864 | 3300005353 | Bacteria | 8184 |
| 35 | Ga0070675_100001644 | 3300005354 | Bacteria | 16514 |
| 36 | Ga0070688_100000676 | 3300005365 | Bacteria | 16998 |
| 37 | Ga0070688_100004157 | 3300005365 | Bacteria | 7510 |
| 38 | Ga0070659_100000523 | 3300005366 | Bacteria | 28186 |
| 39 | Ga0070703_10021945 | 3300005406 | Bacteria | 1870 |
| 40 | Ga0070714_100018728 | 3300005435 | Bacteria | 5632 |
| 41 | Ga0070714_100031430 | 3300005435 | Bacteria | 4429 |
| 42 | Ga0070713_100004716 | 3300005436 | Bacteria | 9213 |
| 43 | Ga0070701_10051393 | 3300005438 | Bacteria | 2138 |
| 44 | Ga0070705_100000623 | 3300005440 | Bacteria | 20474 |
| 45 | Ga0070694_100000022 | 3300005444 | Bacteria | 71609 |
| 46 | Ga0070708_100271995 | 3300005445 | Bacteria | 1593 |
| 47 | Ga0070663_100015602 | 3300005455 | Bacteria | 4910 |
| 48 | Ga0068867_100001983 | 3300005459 | Bacteria | 14274 |
| 49 | Ga0068867_100088489 | 3300005459 | Bacteria | 2347 |
| 50 | Ga0070685_10011405 | 3300005466 | Bacteria | 4652 |
| 51 | Ga0070707_100117019 | 3300005468 | Bacteria | 2587 |
| 52 | Ga0070699_100056271 | 3300005518 | Bacteria | 3406 |
| 53 | Ga0070679_100001744 | 3300005530 | Bacteria | 19580 |
| 54 | Ga0070684_100082393 | 3300005535 | Bacteria | 2848 |
| 55 | Ga0068853_100001043 | 3300005539 | Bacteria | 19590 |
| 56 | Ga0068853_100012720 | 3300005539 | Bacteria | 6851 |
| 57 | Ga0070672_100014679 | 3300005543 | Bacteria | 5557 |
| 58 | Ga0070695_100007047 | 3300005545 | Bacteria | 6663 |
| 59 | Ga0070704_100013564 | 3300005549 | Bacteria | 5061 |
| 60 | Ga0068855_100000101 | 3300005563 | Bacteria | 105095 |
| 61 | Ga0068855_100383487 | 3300005563 | Bacteria | 1543 |
| 62 | Ga0070664_100007727 | 3300005564 | Bacteria | 8683 |
| 63 | Ga0070664_100033715 | 3300005564 | Bacteria | 4291 |
| 64 | Ga0068854_100000873 | 3300005578 | Bacteria | 18083 |
| 65 | Ga0068854_100073215 | 3300005578 | Bacteria | 2510 |
| 66 | Ga0068856_100002928 | 3300005614 | Bacteria | 17482 |
| 67 | Ga0068856_100047375 | 3300005614 | Bacteria | 4234 |
| 68 | Ga0070702_100203637 | 3300005615 | Bacteria | 1312 |
| 69 | Ga0068859_100057392 | 3300005617 | Bacteria | 3921 |
| 70 | Ga0068859_100283276 | 3300005617 | Bacteria | 1750 |
| 71 | Ga0068864_100053328 | 3300005618 | Bacteria | 3488 |
| 72 | Ga0068861_100012517 | 3300005719 | Bacteria | 5918 |
| 73 | Ga0068870_10007759 | 3300005840 | Bacteria | 4799 |
| 74 | Ga0068863_100099271 | 3300005841 | Bacteria | 2766 |
| 75 | Ga0068858_100425170 | 3300005842 | Bacteria | 1278 |
| 76 | Ga0068860_100007147 | 3300005843 | Bacteria | 11169 |
| 77 | Ga0068862_100003210 | 3300005844 | Bacteria | 14171 |
| 78 | Ga0081538_10031213 | 3300005981 | Bacteria | 3599 |
| 79 | Ga0081539_10011723 | 3300005985 | Bacteria | 6877 |
| 80 | Ga0075364_10082485 | 3300006051 | Bacteria | 2127 |
| 81 | Ga0075366_10108849 | 3300006195 | Bacteria | 1666 |
| 82 | Ga0075428_100006891 | 3300006844 | Bacteria | 12620 |
| 83 | Ga0075428_100203460 | 3300006844 | Bacteria | 2140 |
| 84 | Ga0075434_100056033 | 3300006871 | Bacteria | 3917 |
| 85 | Ga0075434_100139360 | 3300006871 | Bacteria | 2445 |
| 86 | Ga0075429_100002942 | 3300006880 | Bacteria | 14444 |
| 87 | Ga0075436_100002000 | 3300006914 | Bacteria | 14080 |
| 88 | Ga0097620_100057395 | 3300006931 | Bacteria | 3921 |
| 89 | Ga0097620_100283269 | 3300006931 | Bacteria | 1750 |
| 90 | Ga0075435_100184891 | 3300007076 | Bacteria | 1762 |
| 91 | Ga0105240_10131148 | 3300009093 | Bacteria | 3006 |
| 92 | Ga0111539_10001921 | 3300009094 | Bacteria | 27677 |
| 93 | Ga0111539_10002165 | 3300009094 | Bacteria | 26287 |
| 94 | Ga0111539_10004312 | 3300009094 | Bacteria | 18610 |
| 95 | Ga0111539_10026917 | 3300009094 | Bacteria | 7025 |
| 96 | Ga0111539_10081474 | 3300009094 | Bacteria | 3807 |
| 97 | Ga0111539_10164969 | 3300009094 | Bacteria | 2590 |
| 98 | Ga0114129_10253998 | 3300009147 | Bacteria | 2359 |
| 99 | Ga0105241_10002364 | 3300009174 | Bacteria | 14171 |
| 100 | Ga0105241_10011637 | 3300009174 | Bacteria | 6455 |
| 101 | Ga0105237_10025867 | 3300009545 | Bacteria | 6000 |
| 102 | Ga0105239_10059855 | 3300010375 | Bacteria | 4179 |
| 103 | Ga0157373_10004145 | 3300013100 | Bacteria | 10930 |
| 104 | Ga0157373_10062020 | 3300013100 | Bacteria | 2648 |
| 105 | Ga0157373_10212249 | 3300013100 | Bacteria | 1365 |
| 106 | Ga0157371_10005083 | 3300013102 | Bacteria | 11228 |
| 107 | Ga0157370_10012539 | 3300013104 | Bacteria | 8789 |
| 108 | Ga0157370_10016094 | 3300013104 | Bacteria | 7581 |
| 109 | Ga0157370_10045204 | 3300013104 | Bacteria | 4226 |
| 110 | Ga0157370_10100675 | 3300013104 | Bacteria | 2707 |
| 111 | Ga0157370_10136568 | 3300013104 | Bacteria | 2285 |
| 112 | Ga0157370_10180258 | 3300013104 | Bacteria | 1963 |
| 113 | Ga0157369_10004726 | 3300013105 | Bacteria | 16006 |
| 114 | Ga0157369_10014972 | 3300013105 | Bacteria | 8753 |
| 115 | Ga0157372_10076960 | 3300013307 | Bacteria | 3768 |
| 116 | Ga0157372_10085171 | 3300013307 | Bacteria | 3584 |
| 117 | Ga0157372_10311565 | 3300013307 | Bacteria | 1832 |
| 118 | Ga0157375_10013344 | 3300013308 | Bacteria | 7307 |
