F400210

General Info

Members Datasets Scaffolds Average Seq Length
309 222 304 369

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10180258|Ga0157370_101802582
Length 418
Sequence MTALASNQPAASNGRDVSAEVLSIRRRTTMDNAGYSLAAMARYFLKLGTIGFGGPVALVGYMYRDLVESRRWISEEDYKEGLTLAQLMPGPLAAQLAMYLGYVHYRVPGATVVGAAFVLPSFVMVVAIGFAYVRFGGLPWMQAVFYGVGAAVIGIIAISAYKLTTKNVGRDRLLWLIFVLTAAFTVWTQSESVWLFLGGGVLVWWVRASPKRSLGKSIAPALAAIDSHGPPATSMLSSVDWSLLAQIGVFFAKAGAFVFGSGLAIVPFLYAGVVHDHPWLTERQFVDAVAVAMLTPGPVVITVGFIGYLVAGLPGACVAAFGTFLPCYLFTILPAPYFKKYGKRPALVSFVDGVTAAAIGAITGAVIVLAERSVVDIVTALIAFVTIGVVWRFKKVPEPVIVAVAAVIGLLAFSVMRR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
4 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
5 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
222 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0.32
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.47
Nodule 0
Rhizoplane 0.65
Rhizosphere 88.03
Stem 0
Stem Tuber 0
Unclassified 4.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4194132 2162886012 Bacteria 1722
2 JGI25156J39149_1008742 3300002705 Bacteria 2523
3 JGI25154J39366_1000357 3300002738 Bacteria 25865
4 rootL2_10065873 3300003322 Bacteria 3827
5 rootL2_10252722 3300003322 Bacteria 1664
6 rootH1_10254642 3300003323 Bacteria 1553
7 Ga0055533_1001036 3300003756 Bacteria 8038
8 Ga0055542_1000877 3300003762 Bacteria 20920
9 Ga0055529_1000683 3300003763 Bacteria 23311
10 Ga0055536_1001701 3300003781 Bacteria 13024
11 Ga0055541_1000764 3300003841 Bacteria 8141
12 Ga0065165_1000961 3300005262 Bacteria 36182
13 Ga0070658_10007446 3300005327 Bacteria 8837
14 Ga0070676_10166363 3300005328 Bacteria 1423
15 Ga0070690_100124811 3300005330 Bacteria 1732
16 Ga0070690_100177463 3300005330 Bacteria 1470
17 Ga0070670_100006723 3300005331 Bacteria 9747
18 Ga0070670_100115508 3300005331 Bacteria 2314
19 Ga0070670_100292200 3300005331 Bacteria 1424
20 Ga0068869_100002092 3300005334 Bacteria 12003
21 Ga0070680_100000881 3300005336 Bacteria 21276
22 Ga0070680_100268470 3300005336 Bacteria 1444
23 Ga0070682_100085025 3300005337 Bacteria 2057
24 Ga0068868_100055655 3300005338 Bacteria 3122
25 Ga0070660_100004440 3300005339 Bacteria 9692
26 Ga0070660_100115977 3300005339 Bacteria 2135
27 Ga0070660_100199184 3300005339 Bacteria 1624
28 Ga0070689_100002163 3300005340 Bacteria 12740
29 Ga0070689_100025481 3300005340 Bacteria 4443
30 Ga0070691_10024447 3300005341 Bacteria 2807
31 Ga0070687_100009558 3300005343 Bacteria 4161
32 Ga0070661_100009262 3300005344 Bacteria 6807
33 Ga0070661_100012104 3300005344 Bacteria 6031
34 Ga0070669_100006864 3300005353 Bacteria 8184
35 Ga0070675_100001644 3300005354 Bacteria 16514
36 Ga0070688_100000676 3300005365 Bacteria 16998
37 Ga0070688_100004157 3300005365 Bacteria 7510
38 Ga0070659_100000523 3300005366 Bacteria 28186
39 Ga0070703_10021945 3300005406 Bacteria 1870
40 Ga0070714_100018728 3300005435 Bacteria 5632
41 Ga0070714_100031430 3300005435 Bacteria 4429
42 Ga0070713_100004716 3300005436 Bacteria 9213
43 Ga0070701_10051393 3300005438 Bacteria 2138
44 Ga0070705_100000623 3300005440 Bacteria 20474
45 Ga0070694_100000022 3300005444 Bacteria 71609
46 Ga0070708_100271995 3300005445 Bacteria 1593
47 Ga0070663_100015602 3300005455 Bacteria 4910
48 Ga0068867_100001983 3300005459 Bacteria 14274
49 Ga0068867_100088489 3300005459 Bacteria 2347
50 Ga0070685_10011405 3300005466 Bacteria 4652
51 Ga0070707_100117019 3300005468 Bacteria 2587
52 Ga0070699_100056271 3300005518 Bacteria 3406
53 Ga0070679_100001744 3300005530 Bacteria 19580
54 Ga0070684_100082393 3300005535 Bacteria 2848
55 Ga0068853_100001043 3300005539 Bacteria 19590
56 Ga0068853_100012720 3300005539 Bacteria 6851
57 Ga0070672_100014679 3300005543 Bacteria 5557
58 Ga0070695_100007047 3300005545 Bacteria 6663
59 Ga0070704_100013564 3300005549 Bacteria 5061
60 Ga0068855_100000101 3300005563 Bacteria 105095
61 Ga0068855_100383487 3300005563 Bacteria 1543
62 Ga0070664_100007727 3300005564 Bacteria 8683
63 Ga0070664_100033715 3300005564 Bacteria 4291
64 Ga0068854_100000873 3300005578 Bacteria 18083
65 Ga0068854_100073215 3300005578 Bacteria 2510
66 Ga0068856_100002928 3300005614 Bacteria 17482
67 Ga0068856_100047375 3300005614 Bacteria 4234
68 Ga0070702_100203637 3300005615 Bacteria 1312
69 Ga0068859_100057392 3300005617 Bacteria 3921
70 Ga0068859_100283276 3300005617 Bacteria 1750
71 Ga0068864_100053328 3300005618 Bacteria 3488
72 Ga0068861_100012517 3300005719 Bacteria 5918
73 Ga0068870_10007759 3300005840 Bacteria 4799
74 Ga0068863_100099271 3300005841 Bacteria 2766
75 Ga0068858_100425170 3300005842 Bacteria 1278
76 Ga0068860_100007147 3300005843 Bacteria 11169
77 Ga0068862_100003210 3300005844 Bacteria 14171
78 Ga0081538_10031213 3300005981 Bacteria 3599
79 Ga0081539_10011723 3300005985 Bacteria 6877
80 Ga0075364_10082485 3300006051 Bacteria 2127
81 Ga0075366_10108849 3300006195 Bacteria 1666
82 Ga0075428_100006891 3300006844 Bacteria 12620
83 Ga0075428_100203460 3300006844 Bacteria 2140
84 Ga0075434_100056033 3300006871 Bacteria 3917
85 Ga0075434_100139360 3300006871 Bacteria 2445
86 Ga0075429_100002942 3300006880 Bacteria 14444
87 Ga0075436_100002000 3300006914 Bacteria 14080
88 Ga0097620_100057395 3300006931 Bacteria 3921