| 119 | Ga0163163_10143231 | 3300014325 | Unclassified | 2433 |
| 120 | Ga0163163_10147191 | 3300014325 | Bacteria | 2400 |
| 121 | Ga0206356_11172816 | 3300020070 | Bacteria | 2198 |
| 122 | Ga0209784_100699 | 3300025224 | Bacteria | 9087 |
| 123 | Ga0209566_100451 | 3300025225 | Bacteria | 30269 |
| 124 | Ga0209674_100266 | 3300025226 | Bacteria | 40849 |
| 125 | Ga0209563_102459 | 3300025230 | Bacteria | 4183 |
| 126 | Ga0209646_1000075 | 3300025246 | Bacteria | 221755 |
| 127 | Ga0209026_1001109 | 3300025250 | Bacteria | 12794 |
| 128 | Ga0209677_103752 | 3300025253 | Bacteria | 4735 |
| 129 | Ga0209148_1000043 | 3300025254 | Bacteria | 461531 |
| 130 | Ga0209148_1002574 | 3300025254 | Bacteria | 6008 |
| 131 | Ga0209759_1004478 | 3300025256 | Bacteria | 5202 |
| 132 | Ga0209676_1001625 | 3300025292 | Bacteria | 19883 |
| 133 | Ga0207692_10043526 | 3300025898 | Bacteria | 2235 |
| 134 | Ga0207647_10053366 | 3300025904 | Bacteria | 2491 |
| 135 | Ga0207645_10010419 | 3300025907 | Bacteria | 6380 |
| 136 | Ga0207643_10002130 | 3300025908 | Bacteria | 10884 |
| 137 | Ga0207654_10083710 | 3300025911 | Bacteria | 1927 |
| 138 | Ga0207707_10003397 | 3300025912 | Bacteria | 14128 |
| 139 | Ga0207695_10178127 | 3300025913 | Bacteria | 2048 |
| 140 | Ga0207660_10006505 | 3300025917 | Bacteria | 7583 |
| 141 | Ga0207657_10000911 | 3300025919 | Bacteria | 31260 |
| 142 | Ga0207657_10001098 | 3300025919 | Bacteria | 28739 |
| 143 | Ga0207657_10008847 | 3300025919 | Bacteria | 10185 |
| 144 | Ga0207649_10023464 | 3300025920 | Bacteria | 3573 |
| 145 | Ga0207649_10055911 | 3300025920 | Bacteria | 2462 |
| 146 | Ga0207681_10013596 | 3300025923 | Bacteria | 5039 |
| 147 | Ga0207694_10047615 | 3300025924 | Bacteria | 3316 |
| 148 | Ga0207650_10040171 | 3300025925 | Bacteria | 3422 |
| 149 | Ga0207659_10004325 | 3300025926 | Bacteria | 8585 |
| 150 | Ga0207664_10001871 | 3300025929 | Bacteria | 13844 |
| 151 | Ga0207644_10047235 | 3300025931 | Bacteria | 3071 |
| 152 | Ga0207690_10002022 | 3300025932 | Bacteria | 12431 |
| 153 | Ga0207690_10076204 | 3300025932 | Bacteria | 2328 |
| 154 | Ga0207690_10081099 | 3300025932 | Bacteria | 2266 |
| 155 | Ga0207706_10157918 | 3300025933 | Bacteria | 1994 |
| 156 | Ga0207670_10013282 | 3300025936 | Bacteria | 4849 |
| 157 | Ga0207691_10055102 | 3300025940 | Bacteria | 3626 |
| 158 | Ga0207689_10000005 | 3300025942 | Bacteria | 135458 |
| 159 | Ga0207661_10094243 | 3300025944 | Bacteria | 2500 |
| 160 | Ga0207679_10000273 | 3300025945 | Bacteria | 38920 |
| 161 | Ga0207679_10121194 | 3300025945 | Bacteria | 2082 |
| 162 | Ga0207679_10278183 | 3300025945 | Bacteria | 1434 |
| 163 | Ga0207667_10065500 | 3300025949 | Bacteria | 3789 |
| 164 | Ga0207667_10166299 | 3300025949 | Bacteria | 2268 |
| 165 | Ga0207640_10005687 | 3300025981 | Bacteria | 6792 |
| 166 | Ga0207640_10237440 | 3300025981 | Bacteria | 1406 |
| 167 | Ga0207658_10144457 | 3300025986 | Bacteria | 1930 |
| 168 | Ga0207703_10094470 | 3300026035 | Bacteria | 2521 |
| 169 | Ga0207639_10002730 | 3300026041 | Bacteria | 11844 |
| 170 | Ga0207639_10024724 | 3300026041 | Bacteria | 4351 |
| 171 | Ga0207678_10015553 | 3300026067 | Bacteria | 6690 |
| 172 | Ga0207702_10000385 | 3300026078 | Bacteria | 50280 |
| 173 | Ga0207702_10058808 | 3300026078 | Bacteria | 3272 |
| 174 | Ga0207641_10048209 | 3300026088 | Bacteria | 3595 |
| 175 | Ga0207648_10000434 | 3300026089 | Bacteria | 46147 |
| 176 | Ga0207648_10027510 | 3300026089 | Bacteria | 5048 |
| 177 | Ga0207676_10221219 | 3300026095 | Bacteria | 1686 |
| 178 | Ga0207674_10001534 | 3300026116 | Bacteria | 29751 |
| 179 | Ga0207674_10003605 | 3300026116 | Bacteria | 18878 |
| 180 | Ga0207674_10007212 | 3300026116 | Bacteria | 12975 |
| 181 | Ga0207674_10077097 | 3300026116 | Bacteria | 3339 |
| 182 | Ga0207675_100010922 | 3300026118 | Bacteria | 8510 |
| 183 | Ga0207698_10007789 | 3300026142 | Bacteria | 6731 |
| 184 | Ga0209996_1006028 | 3300027395 | Bacteria | 1559 |
| 185 | Ga0209995_1009124 | 3300027471 | Bacteria | 1603 |
| 186 | Ga0209966_1000492 | 3300027695 | Bacteria | 10543 |
| 187 | Ga0207428_10001469 | 3300027907 | Bacteria | 24671 |
| 188 | Ga0207428_10093049 | 3300027907 | Bacteria | 2339 |
| 189 | Ga0268264_10010447 | 3300028381 | Bacteria | 7677 |
| 190 | Ga0307410_10016146 | 3300031852 | Bacteria | 4446 |
| 191 | Ga0307416_100000380 | 3300032002 | Bacteria | 23065 |
| 192 | Ga0307416_100020549 | 3300032002 | Bacteria | 4715 |
| 193 | Ga0307415_100000359 | 3300032126 | Bacteria | 19423 |
| 194 | Ga0307415_100064667 | 3300032126 | Bacteria | 2546 |
| 195 | Ga0373937_0223613 | 3300036401 | Bacteria | 1772 |
| 196 | Ga0395899_0000941 | 3300037312 | Bacteria | 27377 |
| 197 | Ga0395899_0026594 | 3300037312 | Bacteria | 4365 |
| 198 | Ga0395900_0014113 | 3300037418 | Bacteria | 8157 |
| 199 | Ga0395900_0018828 | 3300037418 | Bacteria | 7042 |
| 200 | Ga0395900_0053101 | 3300037418 | Bacteria | 4171 |
| 201 | Ga0395900_0101473 | 3300037418 | Bacteria | 2956 |
| 202 | Ga0395898_0007957 | 3300037466 | Bacteria | 11242 |
| 203 | Ga0395898_0161173 | 3300037466 | Bacteria | 2145 |