89 Ga0097620_100283269 3300006931 Bacteria 1750
90 Ga0075435_100184891 3300007076 Bacteria 1762
91 Ga0105240_10131148 3300009093 Bacteria 3006
92 Ga0111539_10001921 3300009094 Bacteria 27677
93 Ga0111539_10002165 3300009094 Bacteria 26287
94 Ga0111539_10004312 3300009094 Bacteria 18610
95 Ga0111539_10026917 3300009094 Bacteria 7025
96 Ga0111539_10081474 3300009094 Bacteria 3807
97 Ga0111539_10164969 3300009094 Bacteria 2590
98 Ga0114129_10253998 3300009147 Bacteria 2359
99 Ga0105241_10002364 3300009174 Bacteria 14171
100 Ga0105241_10011637 3300009174 Bacteria 6455
101 Ga0105237_10025867 3300009545 Bacteria 6000
102 Ga0105239_10059855 3300010375 Bacteria 4179
103 Ga0157373_10004145 3300013100 Bacteria 10930
104 Ga0157373_10062020 3300013100 Bacteria 2648
105 Ga0157373_10212249 3300013100 Bacteria 1365
106 Ga0157371_10005083 3300013102 Bacteria 11228
107 Ga0157370_10012539 3300013104 Bacteria 8789
108 Ga0157370_10016094 3300013104 Bacteria 7581
109 Ga0157370_10045204 3300013104 Bacteria 4226
110 Ga0157370_10100675 3300013104 Bacteria 2707
111 Ga0157370_10136568 3300013104 Bacteria 2285
112 Ga0157370_10180258 3300013104 Bacteria 1963
113 Ga0157369_10004726 3300013105 Bacteria 16006
114 Ga0157369_10014972 3300013105 Bacteria 8753
115 Ga0157372_10076960 3300013307 Bacteria 3768
116 Ga0157372_10085171 3300013307 Bacteria 3584
117 Ga0157372_10311565 3300013307 Bacteria 1832
118 Ga0157375_10013344 3300013308 Bacteria 7307
119 Ga0163163_10143231 3300014325 Unclassified 2433
120 Ga0163163_10147191 3300014325 Bacteria 2400
121 Ga0206356_11172816 3300020070 Bacteria 2198
122 Ga0209784_100699 3300025224 Bacteria 9087
123 Ga0209566_100451 3300025225 Bacteria 30269
124 Ga0209674_100266 3300025226 Bacteria 40849
125 Ga0209563_102459 3300025230 Bacteria 4183
126 Ga0209646_1000075 3300025246 Bacteria 221755
127 Ga0209026_1001109 3300025250 Bacteria 12794
128 Ga0209677_103752 3300025253 Bacteria 4735
129 Ga0209148_1000043 3300025254 Bacteria 461531
130 Ga0209148_1002574 3300025254 Bacteria 6008
131 Ga0209759_1004478 3300025256 Bacteria 5202
132 Ga0209676_1001625 3300025292 Bacteria 19883
133 Ga0207692_10043526 3300025898 Bacteria 2235
134 Ga0207647_10053366 3300025904 Bacteria 2491
135 Ga0207645_10010419 3300025907 Bacteria 6380
136 Ga0207643_10002130 3300025908 Bacteria 10884
137 Ga0207654_10083710 3300025911 Bacteria 1927
138 Ga0207707_10003397 3300025912 Bacteria 14128
139 Ga0207695_10178127 3300025913 Bacteria 2048
140 Ga0207660_10006505 3300025917 Bacteria 7583
141 Ga0207657_10000911 3300025919 Bacteria 31260
142 Ga0207657_10001098 3300025919 Bacteria 28739
143 Ga0207657_10008847 3300025919 Bacteria 10185
144 Ga0207649_10023464 3300025920 Bacteria 3573
145 Ga0207649_10055911 3300025920 Bacteria 2462
146 Ga0207681_10013596 3300025923 Bacteria 5039
147 Ga0207694_10047615 3300025924 Bacteria 3316
148 Ga0207650_10040171 3300025925 Bacteria 3422
149 Ga0207659_10004325 3300025926 Bacteria 8585
150 Ga0207664_10001871 3300025929 Bacteria 13844
151 Ga0207644_10047235 3300025931 Bacteria 3071
152 Ga0207690_10002022 3300025932 Bacteria 12431
153 Ga0207690_10076204 3300025932 Bacteria 2328
154 Ga0207690_10081099 3300025932 Bacteria 2266
155 Ga0207706_10157918 3300025933 Bacteria 1994
156 Ga0207670_10013282 3300025936 Bacteria 4849
157 Ga0207691_10055102 3300025940 Bacteria 3626
158 Ga0207689_10000005 3300025942 Bacteria 135458
159 Ga0207661_10094243 3300025944 Bacteria 2500
160 Ga0207679_10000273 3300025945 Bacteria 38920
161 Ga0207679_10121194 3300025945 Bacteria 2082
162 Ga0207679_10278183 3300025945 Bacteria 1434
163 Ga0207667_10065500 3300025949 Bacteria 3789
164 Ga0207667_10166299 3300025949 Bacteria 2268
165 Ga0207640_10005687 3300025981 Bacteria 6792
166 Ga0207640_10237440 3300025981 Bacteria 1406
167 Ga0207658_10144457 3300025986 Bacteria 1930
168 Ga0207703_10094470 3300026035 Bacteria 2521
169 Ga0207639_10002730 3300026041 Bacteria 11844
170 Ga0207639_10024724 3300026041 Bacteria 4351
171 Ga0207678_10015553 3300026067 Bacteria 6690
172 Ga0207702_10000385 3300026078 Bacteria 50280
173 Ga0207702_10058808 3300026078 Bacteria 3272
174 Ga0207641_10048209 3300026088 Bacteria 3595
175 Ga0207648_10000434 3300026089 Bacteria 46147
176 Ga0207648_10027510 3300026089 Bacteria 5048
177 Ga0207676_10221219 3300026095 Bacteria 1686
178 Ga0207674_10001534 3300026116 Bacteria 29751
179 Ga0207674_10003605 3300026116 Bacteria 18878
180 Ga0207674_10007212 3300026116 Bacteria 12975
181 Ga0207674_10077097 3300026116 Bacteria 3339
182 Ga0207675_100010922 3300026118 Bacteria 8510
183 Ga0207698_10007789 3300026142 Bacteria 6731
184 Ga0209996_1006028 3300027395 Bacteria 1559
185 Ga0209995_1009124 3300027471 Bacteria 1603
186 Ga0209966_1000492 3300027695 Bacteria 10543
187 Ga0207428_10001469 3300027907 Bacteria 24671
188 Ga0207428_10093049 3300027907 Bacteria 2339
189 Ga0268264_10010447 3300028381 Bacteria 7677
190 Ga0307410_10016146 3300031852 Bacteria 4446
191 Ga0307416_100000380 3300032002 Bacteria 23065
192 Ga0307416_100020549 3300032002 Bacteria 4715
193 Ga0307415_100000359 3300032126 Bacteria 19423
194 Ga0307415_100064667 3300032126 Bacteria 2546
195 Ga0373937_0223613 3300036401 Bacteria 1772
196 Ga0395899_0000941 3300037312 Bacteria 27377
197 Ga0395899_0026594 3300037312 Bacteria 4365
198 Ga0395900_0014113 3300037418 Bacteria 8157
199 Ga0395900_0018828 3300037418 Bacteria 7042
200 Ga0395900_0053101 3300037418 Bacteria 4171
201 Ga0395900_0101473 3300037418 Bacteria 2956
202 Ga0395898_0007957 3300037466 Bacteria 11242
203 Ga0395898_0161173 3300037466 Bacteria 2145
204 Ga0395905_0060822 3300037471 Bacteria 3532
205 Ga0395901_0252468 3300038443 Bacteria 1837
206 Ga0439459_0000197 3300042438 Bacteria 6665
207 Ga0439460_0007413 3300042461 Bacteria 2743
208 Ga0451577_0015409 3300042876 Bacteria 7113
209 Ga0451577_0057728 3300042876 Bacteria 3460
210 Ga0451577_0058733 3300042876 Bacteria 3429
211 Ga0453683_0102385 3300044673 Bacteria 1798
212 Ga0453684_0161158 3300044712 Bacteria 2653
213 Ga0453684_0194904 3300044712 Bacteria 2367
214 Ga0466957_0000150 3300044842 Bacteria 30176
215 Ga0451576_0012758 3300045051 Bacteria 9430
216 Ga0466958_0151124 3300045836 Bacteria 1465
217 Ga0495605_0002979 3300046474 Bacteria 10241
218 Ga0495605_0011173 3300046474 Bacteria 5016
219 Ga0495584_0032966 3300046491 Bacteria 2620
220 Ga0495596_0000320 3300046500 Bacteria 31290
221 Ga0495607_0001070 3300046501 Bacteria 25016
222 Ga0495607_0006020 3300046501 Bacteria 8600
223 Ga0495610_0000514 3300046512 Bacteria 39181
224 Ga0495616_0000795 3300046513 Bacteria 23104
225 Ga0495616_0002199 3300046513 Bacteria 13035
226 Ga0495643_0005702 3300046522 Bacteria 8335
227 Ga0495648_0004566 3300046524 Bacteria 11798
228 Ga0495648_0016037 3300046524 Bacteria 5410
229 Ga0495642_0031399 3300046528 Bacteria 2130
230 Ga0495609_0000009 3300046538 Bacteria 354860
231 Ga0495609_0003276 3300046538 Bacteria 9344
232 Ga0495656_0064090 3300046615 Bacteria 1613
233 Ga0495661_0000032 3300046665 Bacteria 170076
234 Ga0495661_0000989 3300046665 Bacteria 25672
235 Ga0495661_0010114 3300046665 Bacteria 6450
236 Ga0495661_0010688 3300046665 Bacteria 6252
237 Ga0495588_0000320 3300046674 Bacteria 32033
238 Ga0495671_0002529 3300046692 Bacteria 11495
239 Ga0495649_0007815 3300046694 Bacteria 6481
240 Ga0495589_0000049 3300046794 Bacteria 116553
241 Ga0495687_000024 3300047443 Bacteria 316676
242 Ga0495677_0000017 3300047445 Bacteria 121483
243 Ga0495626_0000287 3300048091 Bacteria 54612
244 Ga0496106_0019945 3300048909 Bacteria 4972
245 Ga0496109_0196785 3300048912 Bacteria 1895
246 Ga0496116_0005772 3300048919 Bacteria 11379
247 Ga0496121_0016225 3300048924 Bacteria 7707
248 Ga0496122_0005998 3300048925 Bacteria 14189
249 Ga0496123_0001721 3300048926 Bacteria 29129
250 Ga0496123_0004782 3300048926 Bacteria 13979
251 Ga0496124_0118295 3300048927 Bacteria 2121
252 Ga0496125_0043781 3300048928 Bacteria 3794
253 Ga0501031_0008641 3300049568 Bacteria 6623
254 Ga0501033_0013750 3300049570 Bacteria 6156
255 Ga0501036_0002792 3300049572 Bacteria 13832
256 Ga0501037_0221767 3300049573 Bacteria 1330
257 Ga0501038_0001494 3300049574 Bacteria 21535
258 Ga0501039_0007056 3300049575 Bacteria 8554
259 Ga0501040_0000886 3300049576 Bacteria 18812
260 Ga0501040_0023529 3300049576 Bacteria 4132
261 Ga0501041_0000465 3300049577 Bacteria 20540
262 Ga0501042_0000128 3300049578 Bacteria 32900
263 Ga0501046_0000729 3300049580 Bacteria 31807
264 Ga0501048_0000491 3300049582 Bacteria 27609
265 Ga0501068_0000962 3300049584 Bacteria 15131
266 Ga0501069_0085910 3300049585 Bacteria 1776
267 Ga0501071_0000790 3300049587 Bacteria 16882
268 Ga0501072_0001467 3300049588 Bacteria 17674
269 Ga0501074_0003739 3300049590 Bacteria 10808
270 Ga0501075_0002545 3300049591 Bacteria 12140
271 Ga0501075_0055050 3300049591 Bacteria 2993
272 Ga0501075_0085927 3300049591 Bacteria 2383
273 Ga0501076_0000165 3300049592 Bacteria 38444
274 Ga0501076_0072151 3300049592 Bacteria 2763
275 Ga0501077_0001013 3300049593 Bacteria 16971
276 Ga0501077_0055258 3300049593 Bacteria 2521
277 Ga0501079_0002052 3300049741 Bacteria 14428
278 Ga0501079_0243121 3300049741 Bacteria 1406
279 Ga0501080_0002214 3300049742 Bacteria 16896
280 Ga0501081_0000258 3300049743 Bacteria 27526
281 Ga0501083_0063955 3300049744 Bacteria 2453
282 Ga0501035_0002910 3300049822 Bacteria 16479
283 Ga0501045_0000081 3300049824 Bacteria 45827
284 nmdc:mga03n38_12148_c1 3300050490 Bacteria 3232
285 nmdc:mga00v17_99797_c1 3300050491 Bacteria 1832
286 nmdc:mga0yw44_36429_c1 3300050492 Bacteria 2899
287 nmdc:mga05p37_389592_c1 3300050507 Bacteria 1630
288 nmdc:mga09592_4023_c1 3300050508 Bacteria 11860
289 nmdc:mga06r32_278936_c1 3300050510 Bacteria 1658
290 nmdc:mga08y16_6396_c1 3300050511 Bacteria 12348
291 nmdc:mga08y16_663_c1 3300050511 Bacteria 32446
292 nmdc:mga08y16_98237_c1 3300050511 Bacteria 3049
293 nmdc:mga0n895_24496_c1 3300050512 Bacteria 5688
294 nmdc:mga0n895_75930_c1 3300050512 Bacteria 3341
295 nmdc:mga08x19_18289_c1 3300050514 Bacteria 4296
296 nmdc:mga0a205_1408_c1 3300050515 Bacteria 20393
297 nmdc:mga0a205_15176_c1 3300050515 Bacteria 7196
298 Ga0500616_0003610 3300053153 Bacteria 11664
299 Ga0501084_0001443 3300054114 Bacteria 18878
300 Ga0501084_0023325 3300054114 Bacteria 5166
301 Ga0501082_0000047 3300060353 Bacteria 86072
302 Ga0501082_0285498 3300060353 Bacteria 1437
303 Ga0530510_0001944 3300061734 Bacteria 14140
304 Ga0530510_0159040 3300061734 Bacteria 1670