| 204 | Ga0395905_0060822 | 3300037471 | Bacteria | 3532 |
| 205 | Ga0395901_0252468 | 3300038443 | Bacteria | 1837 |
| 206 | Ga0439459_0000197 | 3300042438 | Bacteria | 6665 |
| 207 | Ga0439460_0007413 | 3300042461 | Bacteria | 2743 |
| 208 | Ga0451577_0015409 | 3300042876 | Bacteria | 7113 |
| 209 | Ga0451577_0057728 | 3300042876 | Bacteria | 3460 |
| 210 | Ga0451577_0058733 | 3300042876 | Bacteria | 3429 |
| 211 | Ga0453683_0102385 | 3300044673 | Bacteria | 1798 |
| 212 | Ga0453684_0161158 | 3300044712 | Bacteria | 2653 |
| 213 | Ga0453684_0194904 | 3300044712 | Bacteria | 2367 |
| 214 | Ga0466957_0000150 | 3300044842 | Bacteria | 30176 |
| 215 | Ga0451576_0012758 | 3300045051 | Bacteria | 9430 |
| 216 | Ga0466958_0151124 | 3300045836 | Bacteria | 1465 |
| 217 | Ga0495605_0002979 | 3300046474 | Bacteria | 10241 |
| 218 | Ga0495605_0011173 | 3300046474 | Bacteria | 5016 |
| 219 | Ga0495584_0032966 | 3300046491 | Bacteria | 2620 |
| 220 | Ga0495596_0000320 | 3300046500 | Bacteria | 31290 |
| 221 | Ga0495607_0001070 | 3300046501 | Bacteria | 25016 |
| 222 | Ga0495607_0006020 | 3300046501 | Bacteria | 8600 |
| 223 | Ga0495610_0000514 | 3300046512 | Bacteria | 39181 |
| 224 | Ga0495616_0000795 | 3300046513 | Bacteria | 23104 |
| 225 | Ga0495616_0002199 | 3300046513 | Bacteria | 13035 |
| 226 | Ga0495643_0005702 | 3300046522 | Bacteria | 8335 |
| 227 | Ga0495648_0004566 | 3300046524 | Bacteria | 11798 |
| 228 | Ga0495648_0016037 | 3300046524 | Bacteria | 5410 |
| 229 | Ga0495642_0031399 | 3300046528 | Bacteria | 2130 |
| 230 | Ga0495609_0000009 | 3300046538 | Bacteria | 354860 |
| 231 | Ga0495609_0003276 | 3300046538 | Bacteria | 9344 |
| 232 | Ga0495656_0064090 | 3300046615 | Bacteria | 1613 |
| 233 | Ga0495661_0000032 | 3300046665 | Bacteria | 170076 |
| 234 | Ga0495661_0000989 | 3300046665 | Bacteria | 25672 |
| 235 | Ga0495661_0010114 | 3300046665 | Bacteria | 6450 |
| 236 | Ga0495661_0010688 | 3300046665 | Bacteria | 6252 |
| 237 | Ga0495588_0000320 | 3300046674 | Bacteria | 32033 |
| 238 | Ga0495671_0002529 | 3300046692 | Bacteria | 11495 |
| 239 | Ga0495649_0007815 | 3300046694 | Bacteria | 6481 |
| 240 | Ga0495589_0000049 | 3300046794 | Bacteria | 116553 |
| 241 | Ga0495687_000024 | 3300047443 | Bacteria | 316676 |
| 242 | Ga0495677_0000017 | 3300047445 | Bacteria | 121483 |
| 243 | Ga0495626_0000287 | 3300048091 | Bacteria | 54612 |
| 244 | Ga0496106_0019945 | 3300048909 | Bacteria | 4972 |
| 245 | Ga0496109_0196785 | 3300048912 | Bacteria | 1895 |
| 246 | Ga0496116_0005772 | 3300048919 | Bacteria | 11379 |
| 247 | Ga0496121_0016225 | 3300048924 | Bacteria | 7707 |
| 248 | Ga0496122_0005998 | 3300048925 | Bacteria | 14189 |
| 249 | Ga0496123_0001721 | 3300048926 | Bacteria | 29129 |
| 250 | Ga0496123_0004782 | 3300048926 | Bacteria | 13979 |
| 251 | Ga0496124_0118295 | 3300048927 | Bacteria | 2121 |
| 252 | Ga0496125_0043781 | 3300048928 | Bacteria | 3794 |
| 253 | Ga0501031_0008641 | 3300049568 | Bacteria | 6623 |
| 254 | Ga0501033_0013750 | 3300049570 | Bacteria | 6156 |
| 255 | Ga0501036_0002792 | 3300049572 | Bacteria | 13832 |
| 256 | Ga0501037_0221767 | 3300049573 | Bacteria | 1330 |
| 257 | Ga0501038_0001494 | 3300049574 | Bacteria | 21535 |
| 258 | Ga0501039_0007056 | 3300049575 | Bacteria | 8554 |
| 259 | Ga0501040_0000886 | 3300049576 | Bacteria | 18812 |
| 260 | Ga0501040_0023529 | 3300049576 | Bacteria | 4132 |
| 261 | Ga0501041_0000465 | 3300049577 | Bacteria | 20540 |
| 262 | Ga0501042_0000128 | 3300049578 | Bacteria | 32900 |
| 263 | Ga0501046_0000729 | 3300049580 | Bacteria | 31807 |
| 264 | Ga0501048_0000491 | 3300049582 | Bacteria | 27609 |
| 265 | Ga0501068_0000962 | 3300049584 | Bacteria | 15131 |
| 266 | Ga0501069_0085910 | 3300049585 | Bacteria | 1776 |
| 267 | Ga0501071_0000790 | 3300049587 | Bacteria | 16882 |
| 268 | Ga0501072_0001467 | 3300049588 | Bacteria | 17674 |
| 269 | Ga0501074_0003739 | 3300049590 | Bacteria | 10808 |
| 270 | Ga0501075_0002545 | 3300049591 | Bacteria | 12140 |
| 271 | Ga0501075_0055050 | 3300049591 | Bacteria | 2993 |
| 272 | Ga0501075_0085927 | 3300049591 | Bacteria | 2383 |
| 273 | Ga0501076_0000165 | 3300049592 | Bacteria | 38444 |
| 274 | Ga0501076_0072151 | 3300049592 | Bacteria | 2763 |
| 275 | Ga0501077_0001013 | 3300049593 | Bacteria | 16971 |
| 276 | Ga0501077_0055258 | 3300049593 | Bacteria | 2521 |
| 277 | Ga0501079_0002052 | 3300049741 | Bacteria | 14428 |
| 278 | Ga0501079_0243121 | 3300049741 | Bacteria | 1406 |
| 279 | Ga0501080_0002214 | 3300049742 | Bacteria | 16896 |
| 280 | Ga0501081_0000258 | 3300049743 | Bacteria | 27526 |
| 281 | Ga0501083_0063955 | 3300049744 | Bacteria | 2453 |
| 282 | Ga0501035_0002910 | 3300049822 | Bacteria | 16479 |
| 283 | Ga0501045_0000081 | 3300049824 | Bacteria | 45827 |
| 284 | nmdc:mga03n38_12148_c1 | 3300050490 | Bacteria | 3232 |
| 285 | nmdc:mga00v17_99797_c1 | 3300050491 | Bacteria | 1832 |
| 286 | nmdc:mga0yw44_36429_c1 | 3300050492 | Bacteria | 2899 |
| 287 | nmdc:mga05p37_389592_c1 | 3300050507 | Bacteria | 1630 |
| 288 | nmdc:mga09592_4023_c1 | 3300050508 | Bacteria | 11860 |