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0023529 Ga0501040_0023529_17_877 238
2 3300014325 Ga0163163_10147191 Ga0163163_101471911 240
3 3300005331 Ga0070670_100006723 Ga0070670_10000672311 271
4 3300005334 Ga0068869_100002092 Ga0068869_1000020929 271
5 3300005336 Ga0070680_100000881 Ga0070680_1000008817 271
6 3300005366 Ga0070659_100000523 Ga0070659_10000052328 271
7 3300005406 Ga0070703_10021945 Ga0070703_100219451 271
8 3300005438 Ga0070701_10051393 Ga0070701_100513932 271
9 3300005440 Ga0070705_100000623 Ga0070705_1000006236 271
10 3300005444 Ga0070694_100000022 Ga0070694_10000002212 271
11 3300005455 Ga0070663_100015602 Ga0070663_1000156023 271
12 3300005459 Ga0068867_100001983 Ga0068867_1000019839 271
13 3300005530 Ga0070679_100001744 Ga0070679_10000174410 271
14 3300005539 Ga0068853_100001043 Ga0068853_1000010435 271
15 3300005543 Ga0070672_100014679 Ga0070672_1000146795 271
16 3300005563 Ga0068855_100000101 Ga0068855_10000010117 271
17 3300005564 Ga0070664_100007727 Ga0070664_10000772710 271
18 3300005578 Ga0068854_100000873 Ga0068854_1000008733 271
19 3300005614 Ga0068856_100002928 Ga0068856_10000292811 271
20 3300005615 Ga0070702_100203637 Ga0070702_1002036371 271
21 3300005617 Ga0068859_100057392 Ga0068859_1000573922 271
22 3300005618 Ga0068864_100053328 Ga0068864_1000533282 271
23 3300005719 Ga0068861_100012517 Ga0068861_1000125176 271
24 3300005843 Ga0068860_100007147 Ga0068860_1000071476 271
25 3300005844 Ga0068862_100003210 Ga0068862_1000032105 271
26 3300006931 Ga0097620_100057395 Ga0097620_1000573952 271
27 3300009174 Ga0105241_10002364 Ga0105241_100023646 271
28 3300013100 Ga0157373_10004145 Ga0157373_100041455 271
29 3300013105 Ga0157369_10014972 Ga0157369_100149722 271
30 3300025907 Ga0207645_10010419 Ga0207645_100104192 271
31 3300025912 Ga0207707_10003397 Ga0207707_100033979 271
32 3300025919 Ga0207657_10000911 Ga0207657_1000091134 271
33 3300025932 Ga0207690_10002022 Ga0207690_1000202213 271
34 3300025942 Ga0207689_10000005 Ga0207689_1000000550 271
35 3300025945 Ga0207679_10000273 Ga0207679_1000027331 271
36 3300025981 Ga0207640_10005687 Ga0207640_100056873 271
37 3300026035 Ga0207703_10094470 Ga0207703_100944703 271
38 3300026067 Ga0207678_10015553 Ga0207678_100155534 271
39 3300026078 Ga0207702_10000385 Ga0207702_1000038544 271
40 3300026088 Ga0207641_10048209 Ga0207641_100482092 271
41 3300026089 Ga0207648_10000434 Ga0207648_1000043414 271
42 3300026095 Ga0207676_10221219 Ga0207676_102212192 271
43 3300026116 Ga0207674_10007212 Ga0207674_100072123 271
44 3300026118 Ga0207675_100010922 Ga0207675_1000109222 271
45 3300028381 Ga0268264_10010447 Ga0268264_100104473 271
46 3300042438 Ga0439459_0000197 Ga0439459_0000197_1080_2198 271
47 3300053153 Ga0500616_0003610 Ga0500616_0003610_8576_9718 274
48 3300049570 Ga0501033_0013750 Ga0501033_0013750_5141_6112 275
49 3300006880 Ga0075429_100002942 Ga0075429_10000294211 278
50 3300009094 Ga0111539_10001921 Ga0111539_1000192110 278
51 3300050508 nmdc:mga09592_4023_c1 nmdc:mga09592_4023_c1_4428_5678 278
52 3300050511 nmdc:mga08y16_663_c1 nmdc:mga08y16_663_c1_13373_14623 278
53 3300005341 Ga0070691_10024447 Ga0070691_100244472 280
54 3300006871 Ga0075434_100139360 Ga0075434_1001393603 284
55 3300025904 Ga0207647_10053366 Ga0207647_100533662 286
56 3300042876 Ga0451577_0058733 Ga0451577_0058733_1016_2134 286
57 3300044712 Ga0453684_0194904 Ga0453684_0194904_1121_2239 286
58 3300026041 Ga0207639_10002730 Ga0207639_100027303 287
59 3300005445 Ga0070708_100271995 Ga0070708_1002719951 296
60 3300036401 Ga0373937_0223613 Ga0373937_0223613_387_1520 296
61 3300037418 Ga0395900_0018828 Ga0395900_0018828_10_1140 299
62 3300009094 Ga0111539_10004312 Ga0111539_1000431215 301
63 3300013105 Ga0157369_10004726 Ga0157369_100047269 301
64 3300025933 Ga0207706_10157918 Ga0207706_101579182 301
65 3300027907 Ga0207428_10001469 Ga0207428_1000146919 301
66 3300042876 Ga0451577_0015409 Ga0451577_0015409_1261_2418 301
67 3300044673 Ga0453683_0102385 Ga0453683_0102385_594_1751 301
68 3300044712 Ga0453684_0161158 Ga0453684_0161158_1019_2176 301
69 3300045051 Ga0451576_0012758 Ga0451576_0012758_3983_5140 301
70 3300050511 nmdc:mga08y16_6396_c1 nmdc:mga08y16_6396_c1_4097_5254 301
71 3300050515 nmdc:mga0a205_15176_c1 nmdc:mga0a205_15176_c1_3652_4809 301
72 3300037418 Ga0395900_0101473 Ga0395900_0101473_558_1688 303
73 3300048926 Ga0496123_0004782 Ga0496123_0004782_9508_10638 304
74 3300005545 Ga0070695_100007047 Ga0070695_1000070478 306
75 3300013307 Ga0157372_10076960 Ga0157372_100769606 306
76 3300027395 Ga0209996_1006028 Ga0209996_10060282 306
77 3300027471 Ga0209995_1009124 Ga0209995_10091242 306
78 3300027695 Ga0209966_1000492 Ga0209966_10004922 306
79 3300037312 Ga0395899_0000941 Ga0395899_0000941_3905_5077 306
80 3300037466 Ga0395898_0007957 Ga0395898_0007957_7794_8966 306
81 3300046615 Ga0495656_0064090 Ga0495656_0064090_253_1350 306
82 3300049591 Ga0501075_0085927 Ga0501075_0085927_1299_2363 306
83 3300025254 Ga0209148_1002574 Ga0209148_10025743 308
84 3300037312 Ga0395899_0026594 Ga0395899_0026594_1982_3139 308
85 3300037418 Ga0395900_0014113 Ga0395900_0014113_1540_2697 308
86 3300046665 Ga0495661_0010114 Ga0495661_0010114_5159_6316 308
87 3300048909 Ga0496106_0019945 Ga0496106_0019945_1098_2255 308
88 3300006844 Ga0075428_100006891 Ga0075428_10000689114 310
89 3300009094 Ga0111539_10002165 Ga0111539_1000216518 310
90 3300054114 Ga0501084_0023325 Ga0501084_0023325_3683_4855 310
91 3300060353 Ga0501082_0285498 Ga0501082_0285498_175_1347 310
92 3300006844 Ga0075428_100203460 Ga0075428_1002034603 311
93 3300014325 Ga0163163_10143231 Ga0163163_101432313 311
94 3300044842 Ga0466957_0000150 Ga0466957_0000150_19279_20442 311
95 3300005468 Ga0070707_100117019 Ga0070707_1001170192 312
96 3300013104 Ga0157370_10136568 Ga0157370_101365682 313
97 3300005563 Ga0068855_100383487 Ga0068855_1003834872 315
98 3300005841 Ga0068863_100099271 Ga0068863_1000992712 315
99 3300046474 Ga0495605_0011173 Ga0495605_0011173_1111_2289 315
100 3300046491 Ga0495584_0032966 Ga0495584_0032966_831_2009 315
101 3300046501 Ga0495607_0006020 Ga0495607_0006020_5068_6246 315
102 3300046513 Ga0495616_0002199 Ga0495616_0002199_4191_5369 315
103 3300046528 Ga0495642_0031399 Ga0495642_0031399_524_1702 315
104 3300046538 Ga0495609_0000009 Ga0495609_0000009_29152_30330 315
105 3300046665 Ga0495661_0000032 Ga0495661_0000032_124066_125244 315
106 3300046794 Ga0495589_0000049 Ga0495589_0000049_16255_17433 315
107 3300047443 Ga0495687_000024 Ga0495687_000024_116203_117381 315
108 3300047445 Ga0495677_0000017 Ga0495677_0000017_4110_5288 315
109 3300049591 Ga0501075_0055050 Ga0501075_0055050_1278_2450 315
110 3300049592 Ga0501076_0072151 Ga0501076_0072151_1380_2552 315
111 3300009093 Ga0105240_10131148 Ga0105240_101311483 316
112 3300013100 Ga0157373_10212249 Ga0157373_102122491 316
113 3300013104 Ga0157370_10016094 Ga0157370_100160946 316
114 3300003322 rootL2_10252722 rootL2_102527222 317
115 3300050510 nmdc:mga06r32_278936_c1 nmdc:mga06r32_278936_c1_497_1582 317
116 3300006195 Ga0075366_10108849 Ga0075366_101088492 318
117 3300031852 Ga0307410_10016146 Ga0307410_100161461 318
118 3300032002 Ga0307416_100000380 Ga0307416_1000003802 318
119 3300032126 Ga0307415_100000359 Ga0307415_1000003593 318
120 3300046674 Ga0495588_0000320 Ga0495588_0000320_11210_12367 318
121 3300050490 nmdc:mga03n38_12148_c1 nmdc:mga03n38_12148_c1_708_1892 318
122 3300050491 nmdc:mga00v17_99797_c1 nmdc:mga00v17_99797_c1_545_1729 318
123 3300050492 nmdc:mga0yw44_36429_c1 nmdc:mga0yw44_36429_c1_161_1345 318
124 3300003322 rootL2_10065873 rootL2_100658734 319
125 3300005981 Ga0081538_10031213 Ga0081538_100312134 319
126 3300037471 Ga0395905_0060822 Ga0395905_0060822_78_1235 319
127 3300006051 Ga0075364_10082485 Ga0075364_100824852 320
128 3300048091 Ga0495626_0000287 Ga0495626_0000287_1862_3040 320
129 3300049741 Ga0501079_0243121 Ga0501079_0243121_290_1396 320
130 3300050512 nmdc:mga0n895_75930_c1 nmdc:mga0n895_75930_c1_492_1613 321
131 3300048927 Ga0496124_0118295 Ga0496124_0118295_197_1354 322
132 3300049568 Ga0501031_0008641 Ga0501031_0008641_5462_6595 322
133 3300049572 Ga0501036_0002792 Ga0501036_0002792_10121_11254 322
134 3300049573 Ga0501037_0221767 Ga0501037_0221767_71_1204 322
135 3300049574 Ga0501038_0001494 Ga0501038_0001494_7250_8383 322
136 3300049575 Ga0501039_0007056 Ga0501039_0007056_6269_7402 322
137 3300049576 Ga0501040_0000886 Ga0501040_0000886_9448_10581 322
138 3300049577 Ga0501041_0000465 Ga0501041_0000465_6135_7268 322
139 3300049578 Ga0501042_0000128 Ga0501042_0000128_7538_8671 322
140 3300049580 Ga0501046_0000729 Ga0501046_0000729_13100_14233 322
141 3300049582 Ga0501048_0000491 Ga0501048_0000491_13230_14363 322
142 3300049584 Ga0501068_0000962 Ga0501068_0000962_5646_6779 322
143 3300049587 Ga0501071_0000790 Ga0501071_0000790_13171_14304 322
144 3300049588 Ga0501072_0001467 Ga0501072_0001467_7373_8506 322
145 3300049590 Ga0501074_0003739 Ga0501074_0003739_1350_2483 322
146 3300049591 Ga0501075_0002545 Ga0501075_0002545_9448_10581 322
147 3300049592 Ga0501076_0000165 Ga0501076_0000165_7354_8487 322
148 3300049593 Ga0501077_0001013 Ga0501077_0001013_13260_14393 322
149 3300049741 Ga0501079_0002052 Ga0501079_0002052_7754_8887 322
150 3300049742 Ga0501080_0002214 Ga0501080_0002214_7466_8599 322
151 3300049743 Ga0501081_0000258 Ga0501081_0000258_11573_12706 322
152 3300049744 Ga0501083_0063955 Ga0501083_0063955_1025_2158 322
153 3300049822 Ga0501035_0002910 Ga0501035_0002910_9286_10419 322