| 289 | nmdc:mga06r32_278936_c1 | 3300050510 | Bacteria | 1658 |
| 290 | nmdc:mga08y16_6396_c1 | 3300050511 | Bacteria | 12348 |
| 291 | nmdc:mga08y16_663_c1 | 3300050511 | Bacteria | 32446 |
| 292 | nmdc:mga08y16_98237_c1 | 3300050511 | Bacteria | 3049 |
| 293 | nmdc:mga0n895_24496_c1 | 3300050512 | Bacteria | 5688 |
| 294 | nmdc:mga0n895_75930_c1 | 3300050512 | Bacteria | 3341 |
| 295 | nmdc:mga08x19_18289_c1 | 3300050514 | Bacteria | 4296 |
| 296 | nmdc:mga0a205_1408_c1 | 3300050515 | Bacteria | 20393 |
| 297 | nmdc:mga0a205_15176_c1 | 3300050515 | Bacteria | 7196 |
| 298 | Ga0500616_0003610 | 3300053153 | Bacteria | 11664 |
| 299 | Ga0501084_0001443 | 3300054114 | Bacteria | 18878 |
| 300 | Ga0501084_0023325 | 3300054114 | Bacteria | 5166 |
| 301 | Ga0501082_0000047 | 3300060353 | Bacteria | 86072 |
| 302 | Ga0501082_0285498 | 3300060353 | Bacteria | 1437 |
| 303 | Ga0530510_0001944 | 3300061734 | Bacteria | 14140 |
| 304 | Ga0530510_0159040 | 3300061734 | Bacteria | 1670 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049576 | Ga0501040_0023529 | Ga0501040_0023529_17_877 | 238 |
| 2 | 3300014325 | Ga0163163_10147191 | Ga0163163_101471911 | 240 |
| 3 | 3300005331 | Ga0070670_100006723 | Ga0070670_10000672311 | 271 |
| 4 | 3300005334 | Ga0068869_100002092 | Ga0068869_1000020929 | 271 |
| 5 | 3300005336 | Ga0070680_100000881 | Ga0070680_1000008817 | 271 |
| 6 | 3300005366 | Ga0070659_100000523 | Ga0070659_10000052328 | 271 |
| 7 | 3300005406 | Ga0070703_10021945 | Ga0070703_100219451 | 271 |
| 8 | 3300005438 | Ga0070701_10051393 | Ga0070701_100513932 | 271 |
| 9 | 3300005440 | Ga0070705_100000623 | Ga0070705_1000006236 | 271 |
| 10 | 3300005444 | Ga0070694_100000022 | Ga0070694_10000002212 | 271 |
| 11 | 3300005455 | Ga0070663_100015602 | Ga0070663_1000156023 | 271 |
| 12 | 3300005459 | Ga0068867_100001983 | Ga0068867_1000019839 | 271 |
| 13 | 3300005530 | Ga0070679_100001744 | Ga0070679_10000174410 | 271 |
| 14 | 3300005539 | Ga0068853_100001043 | Ga0068853_1000010435 | 271 |
| 15 | 3300005543 | Ga0070672_100014679 | Ga0070672_1000146795 | 271 |
| 16 | 3300005563 | Ga0068855_100000101 | Ga0068855_10000010117 | 271 |
| 17 | 3300005564 | Ga0070664_100007727 | Ga0070664_10000772710 | 271 |
| 18 | 3300005578 | Ga0068854_100000873 | Ga0068854_1000008733 | 271 |
| 19 | 3300005614 | Ga0068856_100002928 | Ga0068856_10000292811 | 271 |
| 20 | 3300005615 | Ga0070702_100203637 | Ga0070702_1002036371 | 271 |
| 21 | 3300005617 | Ga0068859_100057392 | Ga0068859_1000573922 | 271 |
| 22 | 3300005618 | Ga0068864_100053328 | Ga0068864_1000533282 | 271 |
| 23 | 3300005719 | Ga0068861_100012517 | Ga0068861_1000125176 | 271 |
| 24 | 3300005843 | Ga0068860_100007147 | Ga0068860_1000071476 | 271 |
| 25 | 3300005844 | Ga0068862_100003210 | Ga0068862_1000032105 | 271 |
| 26 | 3300006931 | Ga0097620_100057395 | Ga0097620_1000573952 | 271 |
| 27 | 3300009174 | Ga0105241_10002364 | Ga0105241_100023646 | 271 |
| 28 | 3300013100 | Ga0157373_10004145 | Ga0157373_100041455 | 271 |
| 29 | 3300013105 | Ga0157369_10014972 | Ga0157369_100149722 | 271 |
| 30 | 3300025907 | Ga0207645_10010419 | Ga0207645_100104192 | 271 |
| 31 | 3300025912 | Ga0207707_10003397 | Ga0207707_100033979 | 271 |
| 32 | 3300025919 | Ga0207657_10000911 | Ga0207657_1000091134 | 271 |
| 33 | 3300025932 | Ga0207690_10002022 | Ga0207690_1000202213 | 271 |
| 34 | 3300025942 | Ga0207689_10000005 | Ga0207689_1000000550 | 271 |
| 35 | 3300025945 | Ga0207679_10000273 | Ga0207679_1000027331 | 271 |
| 36 | 3300025981 | Ga0207640_10005687 | Ga0207640_100056873 | 271 |
| 37 | 3300026035 | Ga0207703_10094470 | Ga0207703_100944703 | 271 |
| 38 | 3300026067 | Ga0207678_10015553 | Ga0207678_100155534 | 271 |
| 39 | 3300026078 | Ga0207702_10000385 | Ga0207702_1000038544 | 271 |
| 40 | 3300026088 | Ga0207641_10048209 | Ga0207641_100482092 | 271 |
| 41 | 3300026089 | Ga0207648_10000434 | Ga0207648_1000043414 | 271 |
| 42 | 3300026095 | Ga0207676_10221219 | Ga0207676_102212192 | 271 |
| 43 | 3300026116 | Ga0207674_10007212 | Ga0207674_100072123 | 271 |
| 44 | 3300026118 | Ga0207675_100010922 | Ga0207675_1000109222 | 271 |
| 45 | 3300028381 | Ga0268264_10010447 | Ga0268264_100104473 | 271 |
| 46 | 3300042438 | Ga0439459_0000197 | Ga0439459_0000197_1080_2198 | 271 |
| 47 | 3300053153 | Ga0500616_0003610 | Ga0500616_0003610_8576_9718 | 274 |
| 48 | 3300049570 | Ga0501033_0013750 | Ga0501033_0013750_5141_6112 | 275 |
| 49 | 3300006880 | Ga0075429_100002942 | Ga0075429_10000294211 | 278 |
| 50 | 3300009094 | Ga0111539_10001921 | Ga0111539_1000192110 | 278 |
| 51 | 3300050508 | nmdc:mga09592_4023_c1 | nmdc:mga09592_4023_c1_4428_5678 | 278 |
| 52 | 3300050511 | nmdc:mga08y16_663_c1 | nmdc:mga08y16_663_c1_13373_14623 | 278 |
| 53 | 3300005341 | Ga0070691_10024447 | Ga0070691_100244472 | 280 |
| 54 | 3300006871 | Ga0075434_100139360 | Ga0075434_1001393603 | 284 |
| 55 | 3300025904 | Ga0207647_10053366 | Ga0207647_100533662 | 286 |
| 56 | 3300042876 | Ga0451577_0058733 | Ga0451577_0058733_1016_2134 | 286 |
| 57 | 3300044712 | Ga0453684_0194904 | Ga0453684_0194904_1121_2239 | 286 |
| 58 | 3300026041 | Ga0207639_10002730 | Ga0207639_100027303 | 287 |
| 59 | 3300005445 | Ga0070708_100271995 | Ga0070708_1002719951 | 296 |
| 60 | 3300036401 | Ga0373937_0223613 | Ga0373937_0223613_387_1520 | 296 |
| 61 | 3300037418 | Ga0395900_0018828 | Ga0395900_0018828_10_1140 | 299 |
| 62 | 3300009094 | Ga0111539_10004312 | Ga0111539_1000431215 | 301 |
| 63 | 3300013105 | Ga0157369_10004726 | Ga0157369_100047269 | 301 |
| 64 | 3300025933 | Ga0207706_10157918 | Ga0207706_101579182 | 301 |
| 65 | 3300027907 | Ga0207428_10001469 | Ga0207428_1000146919 | 301 |
| 66 | 3300042876 | Ga0451577_0015409 | Ga0451577_0015409_1261_2418 | 301 |
| 67 | 3300044673 | Ga0453683_0102385 | Ga0453683_0102385_594_1751 | 301 |
| 68 | 3300044712 | Ga0453684_0161158 | Ga0453684_0161158_1019_2176 | 301 |
| 69 | 3300045051 | Ga0451576_0012758 | Ga0451576_0012758_3983_5140 | 301 |
| 70 | 3300050511 | nmdc:mga08y16_6396_c1 | nmdc:mga08y16_6396_c1_4097_5254 | 301 |
| 71 | 3300050515 | nmdc:mga0a205_15176_c1 | nmdc:mga0a205_15176_c1_3652_4809 | 301 |
| 72 | 3300037418 | Ga0395900_0101473 | Ga0395900_0101473_558_1688 | 303 |
| 73 | 3300048926 | Ga0496123_0004782 | Ga0496123_0004782_9508_10638 | 304 |
| 74 | 3300005545 | Ga0070695_100007047 | Ga0070695_1000070478 | 306 |
| 75 | 3300013307 | Ga0157372_10076960 | Ga0157372_100769606 | 306 |
| 76 | 3300027395 | Ga0209996_1006028 | Ga0209996_10060282 | 306 |
| 77 | 3300027471 | Ga0209995_1009124 | Ga0209995_10091242 | 306 |
| 78 | 3300027695 | Ga0209966_1000492 | Ga0209966_10004922 | 306 |
| 79 | 3300037312 | Ga0395899_0000941 | Ga0395899_0000941_3905_5077 | 306 |
| 80 | 3300037466 | Ga0395898_0007957 | Ga0395898_0007957_7794_8966 | 306 |
| 81 | 3300046615 | Ga0495656_0064090 | Ga0495656_0064090_253_1350 | 306 |
| 82 | 3300049591 | Ga0501075_0085927 | Ga0501075_0085927_1299_2363 | 306 |
| 83 | 3300025254 | Ga0209148_1002574 | Ga0209148_10025743 | 308 |
| 84 | 3300037312 | Ga0395899_0026594 | Ga0395899_0026594_1982_3139 | 308 |
| 85 | 3300037418 | Ga0395900_0014113 | Ga0395900_0014113_1540_2697 | 308 |
| 86 | 3300046665 | Ga0495661_0010114 | Ga0495661_0010114_5159_6316 | 308 |
| 87 | 3300048909 | Ga0496106_0019945 | Ga0496106_0019945_1098_2255 | 308 |
| 88 | 3300006844 | Ga0075428_100006891 | Ga0075428_10000689114 | 310 |
| 89 | 3300009094 | Ga0111539_10002165 | Ga0111539_1000216518 | 310 |
| 90 | 3300054114 | Ga0501084_0023325 | Ga0501084_0023325_3683_4855 | 310 |
| 91 | 3300060353 | Ga0501082_0285498 | Ga0501082_0285498_175_1347 | 310 |
| 92 | 3300006844 | Ga0075428_100203460 | Ga0075428_1002034603 | 311 |
| 93 | 3300014325 | Ga0163163_10143231 | Ga0163163_101432313 | 311 |
| 94 | 3300044842 | Ga0466957_0000150 | Ga0466957_0000150_19279_20442 | 311 |
| 95 | 3300005468 | Ga0070707_100117019 | Ga0070707_1001170192 | 312 |
| 96 | 3300013104 | Ga0157370_10136568 | Ga0157370_101365682 | 313 |
| 97 | 3300005563 | Ga0068855_100383487 | Ga0068855_1003834872 | 315 |
| 98 | 3300005841 | Ga0068863_100099271 | Ga0068863_1000992712 | 315 |
| 99 | 3300046474 | Ga0495605_0011173 | Ga0495605_0011173_1111_2289 | 315 |
| 100 | 3300046491 | Ga0495584_0032966 | Ga0495584_0032966_831_2009 | 315 |
| 101 | 3300046501 | Ga0495607_0006020 | Ga0495607_0006020_5068_6246 | 315 |
| 102 | 3300046513 | Ga0495616_0002199 | Ga0495616_0002199_4191_5369 | 315 |
| 103 | 3300046528 | Ga0495642_0031399 | Ga0495642_0031399_524_1702 | 315 |
| 104 | 3300046538 | Ga0495609_0000009 | Ga0495609_0000009_29152_30330 | 315 |
| 105 | 3300046665 | Ga0495661_0000032 | Ga0495661_0000032_124066_125244 | 315 |
| 106 | 3300046794 | Ga0495589_0000049 | Ga0495589_0000049_16255_17433 | 315 |
| 107 | 3300047443 | Ga0495687_000024 | Ga0495687_000024_116203_117381 | 315 |
| 108 | 3300047445 | Ga0495677_0000017 | Ga0495677_0000017_4110_5288 | 315 |
| 109 | 3300049591 | Ga0501075_0055050 | Ga0501075_0055050_1278_2450 | 315 |
| 110 | 3300049592 | Ga0501076_0072151 | Ga0501076_0072151_1380_2552 | 315 |
| 111 | 3300009093 | Ga0105240_10131148 | Ga0105240_101311483 | 316 |
| 112 | 3300013100 | Ga0157373_10212249 | Ga0157373_102122491 | 316 |
| 113 | 3300013104 | Ga0157370_10016094 | Ga0157370_100160946 | 316 |
| 114 | 3300003322 | rootL2_10252722 | rootL2_102527222 | 317 |
| 115 | 3300050510 | nmdc:mga06r32_278936_c1 | nmdc:mga06r32_278936_c1_497_1582 | 317 |
| 116 | 3300006195 | Ga0075366_10108849 | Ga0075366_101088492 | 318 |
| 117 | 3300031852 | Ga0307410_10016146 | Ga0307410_100161461 | 318 |
| 118 | 3300032002 | Ga0307416_100000380 | Ga0307416_1000003802 | 318 |
| 119 | 3300032126 | Ga0307415_100000359 | Ga0307415_1000003593 | 318 |
| 120 | 3300046674 | Ga0495588_0000320 | Ga0495588_0000320_11210_12367 | 318 |
| 121 | 3300050490 | nmdc:mga03n38_12148_c1 | nmdc:mga03n38_12148_c1_708_1892 | 318 |
| 122 | 3300050491 | nmdc:mga00v17_99797_c1 | nmdc:mga00v17_99797_c1_545_1729 | 318 |
| 123 | 3300050492 | nmdc:mga0yw44_36429_c1 | nmdc:mga0yw44_36429_c1_161_1345 | 318 |
| 124 | 3300003322 | rootL2_10065873 | rootL2_100658734 | 319 |
| 125 | 3300005981 | Ga0081538_10031213 | Ga0081538_100312134 | 319 |
| 126 | 3300037471 | Ga0395905_0060822 | Ga0395905_0060822_78_1235 | 319 |