154 3300049824 Ga0501045_0000081 Ga0501045_0000081_7702_8835 322
155 3300054114 Ga0501084_0001443 Ga0501084_0001443_8742_9875 322
156 3300060353 Ga0501082_0000047 Ga0501082_0000047_13280_14413 322
157 3300061734 Ga0530510_0001944 Ga0530510_0001944_5669_6802 322
158 3300061734 Ga0530510_0159040 Ga0530510_0159040_262_1407 322
159 3300006871 Ga0075434_100056033 Ga0075434_1000560333 323
160 3300007076 Ga0075435_100184891 Ga0075435_1001848911 323
161 3300009094 Ga0111539_10081474 Ga0111539_100814743 323
162 3300009094 Ga0111539_10164969 Ga0111539_101649692 323
163 3300009147 Ga0114129_10253998 Ga0114129_102539983 323
164 3300027907 Ga0207428_10093049 Ga0207428_100930492 323
165 3300050507 nmdc:mga05p37_389592_c1 nmdc:mga05p37_389592_c1_238_1389 323
166 3300050511 nmdc:mga08y16_98237_c1 nmdc:mga08y16_98237_c1_279_1430 323
167 3300050512 nmdc:mga0n895_24496_c1 nmdc:mga0n895_24496_c1_1429_2580 323
168 3300050515 nmdc:mga0a205_1408_c1 nmdc:mga0a205_1408_c1_12709_13860 323
169 3300005330 Ga0070690_100177463 Ga0070690_1001774632 325
170 3300005340 Ga0070689_100025481 Ga0070689_1000254812 325
171 3300005365 Ga0070688_100004157 Ga0070688_1000041576 325
172 3300005459 Ga0068867_100088489 Ga0068867_1000884893 325
173 3300005617 Ga0068859_100283276 Ga0068859_1002832762 325
174 3300006931 Ga0097620_100283269 Ga0097620_1002832692 325
175 3300026089 Ga0207648_10027510 Ga0207648_100275102 325
176 3300026116 Ga0207674_10077097 Ga0207674_100770973 325
177 3300046501 Ga0495607_0001070 Ga0495607_0001070_5514_6644 325
178 3300046522 Ga0495643_0005702 Ga0495643_0005702_6910_8040 325
179 3300046524 Ga0495648_0004566 Ga0495648_0004566_4832_5962 325
180 3300046665 Ga0495661_0000989 Ga0495661_0000989_22678_23808 325
181 3300048912 Ga0496109_0196785 Ga0496109_0196785_384_1514 325
182 3300005327 Ga0070658_10007446 Ga0070658_100074467 326
183 3300005336 Ga0070680_100268470 Ga0070680_1002684702 326
184 3300005337 Ga0070682_100085025 Ga0070682_1000850252 326
185 3300005339 Ga0070660_100115977 Ga0070660_1001159772 326
186 3300005344 Ga0070661_100012104 Ga0070661_1000121045 326
187 3300005435 Ga0070714_100031430 Ga0070714_1000314302 326
188 3300005535 Ga0070684_100082393 Ga0070684_1000823932 326
189 3300005539 Ga0068853_100012720 Ga0068853_1000127202 326
190 3300005578 Ga0068854_100073215 Ga0068854_1000732152 326
191 3300005614 Ga0068856_100047375 Ga0068856_1000473752 326
192 3300006914 Ga0075436_100002000 Ga0075436_10000200011 326
193 3300009174 Ga0105241_10011637 Ga0105241_100116375 326
194 3300009545 Ga0105237_10025867 Ga0105237_100258674 326
195 3300010375 Ga0105239_10059855 Ga0105239_100598553 326
196 3300013100 Ga0157373_10062020 Ga0157373_100620202 326
197 3300013102 Ga0157371_10005083 Ga0157371_100050836 326
198 3300013104 Ga0157370_10012539 Ga0157370_100125392 326
199 3300013307 Ga0157372_10085171 Ga0157372_100851714 326
200 3300020070 Ga0206356_11172816 Ga0206356_111728161 326
201 3300025911 Ga0207654_10083710 Ga0207654_100837102 326
202 3300025913 Ga0207695_10178127 Ga0207695_101781272 326
203 3300025917 Ga0207660_10006505 Ga0207660_100065056 326
204 3300025919 Ga0207657_10001098 Ga0207657_1000109810 326
205 3300025920 Ga0207649_10055911 Ga0207649_100559112 326
206 3300025924 Ga0207694_10047615 Ga0207694_100476152 326
207 3300025932 Ga0207690_10076204 Ga0207690_100762042 326
208 3300025944 Ga0207661_10094243 Ga0207661_100942432 326
209 3300025945 Ga0207679_10278183 Ga0207679_102781832 326
210 3300025949 Ga0207667_10065500 Ga0207667_100655002 326
211 3300025981 Ga0207640_10237440 Ga0207640_102374401 326
212 3300026041 Ga0207639_10024724 Ga0207639_100247243 326
213 3300026078 Ga0207702_10058808 Ga0207702_100588083 326
214 3300026116 Ga0207674_10001534 Ga0207674_1000153415 326
215 3300026142 Ga0207698_10007789 Ga0207698_100077896 326
216 3300037418 Ga0395900_0053101 Ga0395900_0053101_439_1608 326
217 3300037466 Ga0395898_0161173 Ga0395898_0161173_956_2125 326
218 3300038443 Ga0395901_0252468 Ga0395901_0252468_424_1593 326
219 3300042461 Ga0439460_0007413 Ga0439460_0007413_1131_2303 326
220 3300049593 Ga0501077_0055258 Ga0501077_0055258_406_1539 326
221 3300050514 nmdc:mga08x19_18289_c1 nmdc:mga08x19_18289_c1_1712_2863 326
222 iso_pu_bacteria 8047673197 8047674296 326
223 3300025945 Ga0207679_10121194 Ga0207679_101211942 327
224 3300032002 Ga0307416_100020549 Ga0307416_1000205493 327
225 3300002705 JGI25156J39149_1008742 JGI25156J39149_10087422 328
226 3300002738 JGI25154J39366_1000357 JGI25154J39366_100035719 328
227 3300003756 Ga0055533_1001036 Ga0055533_10010363 328
228 3300003762 Ga0055542_1000877 Ga0055542_100087710 328
229 3300003841 Ga0055541_1000764 Ga0055541_10007643 328
230 3300005549 Ga0070704_100013564 Ga0070704_1000135645 328