| 127 | 3300006051 | Ga0075364_10082485 | Ga0075364_100824852 | 320 |
| 128 | 3300048091 | Ga0495626_0000287 | Ga0495626_0000287_1862_3040 | 320 |
| 129 | 3300049741 | Ga0501079_0243121 | Ga0501079_0243121_290_1396 | 320 |
| 130 | 3300050512 | nmdc:mga0n895_75930_c1 | nmdc:mga0n895_75930_c1_492_1613 | 321 |
| 131 | 3300048927 | Ga0496124_0118295 | Ga0496124_0118295_197_1354 | 322 |
| 132 | 3300049568 | Ga0501031_0008641 | Ga0501031_0008641_5462_6595 | 322 |
| 133 | 3300049572 | Ga0501036_0002792 | Ga0501036_0002792_10121_11254 | 322 |
| 134 | 3300049573 | Ga0501037_0221767 | Ga0501037_0221767_71_1204 | 322 |
| 135 | 3300049574 | Ga0501038_0001494 | Ga0501038_0001494_7250_8383 | 322 |
| 136 | 3300049575 | Ga0501039_0007056 | Ga0501039_0007056_6269_7402 | 322 |
| 137 | 3300049576 | Ga0501040_0000886 | Ga0501040_0000886_9448_10581 | 322 |
| 138 | 3300049577 | Ga0501041_0000465 | Ga0501041_0000465_6135_7268 | 322 |
| 139 | 3300049578 | Ga0501042_0000128 | Ga0501042_0000128_7538_8671 | 322 |
| 140 | 3300049580 | Ga0501046_0000729 | Ga0501046_0000729_13100_14233 | 322 |
| 141 | 3300049582 | Ga0501048_0000491 | Ga0501048_0000491_13230_14363 | 322 |
| 142 | 3300049584 | Ga0501068_0000962 | Ga0501068_0000962_5646_6779 | 322 |
| 143 | 3300049587 | Ga0501071_0000790 | Ga0501071_0000790_13171_14304 | 322 |
| 144 | 3300049588 | Ga0501072_0001467 | Ga0501072_0001467_7373_8506 | 322 |
| 145 | 3300049590 | Ga0501074_0003739 | Ga0501074_0003739_1350_2483 | 322 |
| 146 | 3300049591 | Ga0501075_0002545 | Ga0501075_0002545_9448_10581 | 322 |
| 147 | 3300049592 | Ga0501076_0000165 | Ga0501076_0000165_7354_8487 | 322 |
| 148 | 3300049593 | Ga0501077_0001013 | Ga0501077_0001013_13260_14393 | 322 |
| 149 | 3300049741 | Ga0501079_0002052 | Ga0501079_0002052_7754_8887 | 322 |
| 150 | 3300049742 | Ga0501080_0002214 | Ga0501080_0002214_7466_8599 | 322 |
| 151 | 3300049743 | Ga0501081_0000258 | Ga0501081_0000258_11573_12706 | 322 |
| 152 | 3300049744 | Ga0501083_0063955 | Ga0501083_0063955_1025_2158 | 322 |
| 153 | 3300049822 | Ga0501035_0002910 | Ga0501035_0002910_9286_10419 | 322 |
| 154 | 3300049824 | Ga0501045_0000081 | Ga0501045_0000081_7702_8835 | 322 |
| 155 | 3300054114 | Ga0501084_0001443 | Ga0501084_0001443_8742_9875 | 322 |
| 156 | 3300060353 | Ga0501082_0000047 | Ga0501082_0000047_13280_14413 | 322 |
| 157 | 3300061734 | Ga0530510_0001944 | Ga0530510_0001944_5669_6802 | 322 |
| 158 | 3300061734 | Ga0530510_0159040 | Ga0530510_0159040_262_1407 | 322 |
| 159 | 3300006871 | Ga0075434_100056033 | Ga0075434_1000560333 | 323 |
| 160 | 3300007076 | Ga0075435_100184891 | Ga0075435_1001848911 | 323 |
| 161 | 3300009094 | Ga0111539_10081474 | Ga0111539_100814743 | 323 |
| 162 | 3300009094 | Ga0111539_10164969 | Ga0111539_101649692 | 323 |
| 163 | 3300009147 | Ga0114129_10253998 | Ga0114129_102539983 | 323 |
| 164 | 3300027907 | Ga0207428_10093049 | Ga0207428_100930492 | 323 |
| 165 | 3300050507 | nmdc:mga05p37_389592_c1 | nmdc:mga05p37_389592_c1_238_1389 | 323 |
| 166 | 3300050511 | nmdc:mga08y16_98237_c1 | nmdc:mga08y16_98237_c1_279_1430 | 323 |
| 167 | 3300050512 | nmdc:mga0n895_24496_c1 | nmdc:mga0n895_24496_c1_1429_2580 | 323 |
| 168 | 3300050515 | nmdc:mga0a205_1408_c1 | nmdc:mga0a205_1408_c1_12709_13860 | 323 |
| 169 | 3300005330 | Ga0070690_100177463 | Ga0070690_1001774632 | 325 |
| 170 | 3300005340 | Ga0070689_100025481 | Ga0070689_1000254812 | 325 |
| 171 | 3300005365 | Ga0070688_100004157 | Ga0070688_1000041576 | 325 |
| 172 | 3300005459 | Ga0068867_100088489 | Ga0068867_1000884893 | 325 |
| 173 | 3300005617 | Ga0068859_100283276 | Ga0068859_1002832762 | 325 |
| 174 | 3300006931 | Ga0097620_100283269 | Ga0097620_1002832692 | 325 |
| 175 | 3300026089 | Ga0207648_10027510 | Ga0207648_100275102 | 325 |
| 176 | 3300026116 | Ga0207674_10077097 | Ga0207674_100770973 | 325 |
| 177 | 3300046501 | Ga0495607_0001070 | Ga0495607_0001070_5514_6644 | 325 |
| 178 | 3300046522 | Ga0495643_0005702 | Ga0495643_0005702_6910_8040 | 325 |
| 179 | 3300046524 | Ga0495648_0004566 | Ga0495648_0004566_4832_5962 | 325 |
| 180 | 3300046665 | Ga0495661_0000989 | Ga0495661_0000989_22678_23808 | 325 |
| 181 | 3300048912 | Ga0496109_0196785 | Ga0496109_0196785_384_1514 | 325 |
| 182 | 3300005327 | Ga0070658_10007446 | Ga0070658_100074467 | 326 |
| 183 | 3300005336 | Ga0070680_100268470 | Ga0070680_1002684702 | 326 |
| 184 | 3300005337 | Ga0070682_100085025 | Ga0070682_1000850252 | 326 |
| 185 | 3300005339 | Ga0070660_100115977 | Ga0070660_1001159772 | 326 |
| 186 | 3300005344 | Ga0070661_100012104 | Ga0070661_1000121045 | 326 |
| 187 | 3300005435 | Ga0070714_100031430 | Ga0070714_1000314302 | 326 |
| 188 | 3300005535 | Ga0070684_100082393 | Ga0070684_1000823932 | 326 |
| 189 | 3300005539 | Ga0068853_100012720 | Ga0068853_1000127202 | 326 |
| 190 | 3300005578 | Ga0068854_100073215 | Ga0068854_1000732152 | 326 |
| 191 | 3300005614 | Ga0068856_100047375 | Ga0068856_1000473752 | 326 |
| 192 | 3300006914 | Ga0075436_100002000 | Ga0075436_10000200011 | 326 |
| 193 | 3300009174 | Ga0105241_10011637 | Ga0105241_100116375 | 326 |
| 194 | 3300009545 | Ga0105237_10025867 | Ga0105237_100258674 | 326 |
| 195 | 3300010375 | Ga0105239_10059855 | Ga0105239_100598553 | 326 |
| 196 | 3300013100 | Ga0157373_10062020 | Ga0157373_100620202 | 326 |
| 197 | 3300013102 | Ga0157371_10005083 | Ga0157371_100050836 | 326 |
| 198 | 3300013104 | Ga0157370_10012539 | Ga0157370_100125392 | 326 |
| 199 | 3300013307 | Ga0157372_10085171 | Ga0157372_100851714 | 326 |
| 200 | 3300020070 | Ga0206356_11172816 | Ga0206356_111728161 | 326 |
| 201 | 3300025911 | Ga0207654_10083710 | Ga0207654_100837102 | 326 |
| 202 | 3300025913 | Ga0207695_10178127 | Ga0207695_101781272 | 326 |
| 203 | 3300025917 | Ga0207660_10006505 | Ga0207660_100065056 | 326 |
| 204 | 3300025919 | Ga0207657_10001098 | Ga0207657_1000109810 | 326 |
| 205 | 3300025920 | Ga0207649_10055911 | Ga0207649_100559112 | 326 |
| 206 | 3300025924 | Ga0207694_10047615 | Ga0207694_100476152 | 326 |
| 207 | 3300025932 | Ga0207690_10076204 | Ga0207690_100762042 | 326 |
| 208 | 3300025944 | Ga0207661_10094243 | Ga0207661_100942432 | 326 |
| 209 | 3300025945 | Ga0207679_10278183 | Ga0207679_102781832 | 326 |
| 210 | 3300025949 | Ga0207667_10065500 | Ga0207667_100655002 | 326 |
| 211 | 3300025981 | Ga0207640_10237440 | Ga0207640_102374401 | 326 |
| 212 | 3300026041 | Ga0207639_10024724 | Ga0207639_100247243 | 326 |
| 213 | 3300026078 | Ga0207702_10058808 | Ga0207702_100588083 | 326 |
| 214 | 3300026116 | Ga0207674_10001534 | Ga0207674_1000153415 | 326 |
| 215 | 3300026142 | Ga0207698_10007789 | Ga0207698_100077896 | 326 |
| 216 | 3300037418 | Ga0395900_0053101 | Ga0395900_0053101_439_1608 | 326 |
| 217 | 3300037466 | Ga0395898_0161173 | Ga0395898_0161173_956_2125 | 326 |
| 218 | 3300038443 | Ga0395901_0252468 | Ga0395901_0252468_424_1593 | 326 |
| 219 | 3300042461 | Ga0439460_0007413 | Ga0439460_0007413_1131_2303 | 326 |
| 220 | 3300049593 | Ga0501077_0055258 | Ga0501077_0055258_406_1539 | 326 |
| 221 | 3300050514 | nmdc:mga08x19_18289_c1 | nmdc:mga08x19_18289_c1_1712_2863 | 326 |
| 222 | iso_pu_bacteria | 8047673197 | 8047674296 | 326 |
| 223 | 3300025945 | Ga0207679_10121194 | Ga0207679_101211942 | 327 |
| 224 | 3300032002 | Ga0307416_100020549 | Ga0307416_1000205493 | 327 |
| 225 | 3300002705 | JGI25156J39149_1008742 | JGI25156J39149_10087422 | 328 |
| 226 | 3300002738 | JGI25154J39366_1000357 | JGI25154J39366_100035719 | 328 |
| 227 | 3300003756 | Ga0055533_1001036 | Ga0055533_10010363 | 328 |
| 228 | 3300003762 | Ga0055542_1000877 | Ga0055542_100087710 | 328 |
| 229 | 3300003841 | Ga0055541_1000764 | Ga0055541_10007643 | 328 |
| 230 | 3300005549 | Ga0070704_100013564 | Ga0070704_1000135645 | 328 |
| 231 | 3300005985 | Ga0081539_10011723 | Ga0081539_100117237 | 328 |
| 232 | 3300025224 | Ga0209784_100699 | Ga0209784_1006993 | 328 |
| 233 | 3300025225 | Ga0209566_100451 | Ga0209566_1004516 | 328 |
| 234 | 3300025226 | Ga0209674_100266 | Ga0209674_10026628 | 328 |
| 235 | 3300025230 | Ga0209563_102459 | Ga0209563_1024593 | 328 |
| 236 | 3300025246 | Ga0209646_1000075 | Ga0209646_1000075121 | 328 |
| 237 | 3300025250 | Ga0209026_1001109 | Ga0209026_10011096 | 328 |
| 238 | 3300025253 | Ga0209677_103752 | Ga0209677_1037523 | 328 |
| 239 | 3300025254 | Ga0209148_1000043 | Ga0209148_100004375 | 328 |
| 240 | 3300025256 | Ga0209759_1004478 | Ga0209759_10044783 | 328 |
| 241 | 3300013104 | Ga0157370_10045204 | Ga0157370_100452044 | 330 |
| 242 | 3300032126 | Ga0307415_100064667 | Ga0307415_1000646673 | 330 |
| 243 | iso_pu_bacteria | 2522125168 | 2522553084 | 330 |
| 244 | iso_pu_bacteria | 2808606415 | 2809130977 | 330 |
| 245 | iso_pu_bacteria | 2808606419 | 2809150687 | 330 |
| 246 | iso_pu_bacteria | 2852618963 | 2852622203 | 330 |
| 247 | 3300003323 | rootH1_10254642 | rootH1_102546421 | 331 |
| 248 | 3300003763 | Ga0055529_1000683 | Ga0055529_100068311 | 331 |
| 249 | 3300003781 | Ga0055536_1001701 | Ga0055536_10017012 | 331 |
| 250 | 3300005262 | Ga0065165_1000961 | Ga0065165_100096126 | 331 |
| 251 | 3300005339 | Ga0070660_100004440 | Ga0070660_1000044402 | 331 |
| 252 | 3300005344 | Ga0070661_100009262 | Ga0070661_1000092621 | 331 |
| 253 | 3300005435 | Ga0070714_100018728 | Ga0070714_1000187284 | 331 |
| 254 | 3300005436 | Ga0070713_100004716 | Ga0070713_1000047168 | 331 |
| 255 | 3300005518 | Ga0070699_100056271 | Ga0070699_1000562715 | 331 |
| 256 | 3300005564 | Ga0070664_100033715 | Ga0070664_1000337152 | 331 |
| 257 | 3300013307 | Ga0157372_10311565 | Ga0157372_103115652 | 331 |
| 258 | 3300025292 | Ga0209676_1001625 | Ga0209676_100162523 | 331 |
| 259 | 3300025898 | Ga0207692_10043526 | Ga0207692_100435262 | 331 |
| 260 | 3300025919 | Ga0207657_10008847 | Ga0207657_100088473 | 331 |
| 261 | 3300025920 | Ga0207649_10023464 | Ga0207649_100234643 | 331 |
| 262 | 3300025929 | Ga0207664_10001871 | Ga0207664_100018714 | 331 |
| 263 | 3300025932 | Ga0207690_10081099 | Ga0207690_100810992 | 331 |
| 264 | 3300042876 | Ga0451577_0057728 | Ga0451577_0057728_1267_2577 | 331 |
| 265 | 3300046474 | Ga0495605_0002979 | Ga0495605_0002979_8626_9834 | 331 |
| 266 | 3300046500 | Ga0495596_0000320 | Ga0495596_0000320_24041_25249 | 331 |