231 3300005985 Ga0081539_10011723 Ga0081539_100117237 328
232 3300025224 Ga0209784_100699 Ga0209784_1006993 328
233 3300025225 Ga0209566_100451 Ga0209566_1004516 328
234 3300025226 Ga0209674_100266 Ga0209674_10026628 328
235 3300025230 Ga0209563_102459 Ga0209563_1024593 328
236 3300025246 Ga0209646_1000075 Ga0209646_1000075121 328
237 3300025250 Ga0209026_1001109 Ga0209026_10011096 328
238 3300025253 Ga0209677_103752 Ga0209677_1037523 328
239 3300025254 Ga0209148_1000043 Ga0209148_100004375 328
240 3300025256 Ga0209759_1004478 Ga0209759_10044783 328
241 3300013104 Ga0157370_10045204 Ga0157370_100452044 330
242 3300032126 Ga0307415_100064667 Ga0307415_1000646673 330
243 iso_pu_bacteria 2522125168 2522553084 330
244 iso_pu_bacteria 2808606415 2809130977 330
245 iso_pu_bacteria 2808606419 2809150687 330
246 iso_pu_bacteria 2852618963 2852622203 330
247 3300003323 rootH1_10254642 rootH1_102546421 331
248 3300003763 Ga0055529_1000683 Ga0055529_100068311 331
249 3300003781 Ga0055536_1001701 Ga0055536_10017012 331
250 3300005262 Ga0065165_1000961 Ga0065165_100096126 331
251 3300005339 Ga0070660_100004440 Ga0070660_1000044402 331
252 3300005344 Ga0070661_100009262 Ga0070661_1000092621 331
253 3300005435 Ga0070714_100018728 Ga0070714_1000187284 331
254 3300005436 Ga0070713_100004716 Ga0070713_1000047168 331
255 3300005518 Ga0070699_100056271 Ga0070699_1000562715 331
256 3300005564 Ga0070664_100033715 Ga0070664_1000337152 331
257 3300013307 Ga0157372_10311565 Ga0157372_103115652 331
258 3300025292 Ga0209676_1001625 Ga0209676_100162523 331
259 3300025898 Ga0207692_10043526 Ga0207692_100435262 331
260 3300025919 Ga0207657_10008847 Ga0207657_100088473 331
261 3300025920 Ga0207649_10023464 Ga0207649_100234643 331
262 3300025929 Ga0207664_10001871 Ga0207664_100018714 331
263 3300025932 Ga0207690_10081099 Ga0207690_100810992 331
264 3300042876 Ga0451577_0057728 Ga0451577_0057728_1267_2577 331
265 3300046474 Ga0495605_0002979 Ga0495605_0002979_8626_9834 331
266 3300046500 Ga0495596_0000320 Ga0495596_0000320_24041_25249 331
267 3300046512 Ga0495610_0000514 Ga0495610_0000514_13669_14877 331
268 3300046513 Ga0495616_0000795 Ga0495616_0000795_5252_6460 331
269 3300046524 Ga0495648_0016037 Ga0495648_0016037_1737_2945 331
270 3300046538 Ga0495609_0003276 Ga0495609_0003276_645_1853 331
271 3300046665 Ga0495661_0010688 Ga0495661_0010688_2167_3375 331
272 3300046692 Ga0495671_0002529 Ga0495671_0002529_5195_6403 331
273 3300046694 Ga0495649_0007815 Ga0495649_0007815_2165_3373 331
274 3300048919 Ga0496116_0005772 Ga0496116_0005772_6735_7943 331
275 3300048924 Ga0496121_0016225 Ga0496121_0016225_3324_4532 331
276 3300048925 Ga0496122_0005998 Ga0496122_0005998_6022_7230 331
277 3300048926 Ga0496123_0001721 Ga0496123_0001721_20619_21827 331
278 3300048928 Ga0496125_0043781 Ga0496125_0043781_1409_2617 331
279 3300049585 Ga0501069_0085910 Ga0501069_0085910_350_1513 331
280 3300005331 Ga0070670_100115508 Ga0070670_1001155082 332
281 3300025925 Ga0207650_10040171 Ga0207650_100401712 332
282 3300013104 Ga0157370_10100675 Ga0157370_101006752 333
283 3300013104 Ga0157370_10180258 Ga0157370_101802582 333
284 3300025949 Ga0207667_10166299 Ga0207667_101662992 333
285 3300045836 Ga0466958_0151124 Ga0466958_0151124_108_1316 333
286 2162886012 MBSR1b_contig_4194132 MBSR1b_0537.00006370 337
287 3300005328 Ga0070676_10166363 Ga0070676_101663632 337
288 3300005330 Ga0070690_100124811 Ga0070690_1001248111 337
289 3300005331 Ga0070670_100292200 Ga0070670_1002922002 337
290 3300005338 Ga0068868_100055655 Ga0068868_1000556553 337
291 3300005339 Ga0070660_100199184 Ga0070660_1001991842 337
292 3300005340 Ga0070689_100002163 Ga0070689_1000021633 337
293 3300005343 Ga0070687_100009558 Ga0070687_1000095582 337
294 3300005353 Ga0070669_100006864 Ga0070669_1000068647 337
295 3300005354 Ga0070675_100001644 Ga0070675_10000164412 337
296 3300005365 Ga0070688_100000676 Ga0070688_1000006766 337
297 3300005466 Ga0070685_10011405 Ga0070685_100114053 337
298 3300005840 Ga0068870_10007759 Ga0068870_100077592 337
299 3300005842 Ga0068858_100425170 Ga0068858_1004251702 337
300 3300009094 Ga0111539_10026917 Ga0111539_100269174 337
301 3300013308 Ga0157375_10013344 Ga0157375_100133447 337
302 3300025908 Ga0207643_10002130 Ga0207643_100021302 337
303 3300025923 Ga0207681_10013596 Ga0207681_100135964 337
304 3300025926 Ga0207659_10004325 Ga0207659_100043256 337
305 3300025931 Ga0207644_10047235 Ga0207644_100472352 337
306 3300025936 Ga0207670_10013282 Ga0207670_100132823 337
307 3300025940 Ga0207691_10055102 Ga0207691_100551022 337
308 3300025986 Ga0207658_10144457 Ga0207658_101444572 337
309 3300026116 Ga0207674_10003605 Ga0207674_100036055 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

245

410

0.96

PF02417

Chromate_transp

Chromate transporter

38

204

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7duw-assembly1.cif.gz_B cryo-em structure of the multiple peptide resistance factor (mprf) loaded with two lysyl-phosphatidylglycerol molecules 0.2344 2 308
7lbm-assembly1.cif.gz_2 structure of the human mediator-bound transcription pre-initiation complex 0.2057 1 277
7duw-assembly1.cif.gz_B cryo-em structure of the multiple peptide resistance factor (mprf) loaded with two lysyl-phosphatidylglycerol molecules 0.204 2 308
8p6a-assembly1.cif.gz_A cryo-em structure of human slc15a4 in outward-open state 0.1914 4 306
5x3x-assembly2.cif.gz_q 2.8a resolution structure of a cobalt energy-coupling factor transporter-cbimqo 0.1858 3 193
ID Description Score Start End Superfamily
af_K7KV83_1_76_1.20.1440.50 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Ta0600-like 0.4003 25 82 1.20.1440.50
af_K7KV83_1_76_1.20.1440.50 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Ta0600-like 0.3228 25 82 1.20.1440.50
af_A0A1D6HQR2_118_260_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.2498 187 292 1.20.120.290
af_A8WFN1_1_205_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.2493 2 202 1.20.140.150
af_A8WFN1_1_205_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.238 2 202 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2V7XKC4-F1-model_v4 Chromate transporter 0.9762 6 103 GO:0005886
GO:0015109
AF-A0A535KX82-F1-model_v4 Chromate transporter 0.9755 6 89 GO:0005886
GO:0015109
AF-A0A537IXV7-F1-model_v4 Chromate transporter 0.9587 6 89 GO:0005886
GO:0015109
AF-A0A351QSS7-F1-model_v4 Chromate transporter 0.9401 203 310 GO:0005886
GO:0015109
AF-A0A2V7PUI8-F1-model_v4 Chromate transporter 0.9271 1 108 GO:0005886
GO:0015109

Feature Viewer

pLDDT pTM Quality
76.15 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map