| 267 | 3300046512 | Ga0495610_0000514 | Ga0495610_0000514_13669_14877 | 331 |
| 268 | 3300046513 | Ga0495616_0000795 | Ga0495616_0000795_5252_6460 | 331 |
| 269 | 3300046524 | Ga0495648_0016037 | Ga0495648_0016037_1737_2945 | 331 |
| 270 | 3300046538 | Ga0495609_0003276 | Ga0495609_0003276_645_1853 | 331 |
| 271 | 3300046665 | Ga0495661_0010688 | Ga0495661_0010688_2167_3375 | 331 |
| 272 | 3300046692 | Ga0495671_0002529 | Ga0495671_0002529_5195_6403 | 331 |
| 273 | 3300046694 | Ga0495649_0007815 | Ga0495649_0007815_2165_3373 | 331 |
| 274 | 3300048919 | Ga0496116_0005772 | Ga0496116_0005772_6735_7943 | 331 |
| 275 | 3300048924 | Ga0496121_0016225 | Ga0496121_0016225_3324_4532 | 331 |
| 276 | 3300048925 | Ga0496122_0005998 | Ga0496122_0005998_6022_7230 | 331 |
| 277 | 3300048926 | Ga0496123_0001721 | Ga0496123_0001721_20619_21827 | 331 |
| 278 | 3300048928 | Ga0496125_0043781 | Ga0496125_0043781_1409_2617 | 331 |
| 279 | 3300049585 | Ga0501069_0085910 | Ga0501069_0085910_350_1513 | 331 |
| 280 | 3300005331 | Ga0070670_100115508 | Ga0070670_1001155082 | 332 |
| 281 | 3300025925 | Ga0207650_10040171 | Ga0207650_100401712 | 332 |
| 282 | 3300013104 | Ga0157370_10100675 | Ga0157370_101006752 | 333 |
| 283 | 3300013104 | Ga0157370_10180258 | Ga0157370_101802582 | 333 |
| 284 | 3300025949 | Ga0207667_10166299 | Ga0207667_101662992 | 333 |
| 285 | 3300045836 | Ga0466958_0151124 | Ga0466958_0151124_108_1316 | 333 |
| 286 | 2162886012 | MBSR1b_contig_4194132 | MBSR1b_0537.00006370 | 337 |
| 287 | 3300005328 | Ga0070676_10166363 | Ga0070676_101663632 | 337 |
| 288 | 3300005330 | Ga0070690_100124811 | Ga0070690_1001248111 | 337 |
| 289 | 3300005331 | Ga0070670_100292200 | Ga0070670_1002922002 | 337 |
| 290 | 3300005338 | Ga0068868_100055655 | Ga0068868_1000556553 | 337 |
| 291 | 3300005339 | Ga0070660_100199184 | Ga0070660_1001991842 | 337 |
| 292 | 3300005340 | Ga0070689_100002163 | Ga0070689_1000021633 | 337 |
| 293 | 3300005343 | Ga0070687_100009558 | Ga0070687_1000095582 | 337 |
| 294 | 3300005353 | Ga0070669_100006864 | Ga0070669_1000068647 | 337 |
| 295 | 3300005354 | Ga0070675_100001644 | Ga0070675_10000164412 | 337 |
| 296 | 3300005365 | Ga0070688_100000676 | Ga0070688_1000006766 | 337 |
| 297 | 3300005466 | Ga0070685_10011405 | Ga0070685_100114053 | 337 |
| 298 | 3300005840 | Ga0068870_10007759 | Ga0068870_100077592 | 337 |
| 299 | 3300005842 | Ga0068858_100425170 | Ga0068858_1004251702 | 337 |
| 300 | 3300009094 | Ga0111539_10026917 | Ga0111539_100269174 | 337 |
| 301 | 3300013308 | Ga0157375_10013344 | Ga0157375_100133447 | 337 |
| 302 | 3300025908 | Ga0207643_10002130 | Ga0207643_100021302 | 337 |
| 303 | 3300025923 | Ga0207681_10013596 | Ga0207681_100135964 | 337 |
| 304 | 3300025926 | Ga0207659_10004325 | Ga0207659_100043256 | 337 |
| 305 | 3300025931 | Ga0207644_10047235 | Ga0207644_100472352 | 337 |
| 306 | 3300025936 | Ga0207670_10013282 | Ga0207670_100132823 | 337 |
| 307 | 3300025940 | Ga0207691_10055102 | Ga0207691_100551022 | 337 |
| 308 | 3300025986 | Ga0207658_10144457 | Ga0207658_101444572 | 337 |
| 309 | 3300026116 | Ga0207674_10003605 | Ga0207674_100036055 | 337 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7duw-assembly1.cif.gz_B | cryo-em structure of the multiple peptide resistance factor (mprf) loaded with two lysyl-phosphatidylglycerol molecules | 0.2344 | 2 | 308 |
| 7lbm-assembly1.cif.gz_2 | structure of the human mediator-bound transcription pre-initiation complex | 0.2057 | 1 | 277 |
| 7duw-assembly1.cif.gz_B | cryo-em structure of the multiple peptide resistance factor (mprf) loaded with two lysyl-phosphatidylglycerol molecules | 0.204 | 2 | 308 |
| 8p6a-assembly1.cif.gz_A | cryo-em structure of human slc15a4 in outward-open state | 0.1914 | 4 | 306 |
| 5x3x-assembly2.cif.gz_q | 2.8a resolution structure of a cobalt energy-coupling factor transporter-cbimqo | 0.1858 | 3 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7KV83_1_76_1.20.1440.50 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Ta0600-like | 0.4003 | 25 | 82 | 1.20.1440.50 |
| af_K7KV83_1_76_1.20.1440.50 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Ta0600-like | 0.3228 | 25 | 82 | 1.20.1440.50 |
| af_A0A1D6HQR2_118_260_1.20.120.290 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle | 0.2498 | 187 | 292 | 1.20.120.290 |
| af_A8WFN1_1_205_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.2493 | 2 | 202 | 1.20.140.150 |
| af_A8WFN1_1_205_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.238 | 2 | 202 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7XKC4-F1-model_v4 | Chromate transporter | 0.9762 | 6 | 103 |
GO:0005886
GO:0015109 |
| AF-A0A535KX82-F1-model_v4 | Chromate transporter | 0.9755 | 6 | 89 |
GO:0005886
GO:0015109 |
| AF-A0A537IXV7-F1-model_v4 | Chromate transporter | 0.9587 | 6 | 89 |
GO:0005886
GO:0015109 |
| AF-A0A351QSS7-F1-model_v4 | Chromate transporter | 0.9401 | 203 | 310 |
GO:0005886
GO:0015109 |
| AF-A0A2V7PUI8-F1-model_v4 | Chromate transporter | 0.9271 | 1 | 108 |
GO:0005886
GO:0015109 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar